diff --git a/glide.lock b/glide.lock index d3d863a81..92236b574 100644 --- a/glide.lock +++ b/glide.lock @@ -1,5 +1,5 @@ hash: 8349c21c53c639aa79752c4e4b07e323ddb4f05be783564d7de687afbb6f2d67 -updated: 2017-03-28T22:35:17.448681338+02:00 +updated: 2017-04-07T10:06:47.901457262+01:00 imports: - name: bitbucket.org/ww/goautoneg version: 75cd24fc2f2c2a2088577d12123ddee5f54e0675 @@ -69,7 +69,7 @@ imports: subpackages: - quantile - name: github.com/blang/semver - version: 3a37c301dda64cbe17f16f661b4c976803c0e2d2 + version: 31b736133b98f26d5e078ec9eb591666edfd091f - name: github.com/boltdb/bolt version: 5cc10bbbc5c141029940133bb33c9e969512a698 - name: github.com/BurntSushi/toml @@ -101,7 +101,7 @@ imports: - pkg/pathutil - pkg/types - name: github.com/coreos/go-oidc - version: 9e117111587506b9dc83b7b38263268bf48352ea + version: 5644a2f50e2d2d5ba0b474bc5bc55fea1925936d subpackages: - http - jose @@ -198,7 +198,7 @@ imports: - name: github.com/gambol99/go-marathon version: 6b00a5b651b1beb2c6821863f7c60df490bd46c8 - name: github.com/ghodss/yaml - version: 04f313413ffd65ce25f2541bfd2b2ceec5c0908c + version: 73d445a93680fa1a78ae23a5839bad48f32ba1ee - name: github.com/go-ini/ini version: 6f66b0e091edb3c7b380f7c4f0f884274d550b67 - name: github.com/go-kit/kit @@ -208,13 +208,13 @@ imports: - metrics/internal/lv - metrics/prometheus - name: github.com/go-openapi/jsonpointer - version: 8d96a2dc61536b690bd36b2e9df0b3c0b62825b2 + version: 46af16f9f7b149af66e5d1bd010e3574dc06de98 - name: github.com/go-openapi/jsonreference - version: 36d33bfe519efae5632669801b180bf1a245da3b + version: 13c6e3589ad90f49bd3e3bbe2c2cb3d7a4142272 - name: github.com/go-openapi/spec - version: 34b5ffff717ab4535aef76e3dd90818bddde571b + version: 6aced65f8501fe1217321abf0749d354824ba2ff - name: github.com/go-openapi/swag - version: 96d7b9ebd181a1735a1c9ac87914f2b32fbf56c9 + version: 1d0bd113de87027671077d3c71eb3ac5d7dbba72 - name: github.com/gogo/protobuf version: 909568be09de550ed094403c2bf8a261b5bb730a subpackages: @@ -235,7 +235,7 @@ imports: subpackages: - query - name: github.com/google/gofuzz - version: 44d81051d367757e1c7c6a5a86423ece9afcf63c + version: bbcb9da2d746f8bdbd6a936686a0a6067ada0ec5 - name: github.com/gorilla/context version: 1ea25387ff6f684839d82767c1733ff4d4d15d0a - name: github.com/gorilla/websocket @@ -266,7 +266,7 @@ imports: - name: github.com/mailgun/timetools version: fd192d755b00c968d312d23f521eb0cdc6f66bd0 - name: github.com/mailru/easyjson - version: 9d6630dc8c577b56cb9687a9cf9e8578aca7298a + version: d5b7844b561a7bc640052f1b935f7b800330d7e0 subpackages: - buffer - jlexer @@ -320,7 +320,7 @@ imports: subpackages: - ovh - name: github.com/pborman/uuid - version: 5007efa264d92316c43112bc573e754bc889b7b1 + version: ca53cad383cad2479bbba7f7a1a05797ec1386e4 - name: github.com/pkg/errors version: bfd5150e4e41705ded2129ec33379de1cb90b513 - name: github.com/pmezard/go-difflib @@ -344,7 +344,7 @@ imports: - name: github.com/prometheus/procfs version: 454a56f35412459b5e684fd5ec0f9211b94f002a - name: github.com/PuerkitoBio/purell - version: 0bcb03f4b4d0a9428594752bd2a3b9aa0a9d4bd4 + version: 8a290539e2e8629dbc4e6bad948158f790ec31f4 - name: github.com/PuerkitoBio/urlesc version: 5bd2802263f21d8788851d5305584c82a5c75d7e - name: github.com/pyr/egoscale @@ -479,7 +479,15 @@ imports: vcs: git subpackages: - . + - cases + - internal + - internal/tag + - language + - runes + - secure/bidirule + - secure/precis - transform + - unicode/bidi - unicode/norm - width - name: google.golang.org/api diff --git a/vendor/github.com/PuerkitoBio/purell/purell.go b/vendor/github.com/PuerkitoBio/purell/purell.go index 645e1b76f..b79da64b3 100644 --- a/vendor/github.com/PuerkitoBio/purell/purell.go +++ b/vendor/github.com/PuerkitoBio/purell/purell.go @@ -15,8 +15,8 @@ import ( "github.com/PuerkitoBio/urlesc" "golang.org/x/net/idna" + "golang.org/x/text/secure/precis" "golang.org/x/text/unicode/norm" - "golang.org/x/text/width" ) // A set of normalization flags determines how a URL will @@ -150,26 +150,22 @@ func MustNormalizeURLString(u string, f NormalizationFlags) string { // NormalizeURLString returns the normalized string, or an error if it can't be parsed into an URL object. // It takes an URL string as input, as well as the normalization flags. func NormalizeURLString(u string, f NormalizationFlags) (string, error) { - parsed, err := url.Parse(u) - if err != nil { - return "", err + if parsed, e := url.Parse(u); e != nil { + return "", e + } else { + options := make([]precis.Option, 1, 3) + options[0] = precis.IgnoreCase + if f&FlagLowercaseHost == FlagLowercaseHost { + options = append(options, precis.FoldCase()) + } + options = append(options, precis.Norm(norm.NFC)) + profile := precis.NewFreeform(options...) + if parsed.Host, e = idna.ToASCII(profile.NewTransformer().String(parsed.Host)); e != nil { + return "", e + } + return NormalizeURL(parsed, f), nil } - - if f&FlagLowercaseHost == FlagLowercaseHost { - parsed.Host = strings.ToLower(parsed.Host) - } - - // The idna package doesn't fully conform to RFC 5895 - // (https://tools.ietf.org/html/rfc5895), so we do it here. - // Taken from Go 1.8 cycle source, courtesy of bradfitz. - // TODO: Remove when (if?) idna package conforms to RFC 5895. - parsed.Host = width.Fold.String(parsed.Host) - parsed.Host = norm.NFC.String(parsed.Host) - if parsed.Host, err = idna.ToASCII(parsed.Host); err != nil { - return "", err - } - - return NormalizeURL(parsed, f), nil + panic("Unreachable code.") } // NormalizeURL returns the normalized string. diff --git a/vendor/github.com/blang/semver/range.go b/vendor/github.com/blang/semver/range.go deleted file mode 100644 index 238e1312d..000000000 --- a/vendor/github.com/blang/semver/range.go +++ /dev/null @@ -1,233 +0,0 @@ -package semver - -import ( - "fmt" - "strings" - "unicode" -) - -type comparator func(Version, Version) bool - -var ( - compEQ comparator = func(v1 Version, v2 Version) bool { - return v1.Compare(v2) == 0 - } - compNE = func(v1 Version, v2 Version) bool { - return v1.Compare(v2) != 0 - } - compGT = func(v1 Version, v2 Version) bool { - return v1.Compare(v2) == 1 - } - compGE = func(v1 Version, v2 Version) bool { - return v1.Compare(v2) >= 0 - } - compLT = func(v1 Version, v2 Version) bool { - return v1.Compare(v2) == -1 - } - compLE = func(v1 Version, v2 Version) bool { - return v1.Compare(v2) <= 0 - } -) - -type versionRange struct { - v Version - c comparator -} - -// rangeFunc creates a Range from the given versionRange. -func (vr *versionRange) rangeFunc() Range { - return Range(func(v Version) bool { - return vr.c(v, vr.v) - }) -} - -// Range represents a range of versions. -// A Range can be used to check if a Version satisfies it: -// -// range, err := semver.ParseRange(">1.0.0 <2.0.0") -// range(semver.MustParse("1.1.1") // returns true -type Range func(Version) bool - -// OR combines the existing Range with another Range using logical OR. -func (rf Range) OR(f Range) Range { - return Range(func(v Version) bool { - return rf(v) || f(v) - }) -} - -// AND combines the existing Range with another Range using logical AND. -func (rf Range) AND(f Range) Range { - return Range(func(v Version) bool { - return rf(v) && f(v) - }) -} - -// ParseRange parses a range and returns a Range. -// If the range could not be parsed an error is returned. -// -// Valid ranges are: -// - "<1.0.0" -// - "<=1.0.0" -// - ">1.0.0" -// - ">=1.0.0" -// - "1.0.0", "=1.0.0", "==1.0.0" -// - "!1.0.0", "!=1.0.0" -// -// A Range can consist of multiple ranges separated by space: -// Ranges can be linked by logical AND: -// - ">1.0.0 <2.0.0" would match between both ranges, so "1.1.1" and "1.8.7" but not "1.0.0" or "2.0.0" -// - ">1.0.0 <3.0.0 !2.0.3-beta.2" would match every version between 1.0.0 and 3.0.0 except 2.0.3-beta.2 -// -// Ranges can also be linked by logical OR: -// - "<2.0.0 || >=3.0.0" would match "1.x.x" and "3.x.x" but not "2.x.x" -// -// AND has a higher precedence than OR. It's not possible to use brackets. -// -// Ranges can be combined by both AND and OR -// -// - `>1.0.0 <2.0.0 || >3.0.0 !4.2.1` would match `1.2.3`, `1.9.9`, `3.1.1`, but not `4.2.1`, `2.1.1` -func ParseRange(s string) (Range, error) { - parts := splitAndTrim(s) - orParts, err := splitORParts(parts) - if err != nil { - return nil, err - } - var orFn Range - for _, p := range orParts { - var andFn Range - for _, ap := range p { - opStr, vStr, err := splitComparatorVersion(ap) - if err != nil { - return nil, err - } - vr, err := buildVersionRange(opStr, vStr) - if err != nil { - return nil, fmt.Errorf("Could not parse Range %q: %s", ap, err) - } - rf := vr.rangeFunc() - - // Set function - if andFn == nil { - andFn = rf - } else { // Combine with existing function - andFn = andFn.AND(rf) - } - } - if orFn == nil { - orFn = andFn - } else { - orFn = orFn.OR(andFn) - } - - } - return orFn, nil -} - -// splitORParts splits the already cleaned parts by '||'. -// Checks for invalid positions of the operator and returns an -// error if found. -func splitORParts(parts []string) ([][]string, error) { - var ORparts [][]string - last := 0 - for i, p := range parts { - if p == "||" { - if i == 0 { - return nil, fmt.Errorf("First element in range is '||'") - } - ORparts = append(ORparts, parts[last:i]) - last = i + 1 - } - } - if last == len(parts) { - return nil, fmt.Errorf("Last element in range is '||'") - } - ORparts = append(ORparts, parts[last:]) - return ORparts, nil -} - -// buildVersionRange takes a slice of 2: operator and version -// and builds a versionRange, otherwise an error. -func buildVersionRange(opStr, vStr string) (*versionRange, error) { - c := parseComparator(opStr) - if c == nil { - return nil, fmt.Errorf("Could not parse comparator %q in %q", opStr, strings.Join([]string{opStr, vStr}, "")) - } - v, err := Parse(vStr) - if err != nil { - return nil, fmt.Errorf("Could not parse version %q in %q: %s", vStr, strings.Join([]string{opStr, vStr}, ""), err) - } - - return &versionRange{ - v: v, - c: c, - }, nil - -} - -// splitAndTrim splits a range string by spaces and cleans leading and trailing spaces -func splitAndTrim(s string) (result []string) { - last := 0 - for i := 0; i < len(s); i++ { - if s[i] == ' ' { - if last < i-1 { - result = append(result, s[last:i]) - } - last = i + 1 - } - } - if last < len(s)-1 { - result = append(result, s[last:]) - } - // parts := strings.Split(s, " ") - // for _, x := range parts { - // if s := strings.TrimSpace(x); len(s) != 0 { - // result = append(result, s) - // } - // } - return -} - -// splitComparatorVersion splits the comparator from the version. -// Spaces between the comparator and the version are not allowed. -// Input must be free of leading or trailing spaces. -func splitComparatorVersion(s string) (string, string, error) { - i := strings.IndexFunc(s, unicode.IsDigit) - if i == -1 { - return "", "", fmt.Errorf("Could not get version from string: %q", s) - } - return strings.TrimSpace(s[0:i]), s[i:], nil -} - -func parseComparator(s string) comparator { - switch s { - case "==": - fallthrough - case "": - fallthrough - case "=": - return compEQ - case ">": - return compGT - case ">=": - return compGE - case "<": - return compLT - case "<=": - return compLE - case "!": - fallthrough - case "!=": - return compNE - } - - return nil -} - -// MustParseRange is like ParseRange but panics if the range cannot be parsed. -func MustParseRange(s string) Range { - r, err := ParseRange(s) - if err != nil { - panic(`semver: ParseRange(` + s + `): ` + err.Error()) - } - return r -} diff --git a/vendor/github.com/blang/semver/semver.go b/vendor/github.com/blang/semver/semver.go index 8ee0842e6..bbf85ce97 100644 --- a/vendor/github.com/blang/semver/semver.go +++ b/vendor/github.com/blang/semver/semver.go @@ -200,29 +200,6 @@ func Make(s string) (Version, error) { return Parse(s) } -// ParseTolerant allows for certain version specifications that do not strictly adhere to semver -// specs to be parsed by this library. It does so by normalizing versions before passing them to -// Parse(). It currently trims spaces, removes a "v" prefix, and adds a 0 patch number to versions -// with only major and minor components specified -func ParseTolerant(s string) (Version, error) { - s = strings.TrimSpace(s) - s = strings.TrimPrefix(s, "v") - - // Split into major.minor.(patch+pr+meta) - parts := strings.SplitN(s, ".", 3) - if len(parts) < 3 { - if strings.ContainsAny(parts[len(parts)-1], "+-") { - return Version{}, errors.New("Short version cannot contain PreRelease/Build meta data") - } - for len(parts) < 3 { - parts = append(parts, "0") - } - s = strings.Join(parts, ".") - } - - return Parse(s) -} - // Parse parses version string and returns a validated Version or error func Parse(s string) (Version, error) { if len(s) == 0 { diff --git a/vendor/github.com/coreos/go-oidc/gen.go b/vendor/github.com/coreos/go-oidc/gen.go deleted file mode 100644 index 0c798f673..000000000 --- a/vendor/github.com/coreos/go-oidc/gen.go +++ /dev/null @@ -1,150 +0,0 @@ -// +build ignore - -// This file is used to generate keys for tests. - -package main - -import ( - "bytes" - "crypto" - "crypto/ecdsa" - "crypto/elliptic" - "crypto/rand" - "crypto/rsa" - "encoding/hex" - "encoding/json" - "fmt" - "io/ioutil" - "log" - "text/template" - - jose "gopkg.in/square/go-jose.v2" -) - -type key struct { - name string - new func() (crypto.Signer, error) -} - -var keys = []key{ - { - "ECDSA_256", func() (crypto.Signer, error) { - return ecdsa.GenerateKey(elliptic.P256(), rand.Reader) - }, - }, - { - "ECDSA_384", func() (crypto.Signer, error) { - return ecdsa.GenerateKey(elliptic.P384(), rand.Reader) - }, - }, - { - "ECDSA_521", func() (crypto.Signer, error) { - return ecdsa.GenerateKey(elliptic.P521(), rand.Reader) - }, - }, - { - "RSA_1024", func() (crypto.Signer, error) { - return rsa.GenerateKey(rand.Reader, 1024) - }, - }, - { - "RSA_2048", func() (crypto.Signer, error) { - return rsa.GenerateKey(rand.Reader, 2048) - }, - }, - { - "RSA_4096", func() (crypto.Signer, error) { - return rsa.GenerateKey(rand.Reader, 4096) - }, - }, -} - -func newJWK(k key, prefix, ident string) (privBytes, pubBytes []byte, err error) { - priv, err := k.new() - if err != nil { - return nil, nil, fmt.Errorf("generate %s: %v", k.name, err) - } - pub := priv.Public() - - privKey := &jose.JSONWebKey{Key: priv} - thumbprint, err := privKey.Thumbprint(crypto.SHA256) - if err != nil { - return nil, nil, fmt.Errorf("computing thumbprint: %v", err) - } - - keyID := hex.EncodeToString(thumbprint) - privKey.KeyID = keyID - pubKey := &jose.JSONWebKey{Key: pub, KeyID: keyID} - - privBytes, err = json.MarshalIndent(privKey, prefix, ident) - if err != nil { - return - } - pubBytes, err = json.MarshalIndent(pubKey, prefix, ident) - return -} - -type keyData struct { - Name string - Priv string - Pub string -} - -var tmpl = template.Must(template.New("").Parse(`// +build !golint - -// This file contains statically created JWKs for tests created by gen.go - -package oidc - -import ( - "encoding/json" - - jose "gopkg.in/square/go-jose.v2" -) - -func mustLoadJWK(s string) jose.JSONWebKey { - var jwk jose.JSONWebKey - if err := json.Unmarshal([]byte(s), &jwk); err != nil { - panic(err) - } - return jwk -} - -var ( -{{- range $i, $key := .Keys }} - testKey{{ $key.Name }} = mustLoadJWK(` + "`" + `{{ $key.Pub }}` + "`" + `) - testKey{{ $key.Name }}_Priv = mustLoadJWK(` + "`" + `{{ $key.Priv }}` + "`" + `) -{{ end -}} -) -`)) - -func main() { - var tmplData struct { - Keys []keyData - } - for _, k := range keys { - for i := 0; i < 4; i++ { - log.Printf("generating %s", k.name) - priv, pub, err := newJWK(k, "\t", "\t") - if err != nil { - log.Fatal(err) - } - name := fmt.Sprintf("%s_%d", k.name, i) - - tmplData.Keys = append(tmplData.Keys, keyData{ - Name: name, - Priv: string(priv), - Pub: string(pub), - }) - } - } - - buff := new(bytes.Buffer) - if err := tmpl.Execute(buff, tmplData); err != nil { - log.Fatalf("excuting template: %v", err) - } - - if err := ioutil.WriteFile("jose_test.go", buff.Bytes(), 0644); err != nil { - log.Fatal(err) - } -} diff --git a/vendor/github.com/coreos/go-oidc/http/doc.go b/vendor/github.com/coreos/go-oidc/http/doc.go deleted file mode 100644 index 5687e8b81..000000000 --- a/vendor/github.com/coreos/go-oidc/http/doc.go +++ /dev/null @@ -1,2 +0,0 @@ -// Package http is DEPRECATED. Use net/http instead. -package http diff --git a/vendor/github.com/coreos/go-oidc/jose.go b/vendor/github.com/coreos/go-oidc/jose.go deleted file mode 100644 index f2e6bf432..000000000 --- a/vendor/github.com/coreos/go-oidc/jose.go +++ /dev/null @@ -1,20 +0,0 @@ -// +build !golint - -// Don't lint this file. We don't want to have to add a comment to each constant. - -package oidc - -const ( - // JOSE asymmetric signing algorithm values as defined by RFC 7518 - // - // see: https://tools.ietf.org/html/rfc7518#section-3.1 - RS256 = "RS256" // RSASSA-PKCS-v1.5 using SHA-256 - RS384 = "RS384" // RSASSA-PKCS-v1.5 using SHA-384 - RS512 = "RS512" // RSASSA-PKCS-v1.5 using SHA-512 - ES256 = "ES256" // ECDSA using P-256 and SHA-256 - ES384 = "ES384" // ECDSA using P-384 and SHA-384 - ES512 = "ES512" // ECDSA using P-521 and SHA-512 - PS256 = "PS256" // RSASSA-PSS using SHA256 and MGF1-SHA256 - PS384 = "PS384" // RSASSA-PSS using SHA384 and MGF1-SHA384 - PS512 = "PS512" // RSASSA-PSS using SHA512 and MGF1-SHA512 -) diff --git a/vendor/github.com/coreos/go-oidc/jose/doc.go b/vendor/github.com/coreos/go-oidc/jose/doc.go deleted file mode 100644 index b5e132178..000000000 --- a/vendor/github.com/coreos/go-oidc/jose/doc.go +++ /dev/null @@ -1,2 +0,0 @@ -// Package jose is DEPRECATED. Use gopkg.in/square/go-jose.v2 instead. -package jose diff --git a/vendor/github.com/coreos/go-oidc/jose/jwk.go b/vendor/github.com/coreos/go-oidc/jose/jwk.go index 119f073ff..b7a8e2355 100644 --- a/vendor/github.com/coreos/go-oidc/jose/jwk.go +++ b/vendor/github.com/coreos/go-oidc/jose/jwk.go @@ -104,7 +104,7 @@ func encodeExponent(e int) string { break } } - return base64.RawURLEncoding.EncodeToString(b[idx:]) + return base64.URLEncoding.EncodeToString(b[idx:]) } // Turns a URL encoded modulus of a key into a big int. @@ -119,7 +119,7 @@ func decodeModulus(n string) (*big.Int, error) { } func encodeModulus(n *big.Int) string { - return base64.RawURLEncoding.EncodeToString(n.Bytes()) + return base64.URLEncoding.EncodeToString(n.Bytes()) } // decodeBase64URLPaddingOptional decodes Base64 whether there is padding or not. diff --git a/vendor/github.com/coreos/go-oidc/jose/sig_hmac.go b/vendor/github.com/coreos/go-oidc/jose/sig_hmac.go new file mode 100755 index 000000000..b3ca3ef3d --- /dev/null +++ b/vendor/github.com/coreos/go-oidc/jose/sig_hmac.go @@ -0,0 +1,67 @@ +package jose + +import ( + "bytes" + "crypto" + "crypto/hmac" + _ "crypto/sha256" + "errors" + "fmt" +) + +type VerifierHMAC struct { + KeyID string + Hash crypto.Hash + Secret []byte +} + +type SignerHMAC struct { + VerifierHMAC +} + +func NewVerifierHMAC(jwk JWK) (*VerifierHMAC, error) { + if jwk.Alg != "" && jwk.Alg != "HS256" { + return nil, fmt.Errorf("unsupported key algorithm %q", jwk.Alg) + } + + v := VerifierHMAC{ + KeyID: jwk.ID, + Secret: jwk.Secret, + Hash: crypto.SHA256, + } + + return &v, nil +} + +func (v *VerifierHMAC) ID() string { + return v.KeyID +} + +func (v *VerifierHMAC) Alg() string { + return "HS256" +} + +func (v *VerifierHMAC) Verify(sig []byte, data []byte) error { + h := hmac.New(v.Hash.New, v.Secret) + h.Write(data) + if !bytes.Equal(sig, h.Sum(nil)) { + return errors.New("invalid hmac signature") + } + return nil +} + +func NewSignerHMAC(kid string, secret []byte) *SignerHMAC { + return &SignerHMAC{ + VerifierHMAC: VerifierHMAC{ + KeyID: kid, + Secret: secret, + Hash: crypto.SHA256, + }, + } +} + +func (s *SignerHMAC) Sign(data []byte) ([]byte, error) { + h := hmac.New(s.Hash.New, s.Secret) + h.Write(data) + return h.Sum(nil), nil +} diff --git a/vendor/github.com/coreos/go-oidc/jwks.go b/vendor/github.com/coreos/go-oidc/jwks.go deleted file mode 100644 index 413f392f5..000000000 --- a/vendor/github.com/coreos/go-oidc/jwks.go +++ /dev/null @@ -1,200 +0,0 @@ -package oidc - -import ( - "encoding/json" - "fmt" - "io/ioutil" - "net/http" - "sync" - "time" - - "github.com/pquerna/cachecontrol" - "golang.org/x/net/context" - "golang.org/x/net/context/ctxhttp" - jose "gopkg.in/square/go-jose.v2" -) - -// keysExpiryDelta is the allowed clock skew between a client and the OpenID Connect -// server. -// -// When keys expire, they are valid for this amount of time after. -// -// If the keys have not expired, and an ID Token claims it was signed by a key not in -// the cache, if and only if the keys expire in this amount of time, the keys will be -// updated. -const keysExpiryDelta = 30 * time.Second - -func newRemoteKeySet(ctx context.Context, jwksURL string, now func() time.Time) *remoteKeySet { - if now == nil { - now = time.Now - } - return &remoteKeySet{jwksURL: jwksURL, ctx: ctx, now: now} -} - -type remoteKeySet struct { - jwksURL string - ctx context.Context - now func() time.Time - - // guard all other fields - mu sync.Mutex - - // inflightCtx suppresses parallel execution of updateKeys and allows - // multiple goroutines to wait for its result. - // Its Err() method returns any errors encountered during updateKeys. - // - // If nil, there is no inflight updateKeys request. - inflightCtx *inflight - - // A set of cached keys and their expiry. - cachedKeys []jose.JSONWebKey - expiry time.Time -} - -// inflight is used to wait on some in-flight request from multiple goroutines -type inflight struct { - done chan struct{} - err error -} - -// Done returns a channel that is closed when the inflight request finishes. -func (i *inflight) Done() <-chan struct{} { - return i.done -} - -// Err returns any error encountered during request execution. May be nil. -func (i *inflight) Err() error { - return i.err -} - -// Cancel signals completion of the inflight request with error err. -// Must be called only once for particular inflight instance. -func (i *inflight) Cancel(err error) { - i.err = err - close(i.done) -} - -func (r *remoteKeySet) keysWithIDFromCache(keyIDs []string) ([]jose.JSONWebKey, bool) { - r.mu.Lock() - keys, expiry := r.cachedKeys, r.expiry - r.mu.Unlock() - - // Have the keys expired? - if expiry.Add(keysExpiryDelta).Before(r.now()) { - return nil, false - } - - var signingKeys []jose.JSONWebKey - for _, key := range keys { - if contains(keyIDs, key.KeyID) { - signingKeys = append(signingKeys, key) - } - } - - if len(signingKeys) == 0 { - // Are the keys about to expire? - if r.now().Add(keysExpiryDelta).After(expiry) { - return nil, false - } - } - - return signingKeys, true -} -func (r *remoteKeySet) keysWithID(ctx context.Context, keyIDs []string) ([]jose.JSONWebKey, error) { - keys, ok := r.keysWithIDFromCache(keyIDs) - if ok { - return keys, nil - } - - var inflightCtx *inflight - func() { - r.mu.Lock() - defer r.mu.Unlock() - - // If there's not a current inflight request, create one. - if r.inflightCtx == nil { - inflightCtx := &inflight{make(chan struct{}), nil} - r.inflightCtx = inflightCtx - - go func() { - // TODO(ericchiang): Upstream Kubernetes request that we recover every time - // we spawn a goroutine, because panics in a goroutine will bring down the - // entire program. There's no way to recover from another goroutine's panic. - // - // Most users actually want to let the panic propagate and bring down the - // program because it implies some unrecoverable state. - // - // Add a context key to allow the recover behavior. - // - // See: https://github.com/coreos/go-oidc/issues/89 - - // Sync keys and close inflightCtx when that's done. - // Use the remoteKeySet's context instead of the requests context - // because a re-sync is unique to the keys set and will span multiple - // requests. - inflightCtx.Cancel(r.updateKeys(r.ctx)) - - r.mu.Lock() - defer r.mu.Unlock() - r.inflightCtx = nil - }() - } - - inflightCtx = r.inflightCtx - }() - - select { - case <-ctx.Done(): - return nil, ctx.Err() - case <-inflightCtx.Done(): - if err := inflightCtx.Err(); err != nil { - return nil, err - } - } - - // Since we've just updated keys, we don't care about the cache miss. - keys, _ = r.keysWithIDFromCache(keyIDs) - return keys, nil -} - -func (r *remoteKeySet) updateKeys(ctx context.Context) error { - req, err := http.NewRequest("GET", r.jwksURL, nil) - if err != nil { - return fmt.Errorf("oidc: can't create request: %v", err) - } - - resp, err := ctxhttp.Do(ctx, clientFromContext(ctx), req) - if err != nil { - return fmt.Errorf("oidc: get keys failed %v", err) - } - defer resp.Body.Close() - - body, err := ioutil.ReadAll(resp.Body) - if err != nil { - return fmt.Errorf("oidc: read response body: %v", err) - } - if resp.StatusCode != http.StatusOK { - return fmt.Errorf("oidc: get keys failed: %s %s", resp.Status, body) - } - - var keySet jose.JSONWebKeySet - if err := json.Unmarshal(body, &keySet); err != nil { - return fmt.Errorf("oidc: failed to decode keys: %v %s", err, body) - } - - // If the server doesn't provide cache control headers, assume the - // keys expire immediately. - expiry := r.now() - - _, e, err := cachecontrol.CachableResponse(req, resp, cachecontrol.Options{}) - if err == nil && e.After(expiry) { - expiry = e - } - - r.mu.Lock() - defer r.mu.Unlock() - r.cachedKeys = keySet.Keys - r.expiry = expiry - - return nil -} diff --git a/vendor/github.com/coreos/go-oidc/key/doc.go b/vendor/github.com/coreos/go-oidc/key/doc.go deleted file mode 100644 index 936eec745..000000000 --- a/vendor/github.com/coreos/go-oidc/key/doc.go +++ /dev/null @@ -1,2 +0,0 @@ -// Package key is DEPRECATED. Use github.com/coreos/go-oidc instead. -package key diff --git a/vendor/github.com/coreos/go-oidc/oauth2/doc.go b/vendor/github.com/coreos/go-oidc/oauth2/doc.go deleted file mode 100644 index 52eb3085e..000000000 --- a/vendor/github.com/coreos/go-oidc/oauth2/doc.go +++ /dev/null @@ -1,2 +0,0 @@ -// Package oauth2 is DEPRECATED. Use golang.org/x/oauth instead. -package oauth2 diff --git a/vendor/github.com/coreos/go-oidc/oidc.go b/vendor/github.com/coreos/go-oidc/oidc.go deleted file mode 100644 index 62be15d3b..000000000 --- a/vendor/github.com/coreos/go-oidc/oidc.go +++ /dev/null @@ -1,299 +0,0 @@ -// Package oidc implements OpenID Connect client logic for the golang.org/x/oauth2 package. -package oidc - -import ( - "encoding/json" - "errors" - "fmt" - "io/ioutil" - "net/http" - "strings" - "time" - - "golang.org/x/net/context" - "golang.org/x/net/context/ctxhttp" - "golang.org/x/oauth2" - jose "gopkg.in/square/go-jose.v2" -) - -const ( - // ScopeOpenID is the mandatory scope for all OpenID Connect OAuth2 requests. - ScopeOpenID = "openid" - - // ScopeOfflineAccess is an optional scope defined by OpenID Connect for requesting - // OAuth2 refresh tokens. - // - // Support for this scope differs between OpenID Connect providers. For instance - // Google rejects it, favoring appending "access_type=offline" as part of the - // authorization request instead. - // - // See: https://openid.net/specs/openid-connect-core-1_0.html#OfflineAccess - ScopeOfflineAccess = "offline_access" -) - -// ClientContext returns a new Context that carries the provided HTTP client. -// -// This method sets the same context key used by the golang.org/x/oauth2 package, -// so the returned context works for that package too. -// -// myClient := &http.Client{} -// ctx := oidc.ClientContext(parentContext, myClient) -// -// // This will use the custom client -// provider, err := oidc.NewProvider(ctx, "https://accounts.example.com") -// -func ClientContext(ctx context.Context, client *http.Client) context.Context { - return context.WithValue(ctx, oauth2.HTTPClient, client) -} - -func clientFromContext(ctx context.Context) *http.Client { - if client, ok := ctx.Value(oauth2.HTTPClient).(*http.Client); ok { - return client - } - return http.DefaultClient -} - -// Provider represents an OpenID Connect server's configuration. -type Provider struct { - issuer string - authURL string - tokenURL string - userInfoURL string - - // Raw claims returned by the server. - rawClaims []byte - - remoteKeySet *remoteKeySet -} - -type cachedKeys struct { - keys []jose.JSONWebKey - expiry time.Time -} - -type providerJSON struct { - Issuer string `json:"issuer"` - AuthURL string `json:"authorization_endpoint"` - TokenURL string `json:"token_endpoint"` - JWKSURL string `json:"jwks_uri"` - UserInfoURL string `json:"userinfo_endpoint"` -} - -// NewProvider uses the OpenID Connect discovery mechanism to construct a Provider. -// -// The issuer is the URL identifier for the service. For example: "https://accounts.google.com" -// or "https://login.salesforce.com". -func NewProvider(ctx context.Context, issuer string) (*Provider, error) { - wellKnown := strings.TrimSuffix(issuer, "/") + "/.well-known/openid-configuration" - resp, err := ctxhttp.Get(ctx, clientFromContext(ctx), wellKnown) - if err != nil { - return nil, err - } - body, err := ioutil.ReadAll(resp.Body) - if err != nil { - return nil, err - } - if resp.StatusCode != http.StatusOK { - return nil, fmt.Errorf("%s: %s", resp.Status, body) - } - defer resp.Body.Close() - var p providerJSON - if err := json.Unmarshal(body, &p); err != nil { - return nil, fmt.Errorf("oidc: failed to decode provider discovery object: %v", err) - } - if p.Issuer != issuer { - return nil, fmt.Errorf("oidc: issuer did not match the issuer returned by provider, expected %q got %q", issuer, p.Issuer) - } - return &Provider{ - issuer: p.Issuer, - authURL: p.AuthURL, - tokenURL: p.TokenURL, - userInfoURL: p.UserInfoURL, - rawClaims: body, - remoteKeySet: newRemoteKeySet(ctx, p.JWKSURL, time.Now), - }, nil -} - -// Claims unmarshals raw fields returned by the server during discovery. -// -// var claims struct { -// ScopesSupported []string `json:"scopes_supported"` -// ClaimsSupported []string `json:"claims_supported"` -// } -// -// if err := provider.Claims(&claims); err != nil { -// // handle unmarshaling error -// } -// -// For a list of fields defined by the OpenID Connect spec see: -// https://openid.net/specs/openid-connect-discovery-1_0.html#ProviderMetadata -func (p *Provider) Claims(v interface{}) error { - if p.rawClaims == nil { - return errors.New("oidc: claims not set") - } - return json.Unmarshal(p.rawClaims, v) -} - -// Endpoint returns the OAuth2 auth and token endpoints for the given provider. -func (p *Provider) Endpoint() oauth2.Endpoint { - return oauth2.Endpoint{AuthURL: p.authURL, TokenURL: p.tokenURL} -} - -// UserInfo represents the OpenID Connect userinfo claims. -type UserInfo struct { - Subject string `json:"sub"` - Profile string `json:"profile"` - Email string `json:"email"` - EmailVerified bool `json:"email_verified"` - - claims []byte -} - -// Claims unmarshals the raw JSON object claims into the provided object. -func (u *UserInfo) Claims(v interface{}) error { - if u.claims == nil { - return errors.New("oidc: claims not set") - } - return json.Unmarshal(u.claims, v) -} - -// UserInfo uses the token source to query the provider's user info endpoint. -func (p *Provider) UserInfo(ctx context.Context, tokenSource oauth2.TokenSource) (*UserInfo, error) { - if p.userInfoURL == "" { - return nil, errors.New("oidc: user info endpoint is not supported by this provider") - } - - req, err := http.NewRequest("GET", p.userInfoURL, nil) - if err != nil { - return nil, fmt.Errorf("oidc: create GET request: %v", err) - } - - token, err := tokenSource.Token() - if err != nil { - return nil, fmt.Errorf("oidc: get access token: %v", err) - } - token.SetAuthHeader(req) - - resp, err := ctxhttp.Do(ctx, clientFromContext(ctx), req) - if err != nil { - return nil, err - } - defer resp.Body.Close() - body, err := ioutil.ReadAll(resp.Body) - if err != nil { - return nil, err - } - if resp.StatusCode != http.StatusOK { - return nil, fmt.Errorf("%s: %s", resp.Status, body) - } - - var userInfo UserInfo - if err := json.Unmarshal(body, &userInfo); err != nil { - return nil, fmt.Errorf("oidc: failed to decode userinfo: %v", err) - } - userInfo.claims = body - return &userInfo, nil -} - -// IDToken is an OpenID Connect extension that provides a predictable representation -// of an authorization event. -// -// The ID Token only holds fields OpenID Connect requires. To access additional -// claims returned by the server, use the Claims method. -type IDToken struct { - // The URL of the server which issued this token. This will always be the same - // as the URL used for initial discovery. - Issuer string - - // The client, or set of clients, that this token is issued for. - Audience []string - - // A unique string which identifies the end user. - Subject string - - IssuedAt time.Time - Expiry time.Time - Nonce string - - // Raw payload of the id_token. - claims []byte -} - -// Claims unmarshals the raw JSON payload of the ID Token into a provided struct. -// -// idToken, err := idTokenVerifier.Verify(rawIDToken) -// if err != nil { -// // handle error -// } -// var claims struct { -// Email string `json:"email"` -// EmailVerified bool `json:"email_verified"` -// } -// if err := idToken.Claims(&claims); err != nil { -// // handle error -// } -// -func (i *IDToken) Claims(v interface{}) error { - if i.claims == nil { - return errors.New("oidc: claims not set") - } - return json.Unmarshal(i.claims, v) -} - -type idToken struct { - Issuer string `json:"iss"` - Subject string `json:"sub"` - Audience audience `json:"aud"` - Expiry jsonTime `json:"exp"` - IssuedAt jsonTime `json:"iat"` - Nonce string `json:"nonce"` -} - -type audience []string - -func (a *audience) UnmarshalJSON(b []byte) error { - var s string - if json.Unmarshal(b, &s) == nil { - *a = audience{s} - return nil - } - var auds []string - if err := json.Unmarshal(b, &auds); err != nil { - return err - } - *a = audience(auds) - return nil -} - -func (a audience) MarshalJSON() ([]byte, error) { - if len(a) == 1 { - return json.Marshal(a[0]) - } - return json.Marshal([]string(a)) -} - -type jsonTime time.Time - -func (j *jsonTime) UnmarshalJSON(b []byte) error { - var n json.Number - if err := json.Unmarshal(b, &n); err != nil { - return err - } - var unix int64 - - if t, err := n.Int64(); err == nil { - unix = t - } else { - f, err := n.Float64() - if err != nil { - return err - } - unix = int64(f) - } - *j = jsonTime(time.Unix(unix, 0)) - return nil -} - -func (j jsonTime) MarshalJSON() ([]byte, error) { - return json.Marshal(time.Time(j).Unix()) -} diff --git a/vendor/github.com/coreos/go-oidc/oidc/doc.go b/vendor/github.com/coreos/go-oidc/oidc/doc.go deleted file mode 100644 index 196611ec5..000000000 --- a/vendor/github.com/coreos/go-oidc/oidc/doc.go +++ /dev/null @@ -1,2 +0,0 @@ -// Package oidc is DEPRECATED. Use github.com/coreos/go-oidc instead. -package oidc diff --git a/vendor/github.com/coreos/go-oidc/oidc/provider.go b/vendor/github.com/coreos/go-oidc/oidc/provider.go index 42197ff1a..ca2838440 100644 --- a/vendor/github.com/coreos/go-oidc/oidc/provider.go +++ b/vendor/github.com/coreos/go-oidc/oidc/provider.go @@ -567,7 +567,7 @@ func (n *pcsStepNext) step(fn pcsStepFunc) (next pcsStepper) { next = &pcsStepNext{aft: ttl} } else { next = &pcsStepRetry{aft: time.Second} - log.Printf("go-oidc: provider config sync failed, retrying in %v: %v", next.after(), err) + log.Printf("go-oidc: provider config sync falied, retyring in %v: %v", next.after(), err) } return } @@ -586,7 +586,7 @@ func (r *pcsStepRetry) step(fn pcsStepFunc) (next pcsStepper) { next = &pcsStepNext{aft: ttl} } else { next = &pcsStepRetry{aft: timeutil.ExpBackoff(r.aft, time.Minute)} - log.Printf("go-oidc: provider config sync failed, retrying in %v: %v", next.after(), err) + log.Printf("go-oidc: provider config sync falied, retyring in %v: %v", next.after(), err) } return } diff --git a/vendor/github.com/coreos/go-oidc/verify.go b/vendor/github.com/coreos/go-oidc/verify.go deleted file mode 100644 index 13c0f9347..000000000 --- a/vendor/github.com/coreos/go-oidc/verify.go +++ /dev/null @@ -1,263 +0,0 @@ -package oidc - -import ( - "bytes" - "encoding/base64" - "encoding/json" - "errors" - "fmt" - "strings" - "time" - - "golang.org/x/net/context" - "golang.org/x/oauth2" - jose "gopkg.in/square/go-jose.v2" -) - -// IDTokenVerifier provides verification for ID Tokens. -type IDTokenVerifier struct { - keySet *remoteKeySet - config *verificationConfig -} - -// verificationConfig is the unexported configuration for an IDTokenVerifier. -// -// Users interact with this struct using a VerificationOption. -type verificationConfig struct { - issuer string - // If provided, this value must be in the ID Token audiences. - audience string - // If not nil, check the expiry of the id token. - checkExpiry func() time.Time - // If specified, only these sets of algorithms may be used to sign the JWT. - requiredAlgs []string - // If not nil, don't verify nonce. - nonceSource NonceSource -} - -// VerificationOption provides additional checks on ID Tokens. -type VerificationOption interface { - // Unexport this method so other packages can't implement this interface. - updateConfig(c *verificationConfig) -} - -// Verifier returns an IDTokenVerifier that uses the provider's key set to verify JWTs. -// -// The returned IDTokenVerifier is tied to the Provider's context and its behavior is -// undefined once the Provider's context is canceled. -func (p *Provider) Verifier(options ...VerificationOption) *IDTokenVerifier { - config := &verificationConfig{issuer: p.issuer} - for _, option := range options { - option.updateConfig(config) - } - - return newVerifier(p.remoteKeySet, config) -} - -func newVerifier(keySet *remoteKeySet, config *verificationConfig) *IDTokenVerifier { - // As discussed in the godocs for VerifrySigningAlg, because almost all providers - // only support RS256, default to only allowing it. - if len(config.requiredAlgs) == 0 { - config.requiredAlgs = []string{RS256} - } - - return &IDTokenVerifier{ - keySet: keySet, - config: config, - } -} - -func parseJWT(p string) ([]byte, error) { - parts := strings.Split(p, ".") - if len(parts) < 2 { - return nil, fmt.Errorf("oidc: malformed jwt, expected 3 parts got %d", len(parts)) - } - payload, err := base64.RawURLEncoding.DecodeString(parts[1]) - if err != nil { - return nil, fmt.Errorf("oidc: malformed jwt payload: %v", err) - } - return payload, nil -} - -func contains(sli []string, ele string) bool { - for _, s := range sli { - if s == ele { - return true - } - } - return false -} - -// Verify parses a raw ID Token, verifies it's been signed by the provider, preforms -// any additional checks passed as VerifictionOptions, and returns the payload. -// -// See: https://openid.net/specs/openid-connect-core-1_0.html#IDTokenValidation -// -// oauth2Token, err := oauth2Config.Exchange(ctx, r.URL.Query().Get("code")) -// if err != nil { -// // handle error -// } -// -// // Extract the ID Token from oauth2 token. -// rawIDToken, ok := oauth2Token.Extra("id_token").(string) -// if !ok { -// // handle error -// } -// -// token, err := verifier.Verify(ctx, rawIDToken) -// -func (v *IDTokenVerifier) Verify(ctx context.Context, rawIDToken string) (*IDToken, error) { - jws, err := jose.ParseSigned(rawIDToken) - if err != nil { - return nil, fmt.Errorf("oidc: mallformed jwt: %v", err) - } - - // Throw out tokens with invalid claims before trying to verify the token. This lets - // us do cheap checks before possibly re-syncing keys. - payload, err := parseJWT(rawIDToken) - if err != nil { - return nil, fmt.Errorf("oidc: malformed jwt: %v", err) - } - var token idToken - if err := json.Unmarshal(payload, &token); err != nil { - return nil, fmt.Errorf("oidc: failed to unmarshal claims: %v", err) - } - - t := &IDToken{ - Issuer: token.Issuer, - Subject: token.Subject, - Audience: []string(token.Audience), - Expiry: time.Time(token.Expiry), - IssuedAt: time.Time(token.IssuedAt), - Nonce: token.Nonce, - claims: payload, - } - - // Check issuer. - if t.Issuer != v.config.issuer { - return nil, fmt.Errorf("oidc: id token issued by a different provider, expected %q got %q", v.config.issuer, t.Issuer) - } - - // If a client ID has been provided, make sure it's part of the audience. - if v.config.audience != "" { - if !contains(t.Audience, v.config.audience) { - return nil, fmt.Errorf("oidc: expected audience %q got %q", v.config.audience, t.Audience) - } - } - - // If a set of required algorithms has been provided, ensure that the signatures use those. - var keyIDs, gotAlgs []string - for _, sig := range jws.Signatures { - if len(v.config.requiredAlgs) == 0 || contains(v.config.requiredAlgs, sig.Header.Algorithm) { - keyIDs = append(keyIDs, sig.Header.KeyID) - } else { - gotAlgs = append(gotAlgs, sig.Header.Algorithm) - } - } - if len(keyIDs) == 0 { - return nil, fmt.Errorf("oidc: no signatures use a require algorithm, expected %q got %q", v.config.requiredAlgs, gotAlgs) - } - - // Get keys from the remote key set. This may trigger a re-sync. - keys, err := v.keySet.keysWithID(ctx, keyIDs) - if err != nil { - return nil, fmt.Errorf("oidc: get keys for id token: %v", err) - } - if len(keys) == 0 { - return nil, fmt.Errorf("oidc: no keys match signature ID(s) %q", keyIDs) - } - - // Try to use a key to validate the signature. - var gotPayload []byte - for _, key := range keys { - if p, err := jws.Verify(&key); err == nil { - gotPayload = p - } - } - if len(gotPayload) == 0 { - return nil, fmt.Errorf("oidc: failed to verify id token") - } - - // Ensure that the payload returned by the square actually matches the payload parsed earlier. - if !bytes.Equal(gotPayload, payload) { - return nil, errors.New("oidc: internal error, payload parsed did not match previous payload") - } - - // Check the nonce after we've verified the token. We don't want to allow unverified - // payloads to trigger a nonce lookup. - if v.config.nonceSource != nil { - if err := v.config.nonceSource.ClaimNonce(t.Nonce); err != nil { - return nil, err - } - } - - return t, nil -} - -// VerifyAudience ensures that an ID Token was issued for the specific client. -// -// Note that a verified token may be valid for other clients, as OpenID Connect allows a token to have -// multiple audiences. -func VerifyAudience(clientID string) VerificationOption { - return clientVerifier{clientID} -} - -type clientVerifier struct { - clientID string -} - -func (v clientVerifier) updateConfig(c *verificationConfig) { - c.audience = v.clientID -} - -// VerifyExpiry ensures that an ID Token has not expired. -func VerifyExpiry() VerificationOption { - return expiryVerifier{} -} - -type expiryVerifier struct{} - -func (v expiryVerifier) updateConfig(c *verificationConfig) { - c.checkExpiry = time.Now -} - -// VerifySigningAlg enforces that an ID Token is signed by a specific signing algorithm. -// -// Because so many providers only support RS256, if this verifiction option isn't used, -// the IDTokenVerifier defaults to only allowing RS256. -func VerifySigningAlg(allowedAlgs ...string) VerificationOption { - return algVerifier{allowedAlgs} -} - -type algVerifier struct { - algs []string -} - -func (v algVerifier) updateConfig(c *verificationConfig) { - c.requiredAlgs = v.algs -} - -// Nonce returns an auth code option which requires the ID Token created by the -// OpenID Connect provider to contain the specified nonce. -func Nonce(nonce string) oauth2.AuthCodeOption { - return oauth2.SetAuthURLParam("nonce", nonce) -} - -// NonceSource represents a source which can verify a nonce is valid and has not -// been claimed before. -type NonceSource interface { - ClaimNonce(nonce string) error -} - -// VerifyNonce ensures that the ID Token contains a nonce which can be claimed by the nonce source. -func VerifyNonce(source NonceSource) VerificationOption { - return nonceVerifier{source} -} - -type nonceVerifier struct { - nonceSource NonceSource -} - -func (n nonceVerifier) updateConfig(c *verificationConfig) { - c.nonceSource = n.nonceSource -} diff --git a/vendor/github.com/ghodss/yaml/fields.go b/vendor/github.com/ghodss/yaml/fields.go index 586007402..0bd3c2b46 100644 --- a/vendor/github.com/ghodss/yaml/fields.go +++ b/vendor/github.com/ghodss/yaml/fields.go @@ -45,11 +45,7 @@ func indirect(v reflect.Value, decodingNull bool) (json.Unmarshaler, encoding.Te break } if v.IsNil() { - if v.CanSet() { - v.Set(reflect.New(v.Type().Elem())) - } else { - v = reflect.New(v.Type().Elem()) - } + v.Set(reflect.New(v.Type().Elem())) } if v.Type().NumMethod() > 0 { if u, ok := v.Interface().(json.Unmarshaler); ok { diff --git a/vendor/github.com/ghodss/yaml/yaml.go b/vendor/github.com/ghodss/yaml/yaml.go index 4fb4054a8..c02beacb9 100644 --- a/vendor/github.com/ghodss/yaml/yaml.go +++ b/vendor/github.com/ghodss/yaml/yaml.go @@ -15,12 +15,12 @@ import ( func Marshal(o interface{}) ([]byte, error) { j, err := json.Marshal(o) if err != nil { - return nil, fmt.Errorf("error marshaling into JSON: %v", err) + return nil, fmt.Errorf("error marshaling into JSON: ", err) } y, err := JSONToYAML(j) if err != nil { - return nil, fmt.Errorf("error converting JSON to YAML: %v", err) + return nil, fmt.Errorf("error converting JSON to YAML: ", err) } return y, nil @@ -48,7 +48,7 @@ func JSONToYAML(j []byte) ([]byte, error) { var jsonObj interface{} // We are using yaml.Unmarshal here (instead of json.Unmarshal) because the // Go JSON library doesn't try to pick the right number type (int, float, - // etc.) when unmarshalling to interface{}, it just picks float64 + // etc.) when unmarshling to interface{}, it just picks float64 // universally. go-yaml does go through the effort of picking the right // number type, so we can preserve number type throughout this process. err := yaml.Unmarshal(j, &jsonObj) diff --git a/vendor/github.com/go-openapi/spec/bindata.go b/vendor/github.com/go-openapi/spec/bindata.go index 9afb5df19..294cbccf7 100644 --- a/vendor/github.com/go-openapi/spec/bindata.go +++ b/vendor/github.com/go-openapi/spec/bindata.go @@ -1,3 +1,17 @@ +// Copyright 2015 go-swagger maintainers +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + // Code generated by go-bindata. // sources: // schemas/jsonschema-draft-04.json @@ -69,7 +83,7 @@ func (fi bindataFileInfo) Sys() interface{} { return nil } -var _jsonschemaDraft04JSON = []byte("\x1f\x8b\x08\x00\x00\x09\x6e\x88\x00\xff\xc4\x57\x3b\x6f\xdb\x3e\x10\xdf\xf3\x29\x08\x26\x63\xf2\x97\xff\x40\x27\x6f\x45\xbb\x18\x68\xd1\x0c\xdd\x0c\x0f\xb4\x75\xb2\x19\x50\xa4\x42\x51\x81\x0d\x43\xdf\xbd\xa0\xa8\x07\x29\x91\x92\x2d\xbb\x8d\x97\x28\xbc\xd7\xef\x8e\xf7\xe2\xf9\x01\x21\x84\x30\x8d\xf1\x12\xe1\x83\x52\xd9\x32\x8a\xde\x72\xc1\x5f\xf2\xdd\x01\x52\xf2\x9f\x90\xfb\x28\x96\x24\x51\x2f\x8b\x2f\x91\x39\x7b\xc4\xcf\x46\xe8\xc9\xfc\x3f\x43\x32\x86\x7c\x27\x69\xa6\xa8\xe0\x5a\xfa\x9b\x90\x80\x0c\x0b\x4a\x41\x91\x5a\x45\xc7\x9d\x50\x4e\x35\x73\x8e\x97\xc8\x20\xae\x08\x86\xed\xab\x94\xe4\xe4\x10\x2a\xa2\x3a\x65\xa0\x95\x93\x8a\xfc\xec\x12\x53\xca\x57\x0a\x52\xad\xef\xff\x1e\x89\xd6\xe7\x67\x84\x9f\x24\x24\x5a\xc5\x23\x46\x65\xcb\x54\x76\xfc\x38\x13\x39\x55\xf4\x03\x56\x5c\xc1\x1e\x64\x18\x04\xad\x19\x86\x30\x68\x5a\xa4\x78\x89\x16\x97\xe8\xff\x0e\x09\x29\x98\x5a\x0c\xed\x10\xc6\x7e\x69\xa8\x6b\x07\x76\x64\x45\x2e\xea\x63\x45\xe5\xb3\x66\x8e\x8d\x4e\x0d\x01\x95\x68\xe3\x85\x91\xd3\x34\x63\xf0\xfb\x94\x41\x3e\x34\x0d\xbc\x72\x60\xdd\x46\x1a\xe1\xad\x10\x0c\x08\xd7\x9f\xad\xe3\x08\xf3\x82\x31\xf3\x37\xdd\x9a\x13\xb1\x7d\x83\x9d\xd2\x5f\xb9\x92\x94\xef\x71\xc8\x7e\x45\x9d\x73\xcf\xd6\x65\x36\x7c\x8d\xa9\xf2\xf2\x94\x28\x38\x7d\x2f\xa0\xa1\x2a\x59\x40\x07\xf3\xc1\x02\xdb\xda\x68\x1c\x33\xa7\x99\x14\x19\x48\x45\x7b\xd1\x33\x45\x17\xf0\xa6\x46\xd9\x03\x92\x08\x99\x12\x7d\x57\xb8\x90\x14\x7b\x63\xd5\x15\xe5\xbd\x35\x2b\xaa\x18\x4c\xea\xf5\x8a\xba\xf5\x3e\x4b\x41\x93\xa5\x67\xfb\x38\x2d\x98\xa2\x19\x83\x2a\xf7\x03\x6a\x9b\x74\x0b\x56\x5e\x8f\x02\xc7\x1d\x2b\x72\xfa\x01\x3f\x5b\x16\xf7\xc6\x6d\xfb\xe4\x58\xb3\x8c\x1b\xf7\x0a\x77\x86\xa6\xb4\xb4\xf5\xe4\x92\xbb\xa0\x24\x84\xe5\x01\x84\xad\x13\x37\x21\x9c\xd2\x72\x0b\x42\x72\xfc\x01\x7c\xaf\x0e\xbd\x9e\x3b\xd5\xbc\x1c\x1f\xaf\xd6\xd0\xb6\x52\xb7\xdf\x12\xa5\x40\x4e\xe7\x68\xb0\x78\x24\xec\xe1\xe8\x0f\x26\x89\xe3\x0a\x0a\x61\x4d\x23\xe9\xf7\x70\x7e\x32\x3d\xdc\x39\xd6\xbf\xf3\x30\xd0\xfd\xf6\x55\xb3\x79\x27\x96\xfe\x6d\x82\x37\x73\xf6\x8f\x36\x3a\x03\xa4\x6d\x7d\x1c\x9e\x73\x35\xf6\x18\xbf\x15\x76\x4a\x8e\x2b\xcf\x00\xbf\x2a\x99\xae\x55\xe0\xcf\x25\x77\x68\xfc\x95\xba\x79\x75\x06\xcb\x5c\x77\x67\x69\xf1\xfb\x2c\xe1\xbd\xa0\x12\xe2\x31\x45\xf6\x30\x0f\x14\xc8\xab\x7f\x60\x4e\x27\xe0\x3f\xaf\x92\xd0\x6a\x8a\x82\xdb\xc0\xa4\xbb\x63\x65\x34\x0d\x28\xb0\x6b\x7c\x1e\x1e\xd3\x51\xc7\x6e\xf4\x33\x60\xc5\x90\x01\x8f\x81\xef\xee\x88\x68\x90\x69\x23\xb9\x8a\x2e\x69\x98\x7d\xa6\x91\x32\x1a\xc8\x6e\x9c\x13\x7f\x10\xea\xcd\xfd\x4e\xef\xa6\xb1\x25\xd9\xde\x22\x8d\xfa\x59\x63\xc5\x0d\x80\xf5\x28\xf1\xd6\xb9\x37\x9e\xa3\xee\xb5\x4c\xbe\x37\xe0\x55\xc6\x27\x82\x75\x49\xd0\xda\xe0\xb9\x1d\xca\xbf\x5b\xd4\xcf\xbf\x0b\x47\xac\x2d\x59\x07\xfe\x7a\x49\xc1\x61\xa6\x24\x17\x2a\xf0\xbe\x2e\xdb\x17\x7f\xa0\x3c\x7d\x4b\xf3\xba\xdb\xc3\xed\x06\xee\xdb\x5e\xd7\xdd\x42\x5c\x47\xb2\xb3\x68\x75\x8c\xf2\xe1\x4f\x00\x00\x00\xff\xff\x4e\x9b\x8d\xdf\x17\x11\x00\x00") +var _jsonschemaDraft04JSON = []byte("\x1f\x8b\x08\x00\x00\x09\x6e\x88\x00\xff\xcc\x57\x3b\x6f\xdb\x30\x10\xde\xfd\x2b\x04\xa5\x63\x52\xb9\x40\xa7\x6c\x45\xbb\x18\x68\xd1\x0c\xdd\x0c\x0f\xb4\x75\xb2\x19\x50\xa4\x42\x51\x85\x0d\x43\xff\xbd\xa4\xa8\x07\x29\x91\x92\x2d\xbb\x48\xb4\xc4\xe1\xbd\xbe\x3b\xde\x8b\xe7\x45\x20\xbf\x10\xc7\xe1\x73\x10\x1e\x84\xc8\x9e\xa3\xe8\x35\x67\xf4\x29\xdf\x1d\x20\x45\x9f\x19\xdf\x47\x31\x47\x89\x78\x5a\x7e\x8d\xf4\xd9\x43\xf8\xa8\x85\x3e\xe9\xff\x67\x48\xc6\x90\xef\x38\xce\x04\x66\x54\x49\x7f\x67\x1c\x02\xcd\x12\xa4\x20\x50\xad\xa2\xe3\x4e\x30\xc5\x8a\x39\x97\xdc\x1a\x71\x45\xd0\x6c\xdf\x38\x47\x27\x8b\x50\x11\xc5\x29\x03\xa5\x1c\x55\xe4\x47\x9b\x98\x62\xba\x12\x90\x2a\x7d\x5f\x7a\x24\x5c\x9f\x9f\xa5\x83\x1c\x12\xa5\xe2\x21\x0c\xca\x96\xa9\xec\xf8\xc3\x8c\xe5\x12\xd7\x5f\x58\x51\x01\x7b\xe0\x7e\x10\xb8\x66\x18\xc2\xc0\x69\x91\x4a\x8e\xe5\x25\xfa\x7f\x40\x82\x0a\x22\x96\x43\x3b\x88\x90\xdf\x0a\xea\xda\x82\x1d\x19\x91\x8b\xfa\x58\xa5\x21\xc5\x1c\x6b\x9d\x0a\x42\x50\x06\x1b\x27\x8c\x1c\xa7\x19\x81\x3f\xd2\x97\x7c\x68\x1a\x68\xe5\xc0\xba\x8d\x74\x10\x6e\x19\x23\x80\xa8\xfa\xd9\x3a\x1e\x84\xb4\x20\x44\xff\x4d\xb7\xfa\x84\x6d\x5f\x61\x27\xd4\xaf\x5c\x70\x4c\xf7\xa1\xcf\x7e\x45\x9d\x73\xcf\xc6\x65\x36\x7c\x8d\xa9\xf2\xf2\x94\x28\x28\x7e\x2b\xa0\xa1\x0a\x5e\x40\x07\x73\x61\x80\x6d\x6d\x34\x8e\xe9\xd3\x8c\xb3\x0c\xb8\xc0\xbd\xe8\xe9\xa2\xf3\x78\x53\xa3\xec\x01\x49\x18\x4f\x91\xba\xab\xb0\xe0\x38\x74\xc6\xaa\x2b\xca\x7b\x6b\x16\x58\x10\x98\xd4\xeb\x14\xb5\xeb\x7d\x96\x82\x26\x4b\xcf\xe6\x71\x2a\xcf\xb0\x4c\xcd\x2a\xf7\x3d\x6a\x9b\x74\xf3\x56\x5e\x8f\x02\xc7\x1d\x29\x72\x59\x28\xbf\x5a\x16\xfb\xc6\x4d\xfb\xe8\x58\xb3\x8c\x1b\x77\x0a\x77\x86\xa6\xb4\xb4\xf5\x64\x93\xbb\xa0\x24\x88\xe4\x1e\x84\xad\x13\x37\x21\x9c\xd2\x72\x0b\x42\x74\xfc\x09\x74\x2f\x0e\xbd\x9e\x3b\xd5\xbc\x2c\x1f\xaf\xd6\xd0\xb6\x52\xbb\xdf\x22\x21\x80\x4f\xe7\xa8\xb7\x78\xb8\xd4\x7d\x74\x07\x13\xc5\x71\x05\x05\x91\xa6\x91\xf4\x7b\x38\x3d\xe9\x1e\x6e\x1d\xab\xef\x3c\x0c\x74\xbf\x7d\xd5\x6c\xce\x89\xa5\xbe\x8d\xf7\x66\xce\xee\xd1\x86\x67\x80\x34\xad\x8f\xc3\xb3\xae\xc6\x1c\xe3\xb7\xc2\x96\xd9\xb4\x72\x0c\xf0\xab\x92\xe9\x5a\x05\xee\x5c\xb2\x87\xc6\x7f\xa9\x9b\x17\x6b\xb0\xcc\x75\x77\x96\x16\xb7\xcf\x1c\xde\x0a\xcc\x21\x1e\x53\x64\x0e\x73\x4f\x81\xbc\xb8\x07\xa6\xe6\xfa\x50\x55\xe2\x5b\x4d\xad\x4b\xb6\xb6\x81\x49\x77\xc7\xca\x68\x1a\x90\x67\xd7\x78\x3f\x3c\xba\xa3\x8e\xdd\xe8\x7b\xc0\x8a\x21\x03\x1a\x03\xdd\xdd\x11\xd1\x20\xd3\x46\x72\x55\x7d\x93\x0d\xb3\xcf\x34\x52\x46\x03\xd9\x8d\x75\xe2\x0e\x42\xbd\xb9\xdf\xe9\xdd\x34\xb6\x24\x9b\x5b\xa4\x56\x3f\x6b\xac\xd8\x01\x30\x1e\x25\xce\x3a\x77\xc6\x73\xd4\xbd\x96\xc9\xf5\x06\xbc\xca\xf8\x44\xb0\x2e\x09\x5a\xf3\xf5\x3a\x94\x7b\xb7\xa8\x9f\x7f\x17\x8e\x58\x53\xb2\x0e\xfc\xf5\x92\x8c\xc2\x4c\x49\xca\x84\xe7\x7d\x5d\xb6\x2f\x7e\x4f\x79\xba\x96\xe6\x75\xb7\x87\x9b\x0d\xdc\xb5\xbd\xae\xbb\x85\xb8\x8e\x64\x67\xd1\xe8\x18\xe5\xe2\x5f\x00\x00\x00\xff\xff\x4e\x9b\x8d\xdf\x17\x11\x00\x00") func jsonschemaDraft04JSONBytes() ([]byte, error) { return bindataRead( @@ -84,12 +98,12 @@ func jsonschemaDraft04JSON() (*asset, error) { return nil, err } - info := bindataFileInfo{name: "jsonschema-draft-04.json", size: 4375, mode: os.FileMode(420), modTime: time.Unix(1482389892, 0)} + info := bindataFileInfo{name: "jsonschema-draft-04.json", size: 4375, mode: os.FileMode(420), modTime: time.Unix(1441640690, 0)} a := &asset{bytes: bytes, info: info} return a, nil } -var _v2SchemaJSON = []byte("\x1f\x8b\x08\x00\x00\x09\x6e\x88\x00\xff\xec\x5d\x4f\x93\xdb\x36\xb2\xbf\xfb\x53\xa0\x14\x57\xd9\xae\xd8\x92\xe3\xf7\x2e\xcf\x97\xd4\xbc\xd8\x49\x66\x37\x5e\x4f\x79\x26\xbb\x87\x78\x5c\x05\x91\x2d\x09\x09\x09\x30\x00\x38\x33\x5a\xef\x7c\xf7\x2d\xf0\x9f\x08\x02\x20\x41\x8a\xd2\xc8\x0e\x0f\xa9\x78\x28\xa0\xd1\xdd\x68\x34\x7e\xdd\xf8\xf7\xf9\x11\x42\x33\x49\x64\x04\xb3\xd7\x68\x76\x86\xfe\x76\xf9\xfe\x1f\xe8\x32\xd8\x40\x8c\xd1\x8a\x71\x74\x79\x8b\xd7\x6b\xe0\xe8\xd5\xfc\x25\x3a\xbb\x38\x9f\xcf\x9e\xab\x0a\x24\x54\xa5\x37\x52\x26\xaf\x17\x0b\x91\x17\x99\x13\xb6\xb8\x79\xb5\x10\x59\xdd\xf9\xef\x82\xd1\x6f\xf2\xc2\x8f\xf3\x4f\xb5\x1a\xea\xc7\x17\x45\x41\xc6\xd7\x8b\x90\xe3\x95\x7c\xf1\xf2\x7f\x8b\xca\x45\x3d\xb9\x4d\x32\xa6\xd8\xf2\x77\x08\x64\xfe\x8d\xc3\x9f\x29\xe1\xa0\x9a\xff\xed\x11\x42\x08\xcd\x8a\xd6\xb3\x9f\x15\x67\x74\xc5\xca\x7f\x27\x58\x6e\xc4\xec\x11\x42\xd7\x59\x5d\x1c\x86\x44\x12\x46\x71\x74\xc1\x59\x02\x5c\x12\x10\xb3\xd7\x68\x85\x23\x01\x59\x81\x04\x4b\x09\x9c\x6a\xbf\x7e\xce\x49\x7d\xba\x7b\x51\xfd\xa1\x44\xe2\xb0\x52\xac\x7d\xb3\x08\x61\x45\x68\x46\x56\x2c\x6e\x80\x86\x8c\xbf\xbd\x93\x40\x05\x61\x74\x96\x95\xbe\x7f\x84\xd0\x7d\x4e\xde\x42\xb7\xe4\xbe\x46\xbb\x14\x5b\x48\x4e\xe8\xba\x90\x05\xa1\x19\xd0\x34\xae\xc4\xce\xbe\xbc\x9a\xbf\x9c\x15\x7f\x5d\x57\xc5\x42\x10\x01\x27\x89\xe2\x48\x51\xb9\xda\x40\xd5\x87\x37\xc0\x15\x5f\x88\xad\x90\xdc\x10\x81\x42\x16\xa4\x31\x50\x39\x2f\x38\xad\xab\xb0\x53\xd8\xac\x94\x56\x6f\xc3\x84\xf4\x11\xa4\x50\xb3\xfa\xe9\xd3\x6f\x9f\x3e\xdf\x2f\xd0\xeb\x8f\x1f\x3f\x7e\xbc\xfe\xf6\xe9\xf7\xaf\x5f\x7f\xfc\x18\x7e\xfb\xec\xfb\xc7\xb3\x36\x79\x54\x43\xe8\x29\xc5\x31\x20\xc6\x11\x49\x9e\xe5\x12\x41\x66\xa0\xe8\xed\x1d\x8e\x93\x08\x5e\xa3\x27\x3b\xc3\x7c\xa2\x73\xba\xc4\x02\x2e\xb0\xdc\xf4\xe5\x76\xd1\xca\x96\xa2\x8a\x94\xcd\x21\xc9\x6c\xec\x2c\x70\x42\x9e\x34\x74\x9d\x19\x7c\xcd\x20\x9c\xea\x2e\x0a\xfe\x42\x84\xd4\x29\x04\x8c\x8a\xb4\x41\xa2\xc1\xdc\x19\x8a\x88\x90\x4a\x49\xef\xce\xdf\xbd\x45\x4a\x52\x81\x70\x10\x40\x22\x21\x44\xcb\x6d\xc5\xec\x4e\x3c\x1c\x45\xef\x57\x9a\xb5\x7d\xae\xfe\xe5\xe4\x31\x86\x90\xe0\xab\x6d\x02\x3b\x2e\xcb\x11\x90\xd9\xa8\xc6\x77\xc2\x59\x98\x06\xfd\xf9\x2e\x78\x45\x01\xa6\xa8\xa0\x71\x5c\xbe\x33\xa7\xd2\xd9\x5f\x95\xef\xd9\xd5\xac\xfd\xdc\x5d\xbf\x5e\xb8\xd1\x3e\xc7\x31\x48\xe0\x5e\x4c\x14\x65\xdf\xb8\xa8\x71\x10\x09\xa3\xc2\xc7\x02\xcb\xa2\x4e\x5a\x02\x82\x94\x13\xb9\xf5\x30\xe6\xb2\xa4\xb5\xfe\x9b\x3e\x7a\xb2\x55\xd2\xa8\x4a\xbc\x16\xb6\x71\x8e\x39\xc7\xdb\x9d\xe1\x10\x09\x71\xbd\x9c\xb3\x41\x89\xd7\xa5\x89\xdc\x57\xb5\x53\x4a\xfe\x4c\xe1\xbc\xa0\x21\x79\x0a\x1a\x0f\x70\xa7\x5c\x08\x8e\xde\xb0\xc0\x43\x24\xad\x74\x63\x0e\xb1\xd9\x90\xe1\xb0\x2d\x13\xa7\x6d\x78\xfd\x04\x14\x38\x8e\x90\xaa\xce\x63\xac\x3e\x23\xbc\x64\xa9\xb4\xf8\x03\x63\xde\xcd\xbe\x16\x13\x4a\x55\xac\x82\x12\xc6\xac\xd4\x35\xf7\x22\xd4\x3a\xff\x22\x73\x0e\x6e\x51\xa0\x75\x1e\xae\x8f\xe8\x5d\xc7\x59\xe6\xe4\x9a\x18\x8d\xd6\x1c\x53\x84\x4d\xb7\x67\x28\x37\x09\x84\x69\x88\x12\x0e\x01\x11\x80\x32\xa2\xf5\xb9\xaa\xc6\xd9\x73\x53\xab\xfb\xb4\x2e\x20\xc6\x54\x92\xa0\x9a\xf3\x69\x1a\x2f\x81\x77\x37\xae\x53\x1a\xce\x40\xc4\xa8\x82\x1c\xb5\xef\xda\x24\x7d\xb9\x61\x69\x14\xa2\x25\xa0\x90\xac\x56\xc0\x81\x4a\xb4\xe2\x2c\xce\x4a\x64\x7a\x9a\x23\xf4\x13\x91\x3f\xa7\x4b\xf4\x63\x84\x6f\x18\x87\x10\xbd\xc3\xfc\x8f\x90\xdd\x52\x44\x04\xc2\x51\xc4\x6e\x21\x74\x48\x21\x81\xc7\xe2\xfd\xea\x12\xf8\x0d\x09\xf6\xe9\x47\x35\xaf\x67\xc4\x14\xf7\x22\x27\x97\xe1\xe2\x76\x2d\x06\x8c\x4a\x1c\x48\x3f\x73\x2d\x0b\x5b\x29\x45\x24\x00\x2a\x0c\x11\xec\x94\xca\xc2\xa6\xc1\x37\x21\x43\x83\x3b\x5f\x97\xf1\x43\x5e\x53\x73\x19\xa5\x36\xd8\x2d\x05\x2e\x34\x0b\xeb\x39\xfc\x1d\x63\x51\x01\xbd\x3d\xbb\x90\x84\x40\x25\x59\x6d\x09\x5d\xa3\x1c\x37\xe6\x5c\x16\x9a\x40\x09\x70\xc1\xe8\x82\xf1\x35\xa6\xe4\xdf\x99\x5c\x8e\x9e\x4d\x79\xb4\x27\x2f\xbf\x7e\xf8\x05\x25\x8c\x50\xa9\x98\x29\x90\x62\x60\xea\x75\xae\x13\xca\xbf\x2b\x1a\x29\x27\x76\xd6\x20\xc6\x64\x5f\xe6\x32\x1a\x08\x87\x21\x07\x21\xbc\xb4\xe4\xe0\x32\x67\xa6\xcd\xf3\x1e\xcd\xd9\x6b\xb6\x6f\x8e\x27\xa7\xed\xdb\xe7\xbc\xcc\x1a\x07\xce\x6f\x87\x33\xf0\xba\x51\x17\x22\x66\x78\x79\x8e\xce\xe5\x13\x81\x80\x06\x2c\xe5\x78\x0d\xa1\xb2\xb8\x54\xa8\x79\x09\xbd\xbf\x3c\x47\x01\x8b\x13\x2c\xc9\x32\xaa\xaa\x1d\xd5\xee\xab\x36\xbd\x6c\xfd\x54\x6c\xc8\x08\x01\x3c\xbd\xe7\x07\x88\xb0\x24\x37\x79\x90\x28\x4a\x1d\x10\x1a\x92\x1b\x12\xa6\x38\x42\x40\xc3\x4c\x43\x62\x8e\xae\x36\xb0\x45\x71\x2a\xa4\x9a\x23\x79\x59\xb1\xa8\xf2\xa4\x0c\x60\x9f\xcc\x8d\x40\xf5\x80\xca\xa8\x99\xc3\xa7\x85\x1f\x31\x25\xa9\x82\xc5\x6d\xbd\xd8\x36\x76\x7c\x02\x28\x97\xf6\x1d\x74\x3b\x11\x7e\x91\xae\x32\xf8\x6c\xf4\xe6\x7b\x9a\xa5\x1f\x62\xc6\x21\xcf\x9a\xe5\xed\x8b\x02\xf3\x2c\x33\x33\xdf\x00\xca\xc9\x09\xb4\x04\xf5\xa5\x08\xd7\xc3\x02\x18\x66\xf1\xab\x1e\x83\x37\x4c\xcd\x12\xc1\x1d\x50\xf6\xaa\xbd\xfe\xe2\x73\x48\x38\x08\xa0\x32\x9b\x18\x44\x86\x0b\x6a\xc1\xaa\x26\x96\x2d\x96\x3c\xa0\x54\x65\x73\x87\x15\xca\x15\xe5\xf5\x94\x46\x9f\x33\x1a\x0c\x9a\xb1\x5a\xd9\x6a\x95\xcd\xcb\x7e\xec\x9a\xc5\x94\x3b\x37\x26\x31\xd7\xfc\xe4\x1f\x13\x8c\x31\x75\x9c\xba\xf7\x87\x3c\xa1\xb7\x4f\x17\x1b\x09\x82\x98\xc4\x70\x95\xd3\xe8\x4c\x48\x5a\xa6\xd6\x2a\x3d\x56\x42\x80\x9f\xaf\xae\x2e\x50\x0c\x42\xe0\x35\x34\x3c\x8a\x62\x03\x37\xba\xb2\x27\x04\xda\x25\x8d\x06\xe2\xa0\x13\x8a\xf3\xf5\xec\x10\x72\x67\x88\x90\x3d\x4b\x64\xeb\xaa\xda\x8f\xf7\x5a\x75\x47\x9a\xa8\x51\x70\x26\xd2\x38\xc6\x7c\xbb\x57\xfc\xbd\xe4\x04\x56\xa8\xa0\x54\x9a\x45\xd5\xf7\x0f\x16\xfc\x57\x1c\x3c\xdf\x23\xba\x77\x38\xda\x16\x4b\x31\x53\x6a\x4d\x9a\x15\x63\xe7\xe1\x18\x69\x9f\x22\xe0\x24\xbb\x94\x4b\x97\xee\x2d\xf9\x70\x87\x72\x7b\xe6\xc4\x33\x2a\x66\x5e\x1c\x35\x72\xe3\x2d\xda\x73\xe4\xc7\x51\x6d\xa4\xa1\x2a\x4f\xde\x94\xcb\xb2\x3e\x31\x48\xae\x82\xce\xc9\xc8\x65\xcd\xc3\xb7\x34\xb6\x2b\xdf\x58\x65\x78\x6e\x73\xac\x5e\x24\x0d\x3f\xdc\x70\x23\xc6\xda\x52\x0b\x2d\x63\x7d\xa9\x49\x2d\x54\x48\x28\xc0\x12\x9c\xe3\x63\xc9\x58\x04\x98\x36\x07\xc8\x0a\xa7\x91\xd4\xf0\xbc\xc1\xa8\xb9\x70\xd0\xc6\xa9\xb6\x78\x80\x5a\xa3\xb4\x2c\xf4\x18\x0b\x8a\x9d\xd0\xb4\x55\x10\xee\x0d\xc5\xd6\xe0\x99\x93\xdc\xa1\x04\xbb\xf1\xa7\x23\xd1\xd1\x97\x8c\x87\x13\x0a\x21\x02\xe9\x99\x25\xed\x20\xc5\x92\x66\x3c\x32\x9c\xd6\x06\xb0\x31\x5c\x86\x29\x0a\xcb\x60\x33\x12\xa5\x91\xfc\x96\x75\xd0\x59\xd7\x13\xbd\xd3\x23\x79\xdd\x2a\x90\xa6\x38\x06\x91\x39\x7f\x20\x72\x03\x1c\x2d\x01\x61\xba\x45\x37\x38\x22\x61\x8e\x71\x85\xc4\x32\x15\x28\x60\x61\x16\xb8\x3d\x29\xdc\x4d\x3d\x2f\x12\x13\x7d\xc8\x7e\x37\xee\xa8\x7f\xfa\xdb\xcb\x17\xff\x77\xfd\xf9\x7f\xee\x9f\x3d\xfe\xcf\xa7\xa7\x45\xfb\xcf\x1e\xf7\xf3\xe0\xff\xc4\x51\x0a\x8e\x4c\xcb\x01\xdc\x0a\x65\xb2\x01\x83\xed\x3d\xe4\xa9\xa3\x4e\x2d\x59\xc5\xe8\x2f\x48\x7d\x5a\x6e\x37\xbf\x5c\x9f\x35\x13\x64\x14\xfa\xef\x0b\x68\xa6\x0d\xb4\x8e\xf1\xa8\xff\xbb\x60\xf4\x03\x64\xab\x5b\x81\x65\x51\xe6\xda\xca\xfa\xf0\xb0\xac\x3e\x9c\xca\x26\x0e\x1d\xdb\x57\x5b\xbb\xb4\x9a\xa6\xb6\x9b\x1a\x6b\xd1\x9a\x9e\x7e\x33\x9a\xec\x41\x69\x45\x22\xb8\xb4\x51\xeb\x04\x77\xca\x6f\x7b\x7b\xc8\xb2\xb0\x95\x92\x25\x5b\xd0\x42\xaa\x2a\xdd\x32\x78\x4f\x0c\xab\x68\x46\x6c\xea\x6d\xf4\x5c\x5e\xde\xc4\xac\xa5\xf9\xd1\x00\x9f\x7d\x98\x65\x24\xbd\xc7\x97\xd4\xb3\x3a\xa8\x2b\xa0\x34\x76\xf9\x65\x5f\x2d\x25\x95\x1b\xcf\xd6\xf4\x9b\x5f\x09\x95\xb0\x36\x3f\xdb\xd0\x39\x2a\x93\x1c\x9d\x03\xa2\x4a\xca\xf5\xf6\x10\xb6\x94\x89\x0b\x6a\x70\x12\x13\x49\x6e\x40\xe4\x29\x12\x2b\xbd\x80\x45\x11\x04\xaa\xc2\x8f\x56\x9e\x5c\x6b\xec\x8d\x5a\x0e\x14\x59\x06\x2b\x1e\x24\xcb\xc2\x56\x4a\x31\xbe\x23\x71\x1a\xfb\x51\x2a\x0b\x3b\x1c\x48\x10\xa5\x82\xdc\xc0\xbb\x3e\x24\x8d\x5a\x76\x2e\x09\xed\xc1\x65\x51\xb8\x83\xcb\x3e\x24\x8d\x5a\x2e\x5d\xfe\x02\x74\x2d\x3d\xf1\xef\xae\xb8\x4b\xe6\x5e\xd4\xaa\xe2\x2e\x5c\x5e\xec\x0e\xf5\x5b\x0c\xcb\x0a\xbb\xa4\x3c\xf7\x1f\x2a\x55\x69\x97\x8c\x7d\x68\x95\xa5\xad\xb4\xf4\x9c\xa5\x07\xb9\x7a\x05\xbb\xad\x50\x6f\xfb\xa0\x4e\x9b\x48\x23\x49\x92\x28\x87\x19\x3e\x32\xee\xca\x3b\x46\x7e\x7f\x18\x64\xcc\xcc\x0f\x34\xe9\x36\x8b\xb7\x6c\xa8\xa5\x5b\x54\x4c\x54\x5b\x15\x3a\xf1\x6c\x2d\xfe\x96\xc8\x0d\xba\x7b\x81\x88\xc8\x23\xab\xee\x7d\x3b\x92\xa7\x60\x29\xe3\xdc\xff\xb8\x64\xe1\xf6\xa2\x5a\x59\xdc\x6f\xeb\x45\x7d\x6a\xd1\x76\x1e\xea\xb8\xf1\xfa\x14\xd3\x36\x63\xe5\xd7\xf3\xe4\xbe\x25\xbd\x5e\x05\xeb\x73\x74\xb5\x21\x2a\x2e\x4e\xa3\x30\xdf\xbf\x43\x28\x2a\xd1\xa5\x2a\x9d\x8a\xfd\x76\xd8\x8d\xbc\x67\x65\xc7\xb8\x03\x45\xec\xa3\xb0\x37\x8a\x70\x4c\x68\x91\x51\x8e\x58\x80\xed\x4a\xf3\x81\x62\xca\x96\xbb\xf1\x52\xcd\x80\xfb\xe4\x4a\x5d\x6c\xdf\x6e\x20\x4b\x80\x30\x8e\x28\x93\xf9\xe9\x8d\x8a\x6d\xd5\x59\x65\x7b\xaa\x44\x9e\xc0\xc2\xd1\x7c\x40\x26\xd6\x1a\xce\xf9\xc5\x69\x7b\x6c\xec\xc8\x71\x7b\xe5\x21\x2e\xd3\xe5\x65\x93\x91\x53\x0b\x7b\x3a\xc7\xfa\x17\x6a\x01\xa7\x33\xd0\xf4\x40\x0f\x39\x87\xda\xe4\x54\x87\x3a\xd5\xe3\xc7\xa6\x8e\x20\xd4\x11\xb2\x4e\xb1\xe9\x14\x9b\x4e\xb1\xe9\x14\x9b\xfe\x15\x63\xd3\x47\xf5\xff\x97\x38\xe9\xcf\x14\xf8\x76\x82\x49\x13\x4c\xaa\x7d\xcd\x6c\x62\x42\x49\x87\x43\x49\x19\x33\x6f\xe3\x44\x6e\x9b\xab\x8a\x3e\x86\xaa\x99\x52\x1b\x5b\x59\x33\x02\x09\xa0\x21\xa1\x6b\x84\x6b\x66\xbb\xdc\x16\x0c\xd3\x68\xab\xec\x36\x4b\xd8\x60\x8a\x40\x31\x85\x6e\x14\x57\x13\xc2\xfb\x92\x10\xde\xbf\x88\xdc\xbc\x53\x5e\x7f\x82\x7a\x13\xd4\x9b\xa0\xde\x04\xf5\x90\x01\xf5\x94\xcb\x7b\x83\x25\x9e\xd0\xde\x84\xf6\x6a\x5f\x4b\xb3\x98\x00\xdf\x04\xf8\x6c\xbc\x7f\x19\x80\xaf\xf1\x71\x45\x22\x98\x40\xe0\x04\x02\x27\x10\xd8\x29\xf5\x04\x02\xff\x4a\x20\x30\xc1\x72\xf3\x65\x02\x40\xd7\xc1\xd1\xe2\x6b\xf1\xa9\x7b\xfb\xe4\x20\xc0\x68\x9d\xd4\xb4\xd3\x96\xb5\xa6\xd1\x41\x20\xe6\x89\xc3\x48\x65\x58\x13\x84\x9c\x56\x56\x3b\x0c\xe0\x6b\x83\x5c\x13\xd2\x9a\x90\xd6\x84\xb4\x26\xa4\x85\x0c\xa4\x45\x19\xfd\xff\x63\x6c\x52\xb5\x1f\x1e\x19\x74\x3a\xcd\xb9\x69\xce\xa6\x3a\x0f\x7a\x2d\x19\xc7\x81\x14\x5d\xcb\xd5\x03\xc9\x39\xd0\xb0\xd1\xb3\xcd\xfb\x7a\x2d\x5d\x3a\x48\xe1\xfa\x2e\xe6\x81\x42\x18\x86\xd6\xc1\xbe\xb1\x23\xd3\xf7\x34\xed\x19\x0a\x0b\xc4\x48\x44\xfd\x22\x50\xb6\x42\x58\xbb\xe5\x3d\xa7\x73\xd4\x8b\xc4\x8c\x70\x61\xec\x73\xee\xc3\x81\x8b\xf5\xe2\xd7\x52\x3e\xcf\xeb\xeb\x17\x3b\x71\x16\xda\x7d\xb8\xde\xf0\x7a\x8f\x06\x2d\xa7\x40\x7b\xc1\x9d\x41\x4d\xb6\x61\xa2\x4e\x9f\x3d\xa0\xc5\xae\xe3\x1c\x1d\x40\x6c\x48\x8b\x63\xa0\xb5\x01\xed\x8e\x02\xe9\x86\xc8\x3b\x06\xee\xdb\x4b\xde\xbd\xc0\xa1\x6f\xcb\xda\xfc\xc2\x44\x16\x87\x9c\x17\x31\xd3\x30\x20\x39\x42\xcb\x6f\xf2\xf1\xf4\x72\x10\xf8\x1c\xa0\xf3\xbd\x10\xea\x21\x35\x7d\xe8\x86\xdb\x15\xed\x81\x81\x07\x28\xbb\x13\x28\xc7\xf8\xce\x7d\x8d\xc2\x31\xb4\x7e\x94\xd6\xdb\x55\xef\x4a\xfb\xed\xc3\x40\x3e\xeb\x9f\xe9\x99\x0f\xdf\x08\x65\x88\x27\x73\x86\x31\x9d\x47\xdf\x55\x19\xba\x3d\xee\x15\x0a\xcd\x8c\xaa\x5e\xb9\xf6\x57\x33\x73\x5a\xa1\x89\x7b\x3b\xa0\xb2\xa4\xc2\xf6\xc1\x53\xb5\x00\xca\x23\xe5\xf4\x60\x6a\xb4\x2d\x74\xea\x4e\xed\x3b\xe3\x47\xfb\xed\x82\x3d\x19\xd4\x3b\x6b\xaf\xae\x2b\x2f\x57\xb3\x82\x68\xcb\xed\x88\x2e\xe1\x5c\xd7\x26\xfa\x0a\x65\xe7\xce\x11\x33\xb4\xdd\x66\xe3\x37\xf6\xfa\x70\xd6\x4f\xa1\x21\x51\xd8\x3c\x26\x14\x4b\xc6\x87\x44\x27\x1c\x70\xf8\x9e\x46\xce\xab\x21\x07\x5f\xc1\x76\x17\x1b\x77\xb4\xda\x75\xa0\x0a\x3a\x30\xe1\xf8\x97\x32\x16\x2b\x00\x75\x85\xee\x62\x46\xef\xd3\x85\xb5\x6b\x60\xbe\xf2\x30\x7a\x8c\x0b\x4b\xa6\xd0\xf9\x64\x42\xe7\x07\x41\x41\xe3\x2c\x5d\xf9\x6d\xe9\x39\x98\x3b\x3b\x5d\x67\xd4\x5c\xed\xf2\xf0\x48\x7b\xbd\x2d\x31\xdd\x3f\x34\xad\x44\x76\x51\x9a\x56\x22\xa7\x95\xc8\x69\x25\xf2\xe1\x56\x22\x1f\x00\x32\x6a\x73\x92\xed\xe1\xc6\x7d\x9f\x49\x2c\x69\x7e\xc8\x31\x4c\x0c\xb4\xf2\x54\x3b\x79\x3b\x9e\x4d\xb4\xd1\x18\x3e\x5f\x9a\x93\xa2\x11\xc3\xda\x27\x0b\xaf\x37\x2e\x5c\x37\xfb\xeb\x9a\xd6\xc3\xac\xc3\xcc\xf8\x1e\x5b\x9d\xac\x22\x64\xb7\xed\x26\xb8\xf3\xb9\x3c\xbb\x1f\xe2\xb0\x22\x77\x43\x6a\x62\x29\x39\x59\xa6\xe6\xe5\xcd\x7b\x83\xc0\x5b\x8e\x93\x64\xac\xeb\xca\x4f\x65\xac\x4a\xbc\x1e\xcd\x82\xfa\x3c\x70\x36\xb6\xb5\xed\x79\xef\xec\x68\x00\xff\x54\xfa\xb5\xe3\xf1\xdb\xe1\xbe\xce\x76\x17\xaf\x57\xb6\x6b\x89\x05\x09\xce\x52\xb9\x01\x2a\x49\xbe\xd9\xf4\xd2\xb8\x7a\xbf\x91\x02\xf3\x22\x8c\x13\xf2\x77\xd8\x8e\x43\x8b\xe1\x54\x6e\x5e\x9d\xc7\x49\x44\x02\x22\xc7\xa4\x79\x81\x85\xb8\x65\x3c\x1c\x93\xe6\x59\xa2\xf8\x1c\x51\x95\x05\xd9\x20\x00\x21\x7e\x60\x21\x58\xa9\x56\xff\xbe\xb6\x5a\x5e\x5b\x3f\x1f\xd6\xd3\x3c\xc4\x4d\xba\x99\xb4\x63\x6e\x7d\x3e\x3d\x57\xd2\x18\x5f\x47\xe8\xc3\x06\x8a\x68\x6c\x7f\x3b\x72\x0f\xe7\xe2\x77\x77\xf1\xd0\x99\xab\xdf\x2e\xfe\xd6\xbb\xcd\x1a\xb9\x90\xd1\xaf\xf2\x38\x3d\xdb\x74\xf8\xeb\xe3\xda\xe8\x2a\x62\xb7\xda\x1b\x07\xa9\xdc\x30\x5e\xbc\x68\xfb\x6b\x9f\x97\xf1\xc6\xb1\xd8\x5c\x29\x1e\x49\x30\xc5\xf7\xde\xad\x91\x42\xf9\xdd\xed\x89\x80\x25\xbe\x37\xd7\xe7\x32\x5c\xe6\x35\xac\xd4\x0c\x2d\xf7\x90\xc4\xe3\xf5\xe3\x2f\x7f\x54\x18\x88\xe3\x61\x47\x85\x64\x7f\xc0\xd7\x3f\x1a\x92\x42\xe9\xc7\x1e\x0d\x95\x76\xa7\x51\xa0\x8f\x02\x1b\x46\x9e\x06\x42\xd1\xf2\x01\x07\x02\xde\xe9\x7d\x1a\x0b\xa7\x32\x16\xcc\xc0\xee\xc4\x90\xd2\x5f\x6f\x98\x54\x5d\xf2\x95\xe1\xa7\x69\x10\x3a\x06\xe1\x65\xb3\x17\x47\x58\x78\xd0\x45\xd6\x5b\xd5\x5f\x25\x1d\x71\x49\xa6\x7a\x64\xda\xd0\x6f\xc7\x3a\x4c\xe3\x09\xc0\x6e\x96\x2c\xa7\xa7\x77\x34\x10\x05\x08\x21\x44\x92\x65\x77\xdf\x20\x5c\xbc\xe7\x97\x3f\xf4\x1a\x45\xd6\xe7\x27\x4a\xde\x74\x27\x66\x11\x7d\x70\xba\xd3\x78\xf9\x1e\x0d\xca\xc8\x39\xde\x7c\xb3\xa6\xe1\xbc\xd7\xc1\x6a\x6f\xb3\x0e\x52\xbe\xe4\x98\x8a\x15\x70\x94\x70\x26\x59\xc0\xa2\xf2\x1c\xfb\xd9\xc5\xf9\xbc\xd5\x92\x9c\xa3\xdf\xe6\x1e\xb3\x0d\x49\xba\x87\x50\x5f\x84\xfe\xe9\xd6\xf8\xbb\xe6\xf0\x7a\xeb\xa6\x65\x3b\x86\x8b\x79\x93\xf5\x59\x20\x6e\xb4\xa7\x44\xf4\x3f\xa5\xfe\x67\x42\x12\xdb\xd3\xe7\xbb\xa5\xa3\x8c\x5c\x2b\x97\xbb\xbb\x7f\x8e\xc5\x6e\xed\x43\x5c\xbf\x74\xc8\x8f\xff\xe6\xd6\xbe\x91\xb6\xf5\x95\xe4\xed\x93\xc4\xa8\x5b\xf9\x76\x4d\x35\xb7\xd8\x8c\xb6\x7d\xaf\x72\xe0\xb6\xbd\x01\x63\x9e\x76\xab\x1a\x32\x76\xe4\x8c\x76\xc2\xad\x6c\xa2\x65\xf7\xcf\xf8\xa7\xda\x2a\xb9\x8c\x3d\x3c\xa3\x9d\x64\x33\xe5\x1a\xb5\x2d\xfb\x86\xa2\x5a\x7f\x19\x5b\x7f\xc6\x3f\xd1\x53\xd3\xe2\x41\x5b\xd3\x4f\xf0\xec\xb0\x42\x73\x43\xd2\x68\x27\xd3\x6a\x6a\x34\xf6\x4e\x1e\x52\x8b\x87\x6c\xcc\xae\x44\xfb\x9e\xa7\x51\x4f\x9d\x55\x03\x81\x8e\x67\xfc\xb4\x69\xf0\x3a\x18\xf2\x40\xd0\xf6\xa8\x34\xe3\xc9\x98\xaf\xf6\xda\x24\xd3\xeb\x60\xb9\x0e\xd3\x1f\xa9\xff\xee\x1f\xfd\x37\x00\x00\xff\xff\x69\x5d\x0a\x6a\x39\x9d\x00\x00") +var _v2SchemaJSON = []byte("\x1f\x8b\x08\x00\x00\x09\x6e\x88\x00\xff\xec\x5d\xdf\x73\xdc\xb6\xf1\x7f\xcf\x5f\x81\xb9\x78\x46\xf6\x24\xd6\x39\xfe\x7e\x5f\xea\x97\x8c\x1a\x39\x89\x5a\xbb\xd2\xf8\x9c\xf6\xc1\x95\x67\x70\x24\x4e\x87\x84\x3f\x2e\x04\x29\xe9\xea\xea\x7f\xef\x02\xfc\x71\x04\x01\x90\x20\x89\x3b\x9d\x6d\x7a\xa6\x8d\x8e\x04\x16\x8b\xc5\x62\xf7\xb3\x0b\x10\xf8\xf4\x0d\x42\xb3\x94\xa6\x01\x99\xbd\x42\xb3\x33\xf4\xb7\xc5\xe5\x3f\xd0\xc2\x5b\x93\x10\xa3\x55\x9c\xa0\xc5\x1d\xbe\xb9\x21\x09\x7a\x79\xfa\x02\x9d\x5d\x5d\x9c\xce\xbe\xe7\x15\xa8\xcf\x4b\xaf\xd3\x74\xf3\x6a\x3e\x67\x79\x91\x53\x1a\xcf\x6f\x5f\xce\x99\xa8\x7b\xfa\x3b\x8b\xa3\x6f\xf3\xc2\x4f\xf2\x47\xb5\x1a\xfc\xe5\xf3\xa2\x60\x9c\xdc\xcc\xfd\x04\xaf\xd2\xe7\x2f\xfe\xbf\xa8\x5c\xd4\x4b\xb7\x1b\xc1\x54\xbc\xfc\x9d\x78\x69\xfe\x2c\x21\x7f\x66\x34\x21\xbc\xf9\x0f\xf0\x1b\x9e\x14\xad\x8b\xd7\x9c\xb3\x68\x15\x97\x7f\x6f\x70\xba\x66\x33\xf8\xfb\x5a\xd4\xc5\xbe\x4f\x53\x1a\x47\x38\xb8\x4a\xe2\x0d\x49\x52\x4a\x18\xd0\x59\xe1\x80\x11\x51\x00\xca\xa7\x24\x89\xa4\xb7\x9f\x72\x52\x1f\xef\x9f\x57\x3f\x78\x97\x12\xb2\xe2\xac\x7d\x3b\xf7\xc9\x8a\x46\x82\x2c\x9b\xdf\x92\xc8\x8f\x93\xd7\xf7\x29\x89\x18\x3c\x98\x89\xd2\x0f\xf0\xff\x0f\x39\x79\x0d\xdd\x92\xfb\x1a\xed\xb2\xdb\x2c\x4d\x68\x74\x53\xf4\x05\x9e\x93\x28\x0b\xab\x6e\x8b\x27\x30\x26\xb3\xe2\xd7\x75\x55\xcc\x27\xcc\x4b\xe8\x86\x73\xc4\xa9\xbc\x5f\x93\x6a\x0c\x6f\x49\xc2\xf9\x42\xf1\x0a\xa5\x6b\xca\x90\x1f\x7b\x59\x48\xa2\xf4\xb4\xe0\xb4\x2e\xc2\xce\xce\x8a\x52\x52\xbd\x75\xcc\x52\x9b\x8e\x14\x62\xe6\xaf\x3e\x7e\xf8\xf8\xe9\x61\x8e\x5e\xfd\x1b\xfe\x5d\x7f\xf7\xf4\xc7\x57\xf0\x97\xff\xdd\xb3\x1f\x9f\xcc\xda\xfa\xc3\x1b\x42\x4f\x23\x1c\x12\x04\x1a\x4a\x37\xcf\xf2\x1e\x11\xa1\xa0\xe8\xf5\x3d\x0e\x37\x01\x79\x85\x4e\x76\x8a\x79\x22\x73\xba\xc4\x8c\x5c\x81\x72\xf4\xe5\x76\xde\xca\x16\xa7\x8a\xb8\xce\xa1\x34\xd6\xb1\x33\xc7\x1b\x7a\xd2\x90\xb5\x50\xf8\x9a\x42\x18\xc5\x5d\x14\x7c\x43\x41\xc6\x12\x05\x0f\xde\x66\x0d\x12\x0d\xe6\xce\x50\x00\xd5\xb8\x90\xde\x5e\xbc\x7d\x8d\x78\x4f\x19\xc2\x9e\x47\x36\x29\xf1\xd1\x72\x5b\x31\xbb\xeb\x9e\x9e\x89\x90\xf8\x14\xbf\x87\xea\x2a\x1b\xa0\xdc\x7e\xe6\xf5\x67\xa3\x68\x1a\x79\x38\x42\x05\x8d\x51\x6c\x88\x29\xdf\x29\xcd\xca\x32\xec\x6a\xd6\x5e\x77\xd7\xaf\x17\x6e\xb4\x9f\x80\x5a\x82\xc2\x58\x31\x51\x94\x3d\x37\x51\x4b\x08\xdb\xc0\x43\x1b\xfd\x28\x8b\x1a\x69\x31\xe2\x65\x09\x4d\xb7\x16\xaa\x56\x96\xd4\xd6\x3f\xef\x23\x27\x5d\x25\x89\x6a\x8a\x6f\x98\x6e\x16\xe2\x24\xc1\xdb\x9d\x1e\xd0\x94\x84\xf5\x72\xc6\x06\x81\x5e\x69\x12\x1f\xaa\xda\x59\x44\xff\xcc\xc8\x45\x41\x23\x4d\x32\x22\xf1\x40\xee\xf9\x04\xc7\xc1\x79\xec\x59\x74\x49\x2a\xdd\xb0\xf0\x3a\x1d\x52\xcc\xa9\xc6\xad\xe9\x66\xcb\x2f\x24\x22\x09\x0e\x10\xaf\x9e\x84\x98\x3f\x46\x78\x19\x67\xa9\x66\xb6\x2a\x5e\x51\x3c\x2d\xcc\x7d\x55\xac\x72\xf4\x8a\xcf\xe8\xf2\x8c\xe5\xd4\x32\x78\x47\xf1\x5a\xf6\x90\x2d\x02\xd4\x7a\xc9\x52\x8e\xf2\xc0\x69\x3c\x66\xad\x1b\x8d\xd6\x0c\x06\x5c\x27\xdb\x33\x94\xab\x04\xc2\x91\x0f\x56\x87\x78\x14\x2c\xb7\x20\x5a\xf7\x24\x35\xce\xbe\x57\xa5\x3a\xa6\x75\x06\x20\x27\x4a\xa9\x57\x79\x64\x70\xed\x4b\x70\xd0\x9d\x8d\xcb\x94\x86\x33\x10\xc4\x11\x07\x04\xb5\xe7\x92\x0b\x5d\xac\xe3\x2c\x00\xcf\x40\x90\x4f\x57\x2b\x92\x00\x46\x40\xab\x24\x0e\x45\x09\x21\xa7\x53\x84\x7e\xa1\xe9\xaf\xd9\x12\xfd\x1c\xe0\xdb\x18\x74\x0f\xbd\xc5\xc9\x1f\x7e\x7c\x17\x21\x40\x16\x38\x08\xe2\x3b\xe2\x1b\x7a\x01\x6a\x14\xb2\xcb\xd5\x82\x24\xb7\xd4\x1b\x33\x8e\xdc\xeb\x0a\x62\x9c\x7b\x96\x93\x13\xa8\xb5\x5d\x8a\xe0\x32\x53\xec\xa5\x76\xea\x5a\x16\xd6\x52\x0a\xa0\x41\x30\xba\x76\x94\xca\xc2\xaa\xc2\x37\x1d\x7a\x83\x3b\x5b\x93\xf1\x53\x5e\x53\x32\x19\xa5\x34\x60\x60\x40\xd7\x24\x0d\xeb\x39\xfd\x0d\x73\x91\xc3\xb0\x91\x43\x48\x7d\x50\x30\xba\xda\x42\x59\x94\xa3\xba\x9c\xcb\x42\x12\x08\xda\x85\x80\x61\x0e\x91\x02\x8e\xe8\x7f\x44\xbf\x0c\x23\x9b\x25\xc1\x48\x5e\x7e\x7b\xf7\x06\x6d\x62\x0a\xfc\x00\x33\x05\x8e\xf3\x54\xb9\x9e\xca\x84\xf2\xe7\x9c\x06\xb8\x3b\x3d\x6b\x30\xe5\xe9\x58\xe6\x04\x0d\x04\xc3\x05\xde\x9e\x59\x49\xc9\xc0\x65\xce\x4c\x9b\xe5\x3d\x98\xb1\x97\x74\x5f\x9d\x4f\x46\xdd\xd7\xfb\x3c\xa1\x8d\x03\xfd\xdb\xfe\x14\xbc\xae\xd4\x45\x17\x05\xfc\x3d\x45\x17\xe9\x09\x43\x24\xf2\xe2\x2c\xc1\x37\x60\x44\x41\xe3\x32\xc6\xfd\x12\xba\x5c\x00\x28\x8e\x43\x18\x08\xba\x0c\xaa\x6a\x07\xd5\xfb\xaa\x4d\x2b\x5d\x3f\x16\x1d\x52\x42\x00\x4b\xeb\xf9\x8e\x04\x20\xeb\xdb\x3c\x84\x63\xa5\x0c\x68\xe4\xd3\x5b\xea\x67\x80\xc4\x80\x0d\x21\x21\x76\x8a\x40\x62\x5b\x14\x66\x10\xcd\x80\x8f\x4c\xca\x8a\x45\x95\x93\x32\xbc\x3c\x39\x55\xc2\xc8\x3d\x0a\xa3\xa6\x0e\x10\xa8\x5a\x11\xe3\x3d\xe5\xb0\xb8\x6d\x14\xdb\xe6\x8e\x4d\x00\x65\x92\xbe\x81\x6e\x27\xc2\x2f\x92\x49\x0a\x9f\x8d\xd1\xbc\x8c\x44\x72\x20\x04\x68\x92\xe7\xb4\xf2\xf6\x59\x81\x79\x96\x42\xcd\x61\xb0\x72\x72\x0c\xc6\x91\x3f\x29\x82\x69\xbf\x00\x86\x22\x1c\x95\x23\xe4\x86\xaa\x69\x22\xb8\x3d\xf6\xbd\x6a\xaf\x7f\xf7\x13\x02\x38\x97\x81\x9f\x15\x8e\x81\x09\x5c\x50\x0b\x56\xa5\x6e\xe9\x62\xc9\x3d\xf6\xaa\x6c\x6e\xbf\x9d\x32\x45\x79\x3d\x7b\x23\xfb\x8c\x06\x83\x6a\xac\x56\xb6\x5a\xe5\xda\xc4\xcb\x2e\x2f\xc6\xcd\xb9\xe2\xc4\x4c\xfe\xc9\x3e\x26\x70\xe1\x3a\x8e\xdd\xfa\x93\x3c\xdd\x36\x66\x88\x95\x04\x41\x48\x43\xf2\x3e\xa7\xd1\x99\x2e\xd4\xb8\xd6\x2a\xdb\x55\x42\x80\x5f\xdf\xbf\xbf\x42\x21\x40\x38\x70\xf9\x0d\x8b\xc2\xd9\xc0\x8d\xa1\xec\x09\x81\x76\x49\xa3\x81\x38\xe8\x88\xe2\x7c\x39\x3b\x24\x09\x43\xce\x10\x89\x57\x6a\x96\x48\x37\x54\xb5\x97\x0f\x52\x75\x43\x9a\xa8\x51\x70\x06\x0e\x22\xc4\xc9\x76\x54\xfc\xbd\x4c\x28\x81\x88\x35\xa7\x54\xaa\x45\x35\xf6\x8f\x16\xfc\x57\x1c\x7c\x3f\x22\xba\x37\x18\x5a\xf1\xce\x36\xa5\xd6\xa4\x59\x31\x76\xe1\xbb\x48\xfb\x14\x01\x27\xdd\xa5\x5c\xba\x64\xaf\x49\x6f\x1b\x84\xdb\x33\xc5\xdd\x22\x16\x4d\x9a\xbb\xc9\x96\x26\xf9\x3f\x88\xad\x82\x8e\x2b\xb6\xb4\x59\xf0\x16\x92\xbb\xf2\x66\x9a\xba\x5c\x78\x0b\x49\xc5\x0a\x36\x26\xb1\xb2\xee\xd2\x42\x4b\x59\x7b\x69\x52\xf3\x39\x0e\xf1\x70\x4a\x8c\xda\xb9\x8c\xe3\x80\xe0\xa8\xa9\x9e\x2b\x9c\x05\xa9\x84\xa6\x15\x46\xd5\xb4\x7d\x1b\xa7\x52\xea\x5e\xd0\x32\xc6\x48\x02\xf8\xbb\x02\x42\x47\xe4\x34\x0a\xc2\xbd\x81\xd0\x0d\xb1\xcc\x08\xee\x7c\xb4\x5e\xf9\x33\x47\x74\xe4\xe5\xd4\xe1\x84\x7c\x12\xc0\xdc\x72\x42\x2a\xde\x34\xa3\x81\xe1\xb4\xd6\x04\x2b\xd3\x65\x98\xa0\x70\xea\xad\x1d\x51\x72\x64\xb7\xb4\x93\x4e\xbb\x9a\x67\x9d\x9c\xc8\xeb\x56\x61\x2c\x4f\x29\x31\x61\xbb\x09\x05\x4b\x9e\xf0\x44\x04\x8e\xb6\xe8\x16\x07\xd4\xcf\x11\x26\x83\x60\x23\x83\x32\xb1\x2f\xc2\xa6\x93\xc2\xdc\xd4\xb3\x12\x21\x95\xa7\xec\x0f\x6e\x67\xfd\xd3\x0f\x2f\x9e\xff\xe5\xfa\xd3\xff\x3d\x3c\x7b\xf2\xdf\x8f\x4f\x8b\xf6\x9f\x3d\xe9\x67\xc1\xff\x89\x83\x8c\x18\xf2\x1c\x7b\x30\x2b\x51\x9c\x36\x40\xa8\x7e\x84\x2c\x65\xd4\x29\x25\x6d\x37\xfa\x77\x64\xd7\x95\x2e\xf5\xcb\xe5\x59\x53\xc1\x38\x22\x97\x2b\x29\x86\xe8\x31\x3a\xda\x81\xb1\xa8\xcf\xb7\x00\xbd\x23\x62\x6d\xc9\xd3\x2c\x89\x5c\x6b\x59\x1f\x1e\x14\xd5\xa7\x53\xd9\xc4\xbe\x23\xeb\x6a\xdb\x93\x54\x53\x95\x76\x53\x62\x2d\x52\x93\x93\x5f\x4a\x93\x3d\x28\xad\x68\x40\x16\x3a\x6a\xb5\x5f\xd7\x46\xbb\x6d\x6d\x21\xcb\xc2\x86\x48\x41\x89\xd5\x5b\x48\x55\xa5\x5b\x26\xef\x91\x61\x15\x49\x89\x55\xb9\x39\xcf\xa4\xe5\x4d\xcc\x5a\x9a\x77\x06\xf8\xf4\xd3\x4c\x90\xb4\x9e\x5f\xa9\x9c\x53\x91\x98\xd2\x85\x73\xca\x0e\x38\xf1\x54\x53\x92\x9b\x71\xb1\xa2\xde\x7c\x4a\xa3\x94\xdc\xa8\x8f\x75\xe8\x1c\x95\x29\x86\xce\x09\x51\xa5\xc4\x7a\x5b\x08\x5d\xc2\xc2\x04\x35\x12\x1a\x52\xbe\xca\xc0\xf2\x04\x85\x96\x9e\x17\x07\x01\x0c\x25\x54\xf8\x59\xcb\x93\x69\x85\xbb\x51\xcb\x80\x22\xcb\x60\xc5\x82\x64\x59\x58\x4b\x29\xc4\xf7\x34\xcc\x42\x3b\x4a\x65\x61\x83\x01\xf1\x82\x8c\x81\x50\xde\xf6\x21\xa9\xd4\xd2\x73\x09\xe5\xed\xb9\x2c\x0a\x77\x70\xd9\x87\xa4\x52\xcb\x24\xcb\x37\x24\xba\x49\x2d\xf1\xef\xae\xb8\xa9\xcf\xbd\xa8\x55\xc5\x4d\xb8\xbc\xd8\x39\x69\xb7\x14\x25\x0a\x9b\x7a\x79\x61\x3f\x55\xaa\xd2\xa6\x3e\xf6\xa1\x55\x96\xd6\xd2\x92\x33\x86\x16\xe4\xea\x15\xf4\xba\x12\x59\xeb\x47\x64\xd4\x09\x98\x79\x14\x3c\xe5\xa5\x12\x06\x1b\xfa\xb8\x2b\x6f\x98\xf9\xfd\x61\x90\xe2\x99\x1f\xc9\xe9\x36\x8b\xb7\xec\x4e\x85\xe0\xa9\x70\x54\x5b\x1e\x3a\x25\x62\x25\xfc\x0e\x82\x2b\x74\xff\x9c\x67\x3d\x45\x64\xd5\xbd\x6b\x86\xe7\x8d\x35\x65\x8c\xbb\x0f\x97\xb1\xbf\xbd\xaa\xd6\xf5\xc6\x6d\x7c\xa8\xbb\x16\x69\xdf\x9f\x8c\x1b\xaf\x8f\x31\x6d\xe3\x2a\xbb\x9d\xa7\xd6\x35\xc9\xed\x2a\x58\xe7\xcb\xf7\x94\xc7\xc5\x7c\x8f\x9b\xd8\x3d\x43\x21\x8a\x2e\xd0\x25\x2f\x9d\xb1\x71\xfb\xdb\x1c\xef\x18\xd9\x31\x6e\x40\x11\x63\x04\x76\xce\x09\x83\x95\x2b\x12\xc2\x41\xec\x61\xbd\xd0\x6c\xa0\x18\xd7\xe5\x6e\xbc\x54\x53\xe0\x3e\xb9\x52\x13\xdb\x77\x6b\x22\x12\x20\x71\x82\x20\x76\xcf\xbf\x6c\xa8\xd8\xe6\x83\x55\xb6\xc7\x4b\xe4\x09\x2c\x1c\x9c\x0e\xc8\xc4\x6a\xc3\x39\xbb\x38\x6d\xc4\xb6\x8a\x1c\xb7\x57\x16\x62\x91\x2d\x17\x4d\x46\x8e\x2d\xec\xe9\x9c\xeb\x9f\xa9\x06\x1c\xcf\x44\x93\x03\x3d\xfe\x4f\x3f\xd5\x26\xa3\x3a\xd4\xa8\x1e\x3e\x36\x35\x04\xa1\x86\x90\x75\x8a\x4d\xa7\xd8\x74\x8a\x4d\x5b\x7b\x3d\xc5\xa6\x5f\x68\x6c\xfa\x4d\xfd\xbf\x25\x4e\x02\xde\x93\xed\x04\x93\x26\x98\x54\x7b\x2a\x74\x62\x42\x49\xfb\x43\x49\x82\x99\xd7\xe1\x26\xdd\x36\x57\x15\xa5\x96\x6d\x76\xbf\xb4\xb1\x25\x9a\x61\x88\xc1\x94\xe2\x49\x19\x5c\x53\xdb\xe5\xb6\x60\x38\x0a\xb6\x5c\x6f\x45\xc2\x86\xaf\x8a\x73\xa6\x78\xce\x26\x33\x7d\x33\x31\x21\xbc\xa3\x44\x78\xff\x82\x01\x7c\xcb\xad\xfe\x04\xf5\xd0\x04\xf5\x26\xa8\x37\x41\x3d\xd4\x84\x7a\xdc\xe4\x9d\xe3\x14\x4f\x68\x6f\x42\x7b\xb5\xa7\xa5\x5a\x4c\x80\x6f\x02\x7c\x3a\xde\x3f\x0f\xc0\xd7\x78\xc8\xf7\x69\x4d\x20\x10\x4d\x20\x70\x02\x81\x5d\xbd\x9e\x40\xe0\xd7\x04\x02\xf9\x27\x2c\x9f\x27\x00\x34\x7d\xb6\x59\x3c\x2d\x1e\x75\x6f\x9f\x1c\x04\x18\xb5\x4e\x4d\xfa\xd6\xb1\xd6\xb4\xa8\xe1\x1c\x62\x1e\x39\x8c\xe4\x8a\x35\x41\xc8\x69\x65\xb5\xfa\xf7\x75\x40\xae\x09\x69\xa1\x09\x69\x4d\x48\x6b\x42\x5a\xa8\x89\xb4\xa2\x38\xfa\xeb\x21\x36\xa9\xea\x3f\x1e\x19\xf4\x75\x9a\x71\xd3\x9c\x4e\x74\x16\xf4\x5a\x32\x8e\x03\x29\x9a\x96\xab\x07\x92\x33\xa0\x61\x65\x64\xaf\x1b\x18\x5a\x33\xa4\x83\x04\x2e\xef\x62\x1e\xd8\x09\x45\xd1\x3a\xd8\x57\x76\x64\xda\x7e\x4d\x7b\x06\x80\x2b\x47\x8c\x94\xd5\x8f\xe1\x04\x04\x83\xa5\x13\xd0\x73\x3a\x07\x3d\xc6\x4b\x09\x17\x5c\x7f\xe7\x3e\x1c\xb8\x68\x8f\x5d\x2d\xfb\x67\x79\xb4\xfb\x7c\xd7\x9d\xb9\x74\x1a\xad\x35\xbc\x1e\xd1\xa0\xe6\x2b\xd0\x5e\x70\x67\x50\x93\x6d\x98\xa8\xd3\x66\x0f\x68\xb1\xeb\x73\x8e\x0e\x20\x36\xa4\x45\x17\x68\x6d\x40\xbb\x4e\x20\xdd\x90\xfe\xba\xc0\x7d\xa3\xfa\x3b\x0a\x1c\xda\xb6\x2c\xf9\x97\x98\x89\x38\xe4\xa2\x88\x99\x86\x01\x49\x07\x2d\x9f\xe7\xf3\xe9\xc5\x20\xf0\x39\x40\xe6\xa3\x10\xea\x3e\x25\xbd\xef\x86\xdb\x05\x6d\x81\x81\x07\x08\xbb\x13\x28\x83\xc0\xcd\xc7\x28\x1c\x42\xea\x07\x69\xbd\x5d\xf4\xa6\xb4\xdf\x18\x06\x72\xaf\x7f\x26\x67\x3e\x6c\x23\x94\x21\x96\xcc\x18\xc6\x74\x7e\xfa\xce\xcb\x44\xdb\xc3\x1e\xa1\xd0\xcc\xa8\xca\x95\x6b\xbf\x9a\x99\xd3\x0a\x4d\x3c\xe8\x01\x95\x26\x15\x36\x06\x4f\xd5\x02\x28\x8b\x94\xd3\xa3\x89\x51\xb7\xd0\x29\x1b\xb5\x1f\x94\x97\xfa\xb3\xfd\x7a\x32\x28\x0f\xd6\xa8\xa1\xc3\x41\xa0\xa2\xb6\x96\xb3\x09\x4d\x9d\x33\x1d\x5a\x68\xdb\x29\x3d\x77\x86\x98\xc1\x1c\x21\xe5\x7d\xea\x9e\x7b\x7d\x38\xeb\x27\x50\x9f\x72\x6c\x0e\x62\xc2\x69\x9c\x0c\x89\x4e\x12\x88\xf9\x2f\xa3\xc0\x78\x30\xe3\xe0\x23\xd8\xee\x43\xe5\x84\x54\xbd\x0c\x78\x41\x03\x26\x74\x7f\x24\x62\xb1\x02\x50\x17\xe8\x2e\x66\xb4\xfe\xba\xb0\x76\x0c\xcc\x17\x1e\x46\xbb\x38\xb0\x64\x0a\x9d\x8f\x26\x74\x7e\x14\x14\xe4\x66\xe9\xca\x6e\x4b\xcf\xde\xcc\xd9\xf1\x1a\xa3\xe6\x6a\x97\x85\x45\x1a\x75\xb3\xc3\x74\xfe\xd0\xb4\x12\xd9\x45\x69\x5a\x89\x9c\x56\x22\xa7\x95\xc8\xc7\x5b\x89\x7c\x04\xc8\x28\xf9\x24\xdd\xb5\x89\x63\x2f\x29\x2c\x69\xbe\xcb\x31\x0c\xbf\x16\x62\xa6\xf4\xb7\xe3\xd2\x42\x1d\x8d\xe1\xfe\x52\x75\x8a\x4a\x0c\xab\x77\x16\x56\x37\x4c\x98\xce\xd5\x97\x25\x2d\x87\x59\xfb\xf1\xf8\x16\x5b\x9d\xb4\x5d\x10\xa7\xed\x6e\x70\xe7\x65\x75\x7a\x3b\x04\x4a\x40\xef\x87\xd4\x04\x95\x4f\xe8\x32\x53\x0f\x6f\x1e\x0d\x02\xef\x12\xbc\xd9\xb8\x3a\xae\xfc\x58\xe6\x2a\xbf\xfc\xd3\x95\x06\xf5\xb9\x5e\xcc\xb5\xb6\x8d\x3c\x77\xd6\x19\xc0\x3f\x96\x71\xed\xb8\x7a\x76\xb8\xad\xd3\x9d\xc5\x6b\x95\xed\x5a\x62\x46\xbd\xb3\x2c\x5d\xf3\x7b\x24\xf2\xcd\xa6\x0b\xe5\xe8\xfd\x46\x0a\xcc\x8a\x30\xde\xd0\xbf\x93\xad\x1b\x5a\x31\x06\x06\x5f\x5e\x40\x60\x46\x3d\x9a\xba\xa4\x79\x85\x19\xbb\x8b\x13\xdf\x25\xcd\xb3\x0d\xe7\xd3\xa1\x28\x0b\xb2\x9e\x47\x18\xfb\x29\xf6\x89\x96\x6a\xf5\xf7\xb5\x56\xf3\xda\xc6\x79\xbf\x96\xe6\x31\x4e\xd2\x15\xbd\x75\xb9\xf5\xf9\xf8\x4c\x49\x63\x7e\x1d\x60\x0c\x1b\x28\xa2\xb1\xfd\xed\xc0\x23\x9c\x77\xbf\x7b\x88\x87\x7a\xae\x7e\xbb\xf8\x5b\xcf\x36\x6b\xe4\x42\x9c\x1f\xe5\x71\x7c\xba\x69\xb0\xd7\x87\xd5\xd1\x55\x10\xdf\x49\x77\x1c\x00\x4f\x71\x52\xdc\x27\xfb\x5b\x9f\x7b\xe9\xdc\x68\x6c\x2e\x14\x8b\x24\x18\xe7\x7b\x74\x6b\xb4\x10\x7e\x77\x7b\xcc\x83\x5e\xdb\x5e\x84\x22\xfa\xb0\xc8\x6b\x68\xa9\x29\x52\xee\xd1\x13\x8b\xbb\x87\x3f\xff\x59\xa1\x20\x8e\xc7\x9d\x15\x69\xfc\x07\xf9\xf2\x67\xc3\xa6\x10\xfa\xa1\x67\x43\x25\xdd\x69\x16\xc8\xb3\x40\x87\x91\xa7\x89\x50\xb4\xbc\xc7\x89\x80\x77\x72\x9f\xe6\xc2\xb1\xcc\x05\x35\xb0\x3b\x32\xa4\xf4\xf5\x4d\x93\x6a\x48\xbe\x30\xfc\x34\x4d\x42\xa4\x9f\x84\x8b\xe6\x28\x3a\x58\x78\x90\xbb\x2c\xb7\x2a\xdf\x3d\xea\x70\x49\xa6\xba\xe2\x59\x91\x6f\xc7\x3a\x4c\xe3\x0a\xc0\x6e\x96\x34\x5f\x4f\xef\x68\xa0\x88\x10\x9f\xf8\x28\x8d\xc5\xd9\x37\x08\x17\xf7\xf9\xe5\xf7\xb4\x06\x81\xf6\xfa\x89\x92\x37\xd9\x88\x69\xba\x3e\x38\xdd\xa9\xdc\x3b\x2f\x89\xc8\x9a\x8c\xe1\xce\x37\x6d\x1a\xce\x7a\x1d\xac\x76\x37\xeb\x20\xe1\xa7\x09\x8e\x18\xf0\xc4\x2f\xff\x48\x63\x2f\x0e\xca\xef\xd8\xc5\x75\xff\x6d\xe2\x34\xce\x7e\x9d\x79\x14\x1b\x92\x64\x0b\xc1\x9f\x30\xf9\xd1\x9d\xf2\xbb\x66\xf0\x7a\xcb\xa6\x65\x3b\x86\x89\x79\x95\xf5\x99\xc7\x6e\xa5\xab\x44\xe4\x9f\xa9\xfc\x73\x43\x37\xba\x8b\xc7\x77\x4b\x47\x82\x5c\x2b\x97\xbb\xb3\x7f\x0e\xc5\x6e\xed\x41\x58\x3f\x74\xc8\x8e\xff\xe6\xd6\x3e\x47\xdb\xfa\x4a\xf2\x7a\x27\xe1\x74\x2b\xdf\xae\xa9\xe6\x16\x1b\x67\xdb\xf7\x2a\x03\xae\xdb\x1b\xe0\xf2\x6b\xb7\xaa\x21\x65\x47\x8e\xb3\x2f\xdc\xca\x26\x5a\x76\xff\xb8\xff\xaa\xad\xea\x97\xb2\x87\xc7\xd9\x97\x6c\x6a\xbf\x9c\xb6\xa5\xdf\x50\x54\x1b\x2f\x65\xeb\x8f\xfb\x2f\x7a\x6a\x52\xdc\x6b\x6b\xf2\x17\x3c\x3b\xac\xd0\xdc\x90\xe4\xec\xcb\xb4\x9a\x18\x95\xbd\x93\xfb\x94\xe2\x3e\x1b\xd3\x0b\x51\xbf\xe7\xc9\xe9\x57\x67\xd5\x44\x88\xdc\x29\x7f\xd4\x54\x78\x19\x0c\x59\x20\x68\x7d\x54\x2a\x78\x52\xfc\xd5\xa8\x4d\x32\xbd\x3e\x2c\x97\x61\xfa\x37\xfc\x7f\x0f\xff\x0b\x00\x00\xff\xff\x31\x8b\xeb\xb6\x54\x9c\x00\x00") func v2SchemaJSONBytes() ([]byte, error) { return bindataRead( @@ -104,7 +118,7 @@ func v2SchemaJSON() (*asset, error) { return nil, err } - info := bindataFileInfo{name: "v2/schema.json", size: 40249, mode: os.FileMode(420), modTime: time.Unix(1482389892, 0)} + info := bindataFileInfo{name: "v2/schema.json", size: 40020, mode: os.FileMode(420), modTime: time.Unix(1446147817, 0)} a := &asset{bytes: bytes, info: info} return a, nil } @@ -162,7 +176,7 @@ func AssetNames() []string { // _bindata is a table, holding each asset generator, mapped to its name. var _bindata = map[string]func() (*asset, error){ "jsonschema-draft-04.json": jsonschemaDraft04JSON, - "v2/schema.json": v2SchemaJSON, + "v2/schema.json": v2SchemaJSON, } // AssetDir returns the file names below a certain @@ -204,6 +218,7 @@ type bintree struct { Func func() (*asset, error) Children map[string]*bintree } + var _bintree = &bintree{nil, map[string]*bintree{ "jsonschema-draft-04.json": &bintree{jsonschemaDraft04JSON, map[string]*bintree{}}, "v2": &bintree{nil, map[string]*bintree{ @@ -257,4 +272,3 @@ func _filePath(dir, name string) string { cannonicalName := strings.Replace(name, "\\", "/", -1) return filepath.Join(append([]string{dir}, strings.Split(cannonicalName, "/")...)...) } - diff --git a/vendor/github.com/go-openapi/spec/expander.go b/vendor/github.com/go-openapi/spec/expander.go index 9f2275f57..eb1490b05 100644 --- a/vendor/github.com/go-openapi/spec/expander.go +++ b/vendor/github.com/go-openapi/spec/expander.go @@ -17,11 +17,7 @@ package spec import ( "encoding/json" "fmt" - "log" "net/url" - "os" - "path" - "path/filepath" "reflect" "strings" "sync" @@ -30,17 +26,6 @@ import ( "github.com/go-openapi/swag" ) -var ( - // Debug enables logging when SWAGGER_DEBUG env var is not empty - Debug = os.Getenv("SWAGGER_DEBUG") != "" -) - -// ExpandOptions provides options for expand. -type ExpandOptions struct { - RelativeBase string - SkipSchemas bool -} - // ResolutionCache a cache for resolving urls type ResolutionCache interface { Get(string) (interface{}, bool) @@ -52,11 +37,7 @@ type simpleCache struct { store map[string]interface{} } -var resCache ResolutionCache - -func init() { - resCache = initResolutionCache() -} +var resCache = initResolutionCache() func initResolutionCache() ResolutionCache { return &simpleCache{store: map[string]interface{}{ @@ -66,11 +47,8 @@ func initResolutionCache() ResolutionCache { } func (s *simpleCache) Get(uri string) (interface{}, bool) { - debugLog("getting %q from resolution cache", uri) s.lock.Lock() v, ok := s.store[uri] - debugLog("got %q from resolution cache: %t", uri, ok) - s.lock.Unlock() return v, ok } @@ -81,9 +59,9 @@ func (s *simpleCache) Set(uri string, data interface{}) { s.lock.Unlock() } -// ResolveRefWithBase resolves a reference against a context root with preservation of base path -func ResolveRefWithBase(root interface{}, ref *Ref, opts *ExpandOptions) (*Schema, error) { - resolver, err := defaultSchemaLoader(root, nil, opts, nil) +// ResolveRef resolves a reference against a context root +func ResolveRef(root interface{}, ref *Ref) (*Schema, error) { + resolver, err := defaultSchemaLoader(root, nil, nil) if err != nil { return nil, err } @@ -95,19 +73,9 @@ func ResolveRefWithBase(root interface{}, ref *Ref, opts *ExpandOptions) (*Schem return result, nil } -// ResolveRef resolves a reference against a context root -func ResolveRef(root interface{}, ref *Ref) (*Schema, error) { - return ResolveRefWithBase(root, ref, nil) -} - // ResolveParameter resolves a paramter reference against a context root func ResolveParameter(root interface{}, ref Ref) (*Parameter, error) { - return ResolveParameterWithBase(root, ref, nil) -} - -// ResolveParameterWithBase resolves a paramter reference against a context root and base path -func ResolveParameterWithBase(root interface{}, ref Ref, opts *ExpandOptions) (*Parameter, error) { - resolver, err := defaultSchemaLoader(root, nil, opts, nil) + resolver, err := defaultSchemaLoader(root, nil, nil) if err != nil { return nil, err } @@ -121,12 +89,7 @@ func ResolveParameterWithBase(root interface{}, ref Ref, opts *ExpandOptions) (* // ResolveResponse resolves response a reference against a context root func ResolveResponse(root interface{}, ref Ref) (*Response, error) { - return ResolveResponseWithBase(root, ref, nil) -} - -// ResolveResponseWithBase resolves response a reference against a context root and base path -func ResolveResponseWithBase(root interface{}, ref Ref, opts *ExpandOptions) (*Response, error) { - resolver, err := defaultSchemaLoader(root, nil, opts, nil) + resolver, err := defaultSchemaLoader(root, nil, nil) if err != nil { return nil, err } @@ -138,70 +101,23 @@ func ResolveResponseWithBase(root interface{}, ref Ref, opts *ExpandOptions) (*R return result, nil } -// ResolveItems resolves header and parameter items reference against a context root and base path -func ResolveItems(root interface{}, ref Ref, opts *ExpandOptions) (*Items, error) { - resolver, err := defaultSchemaLoader(root, nil, opts, nil) - if err != nil { - return nil, err - } - - result := new(Items) - if err := resolver.Resolve(&ref, result); err != nil { - return nil, err - } - return result, nil -} - -// ResolvePathItem resolves response a path item against a context root and base path -func ResolvePathItem(root interface{}, ref Ref, opts *ExpandOptions) (*PathItem, error) { - resolver, err := defaultSchemaLoader(root, nil, opts, nil) - if err != nil { - return nil, err - } - - result := new(PathItem) - if err := resolver.Resolve(&ref, result); err != nil { - return nil, err - } - return result, nil -} - type schemaLoader struct { loadingRef *Ref startingRef *Ref currentRef *Ref root interface{} - options *ExpandOptions cache ResolutionCache loadDoc func(string) (json.RawMessage, error) } var idPtr, _ = jsonpointer.New("/id") +var schemaPtr, _ = jsonpointer.New("/$schema") var refPtr, _ = jsonpointer.New("/$ref") -// PathLoader function to use when loading remote refs -var PathLoader func(string) (json.RawMessage, error) - -func init() { - PathLoader = func(path string) (json.RawMessage, error) { - data, err := swag.LoadFromFileOrHTTP(path) - if err != nil { - return nil, err - } - return json.RawMessage(data), nil - } -} - -func defaultSchemaLoader( - root interface{}, ref *Ref, - expandOptions *ExpandOptions, cache ResolutionCache) (*schemaLoader, error) { - +func defaultSchemaLoader(root interface{}, ref *Ref, cache ResolutionCache) (*schemaLoader, error) { if cache == nil { cache = resCache } - if expandOptions == nil { - expandOptions = &ExpandOptions{} - } var ptr *jsonpointer.Pointer if ref != nil { @@ -211,16 +127,18 @@ func defaultSchemaLoader( currentRef := nextRef(root, ref, ptr) return &schemaLoader{ + root: root, loadingRef: ref, startingRef: ref, - currentRef: currentRef, - root: root, - options: expandOptions, cache: cache, loadDoc: func(path string) (json.RawMessage, error) { - debugLog("fetching document at %q", path) - return PathLoader(path) + data, err := swag.LoadFromFileOrHTTP(path) + if err != nil { + return nil, err + } + return json.RawMessage(data), nil }, + currentRef: currentRef, }, nil } @@ -241,7 +159,6 @@ func nextRef(startingNode interface{}, startingRef *Ref, ptr *jsonpointer.Pointe if startingRef == nil { return nil } - if ptr == nil { return startingRef } @@ -267,106 +184,32 @@ func nextRef(startingNode interface{}, startingRef *Ref, ptr *jsonpointer.Pointe refRef, _, _ := refPtr.Get(node) if refRef != nil { - var rf Ref - switch value := refRef.(type) { - case string: - rf, _ = NewRef(value) - } + rf, _ := NewRef(refRef.(string)) nw, err := ret.Inherits(rf) if err != nil { break } - nwURL := nw.GetURL() - if nwURL.Scheme == "file" || (nwURL.Scheme == "" && nwURL.Host == "") { - nwpt := filepath.ToSlash(nwURL.Path) - if filepath.IsAbs(nwpt) { - _, err := os.Stat(nwpt) - if err != nil { - nwURL.Path = filepath.Join(".", nwpt) - } - } - } - ret = nw } } - return ret } -func debugLog(msg string, args ...interface{}) { - if Debug { - log.Printf(msg, args...) - } -} - -func normalizeFileRef(ref *Ref, relativeBase string) *Ref { - refURL := ref.GetURL() - debugLog("normalizing %s against %s", ref.String(), relativeBase) - if strings.HasPrefix(refURL.String(), "#") { - return ref - } - - if refURL.Scheme == "file" || (refURL.Scheme == "" && refURL.Host == "") { - filePath := refURL.Path - debugLog("normalizing file path: %s", filePath) - - if !filepath.IsAbs(filepath.FromSlash(filePath)) && len(relativeBase) != 0 { - debugLog("joining %s with %s", relativeBase, filePath) - if fi, err := os.Stat(filepath.FromSlash(relativeBase)); err == nil { - if !fi.IsDir() { - relativeBase = path.Dir(relativeBase) - } - } - filePath = filepath.Join(filepath.FromSlash(relativeBase), filepath.FromSlash(filePath)) - } - if !filepath.IsAbs(filepath.FromSlash(filePath)) { - pwd, err := os.Getwd() - if err == nil { - debugLog("joining cwd %s with %s", pwd, filePath) - filePath = filepath.Join(pwd, filePath) - } - } - - debugLog("cleaning %s", filePath) - filePath = filepath.Clean(filePath) - _, err := os.Stat(filepath.FromSlash(filePath)) - if err == nil { - debugLog("rewriting url to scheme \"\" path %s", filePath) - refURL.Scheme = "" - refURL.Path = filepath.ToSlash(filePath) - debugLog("new url with joined filepath: %s", refURL.String()) - *ref = MustCreateRef(refURL.String()) - } - } - - return ref -} - func (r *schemaLoader) resolveRef(currentRef, ref *Ref, node, target interface{}) error { - tgt := reflect.ValueOf(target) if tgt.Kind() != reflect.Ptr { return fmt.Errorf("resolve ref: target needs to be a pointer") } oldRef := currentRef - if currentRef != nil { - debugLog("resolve ref current %s new %s", currentRef.String(), ref.String()) - nextRef := nextRef(node, ref, currentRef.GetPointer()) - if nextRef == nil || nextRef.GetURL() == nil { - return nil - } var err error - currentRef, err = currentRef.Inherits(*nextRef) - debugLog("resolved ref current %s", currentRef.String()) + currentRef, err = currentRef.Inherits(*nextRef(node, ref, currentRef.GetPointer())) if err != nil { return err } } - if currentRef == nil { currentRef = ref } @@ -402,69 +245,42 @@ func (r *schemaLoader) resolveRef(currentRef, ref *Ref, node, target interface{} return nil } - relativeBase := "" - if r.options != nil && r.options.RelativeBase != "" { - relativeBase = r.options.RelativeBase - } - normalizeFileRef(currentRef, relativeBase) - normalizeFileRef(ref, relativeBase) - - data, _, _, err := r.load(currentRef.GetURL()) - if err != nil { - return err - } - - if ((oldRef == nil && currentRef != nil) || - (oldRef != nil && currentRef == nil) || - oldRef.String() != currentRef.String()) && - ((oldRef == nil && ref != nil) || - (oldRef != nil && ref == nil) || - (oldRef.String() != ref.String())) { - - return r.resolveRef(currentRef, ref, data, target) - } - - var res interface{} - if currentRef.String() != "" { - res, _, err = currentRef.GetPointer().Get(data) + if refURL.Scheme != "" && refURL.Host != "" { + // most definitely take the red pill + data, _, _, err := r.load(refURL) if err != nil { - if strings.HasPrefix(ref.String(), "#") { - if r.loadingRef != nil { - rr, er := r.loadingRef.Inherits(*ref) - if er != nil { - return er - } - refURL = rr.GetURL() + return err + } - data, _, _, err = r.load(refURL) - if err != nil { - return err - } - } else { - data = r.root - } - } + if ((oldRef == nil && currentRef != nil) || + (oldRef != nil && currentRef == nil) || + oldRef.String() != currentRef.String()) && + ((oldRef == nil && ref != nil) || + (oldRef != nil && ref == nil) || + (oldRef.String() != ref.String())) { - res, _, err = ref.GetPointer().Get(data) + return r.resolveRef(currentRef, ref, data, target) + } + + var res interface{} + if currentRef.String() != "" { + res, _, err = currentRef.GetPointer().Get(data) if err != nil { return err } + } else { + res = data } - } else { - res = data + + if err := swag.DynamicJSONToStruct(res, target); err != nil { + return err + } + } - - if err := swag.DynamicJSONToStruct(res, target); err != nil { - return err - } - - r.currentRef = currentRef - return nil } func (r *schemaLoader) load(refURL *url.URL) (interface{}, url.URL, bool, error) { - debugLog("loading schema from url: %s", refURL) toFetch := *refURL toFetch.Fragment = "" @@ -483,27 +299,33 @@ func (r *schemaLoader) load(refURL *url.URL) (interface{}, url.URL, bool, error) return data, toFetch, fromCache, nil } - func (r *schemaLoader) Resolve(ref *Ref, target interface{}) error { - return r.resolveRef(r.currentRef, ref, r.root, target) + if err := r.resolveRef(r.currentRef, ref, r.root, target); err != nil { + return err + } + + return nil +} + +type specExpander struct { + spec *Swagger + resolver *schemaLoader } // ExpandSpec expands the references in a swagger spec -func ExpandSpec(spec *Swagger, options *ExpandOptions) error { - resolver, err := defaultSchemaLoader(spec, nil, options, nil) +func ExpandSpec(spec *Swagger) error { + resolver, err := defaultSchemaLoader(spec, nil, nil) if err != nil { return err } - if options == nil || !options.SkipSchemas { - for key, definition := range spec.Definitions { - var def *Schema - var err error - if def, err = expandSchema(definition, []string{"#/definitions/" + key}, resolver); err != nil { - return err - } - spec.Definitions[key] = *def + for key, defintition := range spec.Definitions { + var def *Schema + var err error + if def, err = expandSchema(defintition, []string{"#/definitions/" + key}, resolver); err != nil { + return err } + spec.Definitions[key] = *def } for key, parameter := range spec.Parameters { @@ -534,11 +356,7 @@ func ExpandSpec(spec *Swagger, options *ExpandOptions) error { // ExpandSchema expands the refs in the schema object func ExpandSchema(schema *Schema, root interface{}, cache ResolutionCache) error { - return ExpandSchemaWithBasePath(schema, root, cache, nil) -} -// ExpandSchemaWithBasePath expands the refs in the schema object, base path configured through expand options -func ExpandSchemaWithBasePath(schema *Schema, root interface{}, cache ResolutionCache, opts *ExpandOptions) error { if schema == nil { return nil } @@ -549,17 +367,18 @@ func ExpandSchemaWithBasePath(schema *Schema, root interface{}, cache Resolution nrr, _ := NewRef(schema.ID) var rrr *Ref if nrr.String() != "" { - switch rt := root.(type) { + switch root.(type) { case *Schema: - rid, _ := NewRef(rt.ID) + rid, _ := NewRef(root.(*Schema).ID) rrr, _ = rid.Inherits(nrr) case *Swagger: - rid, _ := NewRef(rt.ID) + rid, _ := NewRef(root.(*Swagger).ID) rrr, _ = rid.Inherits(nrr) } + } - resolver, err := defaultSchemaLoader(root, rrr, opts, cache) + resolver, err := defaultSchemaLoader(root, rrr, cache) if err != nil { return err } @@ -570,7 +389,7 @@ func ExpandSchemaWithBasePath(schema *Schema, root interface{}, cache Resolution } var s *Schema if s, err = expandSchema(*schema, refs, resolver); err != nil { - return err + return nil } *schema = *s return nil @@ -581,15 +400,7 @@ func expandItems(target Schema, parentRefs []string, resolver *schemaLoader) (*S if target.Items.Schema != nil { t, err := expandSchema(*target.Items.Schema, parentRefs, resolver) if err != nil { - if target.Items.Schema.ID == "" { - target.Items.Schema.ID = target.ID - if err != nil { - t, err = expandSchema(*target.Items.Schema, parentRefs, resolver) - if err != nil { - return nil, err - } - } - } + return nil, err } *target.Items.Schema = *t } @@ -604,108 +415,101 @@ func expandItems(target Schema, parentRefs []string, resolver *schemaLoader) (*S return &target, nil } -func expandSchema(target Schema, parentRefs []string, resolver *schemaLoader) (*Schema, error) { +func expandSchema(target Schema, parentRefs []string, resolver *schemaLoader) (schema *Schema, err error) { + defer func() { + schema = &target + }() if target.Ref.String() == "" && target.Ref.IsRoot() { - debugLog("skipping expand schema for no ref and root: %v", resolver.root) - - return resolver.root.(*Schema), nil + target = *resolver.root.(*Schema) + return } // t is the new expanded schema var t *Schema - for target.Ref.String() != "" { - if swag.ContainsStringsCI(parentRefs, target.Ref.String()) { - return &target, nil + // var newTarget Schema + pRefs := strings.Join(parentRefs, ",") + pRefs += "," + if strings.Contains(pRefs, target.Ref.String()+",") { + err = nil + return } - if err := resolver.Resolve(&target.Ref, &t); err != nil { - return &target, err + if err = resolver.Resolve(&target.Ref, &t); err != nil { + return } - parentRefs = append(parentRefs, target.Ref.String()) target = *t } - t, err := expandItems(target, parentRefs, resolver) - if err != nil { - return &target, err + if t, err = expandItems(target, parentRefs, resolver); err != nil { + return } target = *t for i := range target.AllOf { - t, err := expandSchema(target.AllOf[i], parentRefs, resolver) - if err != nil { - return &target, err + if t, err = expandSchema(target.AllOf[i], parentRefs, resolver); err != nil { + return } target.AllOf[i] = *t } for i := range target.AnyOf { - t, err := expandSchema(target.AnyOf[i], parentRefs, resolver) - if err != nil { - return &target, err + if t, err = expandSchema(target.AnyOf[i], parentRefs, resolver); err != nil { + return } target.AnyOf[i] = *t } for i := range target.OneOf { - t, err := expandSchema(target.OneOf[i], parentRefs, resolver) - if err != nil { - return &target, err + if t, err = expandSchema(target.OneOf[i], parentRefs, resolver); err != nil { + return } target.OneOf[i] = *t } if target.Not != nil { - t, err := expandSchema(*target.Not, parentRefs, resolver) - if err != nil { - return &target, err + if t, err = expandSchema(*target.Not, parentRefs, resolver); err != nil { + return } *target.Not = *t } - for k := range target.Properties { - t, err := expandSchema(target.Properties[k], parentRefs, resolver) - if err != nil { - return &target, err + for k, _ := range target.Properties { + if t, err = expandSchema(target.Properties[k], parentRefs, resolver); err != nil { + return } target.Properties[k] = *t } if target.AdditionalProperties != nil && target.AdditionalProperties.Schema != nil { - t, err := expandSchema(*target.AdditionalProperties.Schema, parentRefs, resolver) - if err != nil { - return &target, err + if t, err = expandSchema(*target.AdditionalProperties.Schema, parentRefs, resolver); err != nil { + return } *target.AdditionalProperties.Schema = *t } - for k := range target.PatternProperties { - t, err := expandSchema(target.PatternProperties[k], parentRefs, resolver) - if err != nil { - return &target, err + for k, _ := range target.PatternProperties { + if t, err = expandSchema(target.PatternProperties[k], parentRefs, resolver); err != nil { + return } target.PatternProperties[k] = *t } - for k := range target.Dependencies { + for k, _ := range target.Dependencies { if target.Dependencies[k].Schema != nil { - t, err := expandSchema(*target.Dependencies[k].Schema, parentRefs, resolver) - if err != nil { - return &target, err + if t, err = expandSchema(*target.Dependencies[k].Schema, parentRefs, resolver); err != nil { + return } *target.Dependencies[k].Schema = *t } } if target.AdditionalItems != nil && target.AdditionalItems.Schema != nil { - t, err := expandSchema(*target.AdditionalItems.Schema, parentRefs, resolver) - if err != nil { - return &target, err + if t, err = expandSchema(*target.AdditionalItems.Schema, parentRefs, resolver); err != nil { + return } *target.AdditionalItems.Schema = *t } - for k := range target.Definitions { - t, err := expandSchema(target.Definitions[k], parentRefs, resolver) - if err != nil { - return &target, err + for k, _ := range target.Definitions { + if t, err = expandSchema(target.Definitions[k], parentRefs, resolver); err != nil { + return } target.Definitions[k] = *t } - return &target, nil + return } func expandPathItem(pathItem *PathItem, resolver *schemaLoader) error { @@ -778,25 +582,22 @@ func expandResponse(response *Response, resolver *schemaLoader) error { return nil } - var parentRefs []string if response.Ref.String() != "" { - parentRefs = append(parentRefs, response.Ref.String()) if err := resolver.Resolve(&response.Ref, response); err != nil { return err } } - if !resolver.options.SkipSchemas && response.Schema != nil { - parentRefs = append(parentRefs, response.Schema.Ref.String()) - debugLog("response ref: %s", response.Schema.Ref) + if response.Schema != nil { + parentRefs := []string{response.Schema.Ref.String()} if err := resolver.Resolve(&response.Schema.Ref, &response.Schema); err != nil { return err } - s, err := expandSchema(*response.Schema, parentRefs, resolver) - if err != nil { + if s, err := expandSchema(*response.Schema, parentRefs, resolver); err != nil { return err + } else { + *response.Schema = *s } - *response.Schema = *s } return nil } @@ -805,24 +606,21 @@ func expandParameter(parameter *Parameter, resolver *schemaLoader) error { if parameter == nil { return nil } - - var parentRefs []string if parameter.Ref.String() != "" { - parentRefs = append(parentRefs, parameter.Ref.String()) if err := resolver.Resolve(¶meter.Ref, parameter); err != nil { return err } } - if !resolver.options.SkipSchemas && parameter.Schema != nil { - parentRefs = append(parentRefs, parameter.Schema.Ref.String()) + if parameter.Schema != nil { + parentRefs := []string{parameter.Schema.Ref.String()} if err := resolver.Resolve(¶meter.Schema.Ref, ¶meter.Schema); err != nil { return err } - s, err := expandSchema(*parameter.Schema, parentRefs, resolver) - if err != nil { + if s, err := expandSchema(*parameter.Schema, parentRefs, resolver); err != nil { return err + } else { + *parameter.Schema = *s } - *parameter.Schema = *s } return nil } diff --git a/vendor/github.com/go-openapi/spec/header.go b/vendor/github.com/go-openapi/spec/header.go index 85c4d454c..758b84531 100644 --- a/vendor/github.com/go-openapi/spec/header.go +++ b/vendor/github.com/go-openapi/spec/header.go @@ -16,9 +16,7 @@ package spec import ( "encoding/json" - "strings" - "github.com/go-openapi/jsonpointer" "github.com/go-openapi/swag" ) @@ -32,7 +30,6 @@ type HeaderProps struct { type Header struct { CommonValidations SimpleSchema - VendorExtensible HeaderProps } @@ -161,35 +158,8 @@ func (h *Header) UnmarshalJSON(data []byte) error { if err := json.Unmarshal(data, &h.SimpleSchema); err != nil { return err } - if err := json.Unmarshal(data, &h.VendorExtensible); err != nil { - return err - } if err := json.Unmarshal(data, &h.HeaderProps); err != nil { return err } return nil } - -// JSONLookup look up a value by the json property name -func (p Header) JSONLookup(token string) (interface{}, error) { - if ex, ok := p.Extensions[token]; ok { - return &ex, nil - } - - r, _, err := jsonpointer.GetForToken(p.CommonValidations, token) - if err != nil && !strings.HasPrefix(err.Error(), "object has no field") { - return nil, err - } - if r != nil { - return r, nil - } - r, _, err = jsonpointer.GetForToken(p.SimpleSchema, token) - if err != nil && !strings.HasPrefix(err.Error(), "object has no field") { - return nil, err - } - if r != nil { - return r, nil - } - r, _, err = jsonpointer.GetForToken(p.HeaderProps, token) - return r, err -} diff --git a/vendor/github.com/go-openapi/spec/items.go b/vendor/github.com/go-openapi/spec/items.go index 9b726eb2d..4d57ea5ca 100644 --- a/vendor/github.com/go-openapi/spec/items.go +++ b/vendor/github.com/go-openapi/spec/items.go @@ -16,9 +16,7 @@ package spec import ( "encoding/json" - "strings" - "github.com/go-openapi/jsonpointer" "github.com/go-openapi/swag" ) @@ -199,20 +197,3 @@ func (i Items) MarshalJSON() ([]byte, error) { } return swag.ConcatJSON(b3, b1, b2), nil } - -// JSONLookup look up a value by the json property name -func (p Items) JSONLookup(token string) (interface{}, error) { - if token == "$ref" { - return &p.Ref, nil - } - - r, _, err := jsonpointer.GetForToken(p.CommonValidations, token) - if err != nil && !strings.HasPrefix(err.Error(), "object has no field") { - return nil, err - } - if r != nil { - return r, nil - } - r, _, err = jsonpointer.GetForToken(p.SimpleSchema, token) - return r, err -} diff --git a/vendor/github.com/go-openapi/spec/parameter.go b/vendor/github.com/go-openapi/spec/parameter.go index 71aee1e80..8fb66d12a 100644 --- a/vendor/github.com/go-openapi/spec/parameter.go +++ b/vendor/github.com/go-openapi/spec/parameter.go @@ -16,7 +16,6 @@ package spec import ( "encoding/json" - "strings" "github.com/go-openapi/jsonpointer" "github.com/go-openapi/swag" @@ -101,16 +100,15 @@ func (p Parameter) JSONLookup(token string) (interface{}, error) { if token == "$ref" { return &p.Ref, nil } - r, _, err := jsonpointer.GetForToken(p.CommonValidations, token) - if err != nil && !strings.HasPrefix(err.Error(), "object has no field") { + if err != nil { return nil, err } if r != nil { return r, nil } r, _, err = jsonpointer.GetForToken(p.SimpleSchema, token) - if err != nil && !strings.HasPrefix(err.Error(), "object has no field") { + if err != nil { return nil, err } if r != nil { diff --git a/vendor/github.com/go-openapi/spec/ref.go b/vendor/github.com/go-openapi/spec/ref.go index f6bfbfb56..68631df8b 100644 --- a/vendor/github.com/go-openapi/spec/ref.go +++ b/vendor/github.com/go-openapi/spec/ref.go @@ -55,7 +55,7 @@ func (r *Ref) RemoteURI() string { } // IsValidURI returns true when the url the ref points to can be found -func (r *Ref) IsValidURI(basepaths ...string) bool { +func (r *Ref) IsValidURI() bool { if r.String() == "" { return true } @@ -81,18 +81,14 @@ func (r *Ref) IsValidURI(basepaths ...string) bool { // check for local file pth := v if r.HasURLPathOnly { - base := "." - if len(basepaths) > 0 { - base = filepath.Dir(filepath.Join(basepaths...)) - } - p, e := filepath.Abs(filepath.ToSlash(filepath.Join(base, pth))) + p, e := filepath.Abs(pth) if e != nil { return false } pth = p } - fi, err := os.Stat(filepath.ToSlash(pth)) + fi, err := os.Stat(pth) if err != nil { return false } diff --git a/vendor/github.com/go-openapi/spec/response.go b/vendor/github.com/go-openapi/spec/response.go index 178db0365..308cc8478 100644 --- a/vendor/github.com/go-openapi/spec/response.go +++ b/vendor/github.com/go-openapi/spec/response.go @@ -17,7 +17,6 @@ package spec import ( "encoding/json" - "github.com/go-openapi/jsonpointer" "github.com/go-openapi/swag" ) @@ -37,15 +36,6 @@ type Response struct { ResponseProps } -// JSONLookup look up a value by the json property name -func (p Response) JSONLookup(token string) (interface{}, error) { - if token == "$ref" { - return &p.Ref, nil - } - r, _, err := jsonpointer.GetForToken(p.ResponseProps, token) - return r, err -} - // UnmarshalJSON hydrates this items instance with the data from JSON func (r *Response) UnmarshalJSON(data []byte) error { if err := json.Unmarshal(data, &r.ResponseProps); err != nil { diff --git a/vendor/github.com/go-openapi/spec/responses.go b/vendor/github.com/go-openapi/spec/responses.go index 3ab06697f..ea071ca63 100644 --- a/vendor/github.com/go-openapi/spec/responses.go +++ b/vendor/github.com/go-openapi/spec/responses.go @@ -51,7 +51,7 @@ func (r Responses) JSONLookup(token string) (interface{}, error) { } if i, err := strconv.Atoi(token); err == nil { if scr, ok := r.StatusCodeResponses[i]; ok { - return scr, nil + return &scr, nil } } return nil, fmt.Errorf("object has no field %q", token) diff --git a/vendor/github.com/go-openapi/spec/schema.go b/vendor/github.com/go-openapi/spec/schema.go index 04aafcc74..eb88f005c 100644 --- a/vendor/github.com/go-openapi/spec/schema.go +++ b/vendor/github.com/go-openapi/spec/schema.go @@ -269,7 +269,7 @@ func (s Schema) JSONLookup(token string) (interface{}, error) { } r, _, err := jsonpointer.GetForToken(s.SchemaProps, token) - if r != nil || (err != nil && !strings.HasPrefix(err.Error(), "object has no field")) { + if r != nil || err != nil { return r, err } r, _, err = jsonpointer.GetForToken(s.SwaggerSchemaProps, token) diff --git a/vendor/github.com/go-openapi/spec/spec.go b/vendor/github.com/go-openapi/spec/spec.go index 0bb045bc0..cc2ae56b2 100644 --- a/vendor/github.com/go-openapi/spec/spec.go +++ b/vendor/github.com/go-openapi/spec/spec.go @@ -16,8 +16,6 @@ package spec import "encoding/json" -//go:generate curl -L --progress -o ./schemas/v2/schema.json http://swagger.io/v2/schema.json -//go:generate curl -L --progress -o ./schemas/jsonschema-draft-04.json http://json-schema.org/draft-04/schema //go:generate go-bindata -pkg=spec -prefix=./schemas -ignore=.*\.md ./schemas/... //go:generate perl -pi -e s,Json,JSON,g bindata.go @@ -29,14 +27,9 @@ const ( ) var ( - jsonSchema *Schema - swaggerSchema *Schema -) - -func init() { - jsonSchema = MustLoadJSONSchemaDraft04() + jsonSchema = MustLoadJSONSchemaDraft04() swaggerSchema = MustLoadSwagger20Schema() -} +) // MustLoadJSONSchemaDraft04 panics when Swagger20Schema returns an error func MustLoadJSONSchemaDraft04() *Schema { diff --git a/vendor/github.com/go-openapi/swag/convert.go b/vendor/github.com/go-openapi/swag/convert.go index 2bf5ecbba..28d912410 100644 --- a/vendor/github.com/go-openapi/swag/convert.go +++ b/vendor/github.com/go-openapi/swag/convert.go @@ -159,7 +159,7 @@ func FormatInt16(value int16) string { // FormatInt32 turns an int32 into a string func FormatInt32(value int32) string { - return strconv.Itoa(int(value)) + return strconv.FormatInt(int64(value), 10) } // FormatInt64 turns an int64 into a string diff --git a/vendor/github.com/go-openapi/swag/json.go b/vendor/github.com/go-openapi/swag/json.go index 0eb374467..6e9ec20fc 100644 --- a/vendor/github.com/go-openapi/swag/json.go +++ b/vendor/github.com/go-openapi/swag/json.go @@ -17,7 +17,6 @@ package swag import ( "bytes" "encoding/json" - "log" "reflect" "strings" "sync" @@ -111,40 +110,28 @@ func ConcatJSON(blobs ...[]byte) []byte { if len(b) < 3 { // yep empty but also the last one, so closing this thing if i == last && a > 0 { - if err := buf.WriteByte(closing); err != nil { - log.Println(err) - } + buf.WriteByte(closing) } continue } idx = 0 if a > 0 { // we need to join with a comma for everything beyond the first non-empty item - if err := buf.WriteByte(comma); err != nil { - log.Println(err) - } + buf.WriteByte(comma) idx = 1 // this is not the first or the last so we want to drop the leading bracket } if i != last { // not the last one, strip brackets - if _, err := buf.Write(b[idx : len(b)-1]); err != nil { - log.Println(err) - } + buf.Write(b[idx : len(b)-1]) } else { // last one, strip only the leading bracket - if _, err := buf.Write(b[idx:]); err != nil { - log.Println(err) - } + buf.Write(b[idx:]) } a++ } // somehow it ended up being empty, so provide a default value if buf.Len() == 0 { - if err := buf.WriteByte(opening); err != nil { - log.Println(err) - } - if err := buf.WriteByte(closing); err != nil { - log.Println(err) - } + buf.WriteByte(opening) + buf.WriteByte(closing) } return buf.Bytes() } @@ -152,23 +139,15 @@ func ConcatJSON(blobs ...[]byte) []byte { // ToDynamicJSON turns an object into a properly JSON typed structure func ToDynamicJSON(data interface{}) interface{} { // TODO: convert straight to a json typed map (mergo + iterate?) - b, err := json.Marshal(data) - if err != nil { - log.Println(err) - } + b, _ := json.Marshal(data) var res interface{} - if err := json.Unmarshal(b, &res); err != nil { - log.Println(err) - } + json.Unmarshal(b, &res) return res } // FromDynamicJSON turns an object into a properly JSON typed structure func FromDynamicJSON(data, target interface{}) error { - b, err := json.Marshal(data) - if err != nil { - log.Println(err) - } + b, _ := json.Marshal(data) return json.Unmarshal(b, target) } diff --git a/vendor/github.com/go-openapi/swag/loading.go b/vendor/github.com/go-openapi/swag/loading.go index 62ed1e80a..6dbc31330 100644 --- a/vendor/github.com/go-openapi/swag/loading.go +++ b/vendor/github.com/go-openapi/swag/loading.go @@ -17,25 +17,13 @@ package swag import ( "fmt" "io/ioutil" - "log" "net/http" - "path/filepath" "strings" - "time" ) -// LoadHTTPTimeout the default timeout for load requests -var LoadHTTPTimeout = 30 * time.Second - // LoadFromFileOrHTTP loads the bytes from a file or a remote http server based on the path passed in func LoadFromFileOrHTTP(path string) ([]byte, error) { - return LoadStrategy(path, ioutil.ReadFile, loadHTTPBytes(LoadHTTPTimeout))(path) -} - -// LoadFromFileOrHTTPWithTimeout loads the bytes from a file or a remote http server based on the path passed in -// timeout arg allows for per request overriding of the request timeout -func LoadFromFileOrHTTPWithTimeout(path string, timeout time.Duration) ([]byte, error) { - return LoadStrategy(path, ioutil.ReadFile, loadHTTPBytes(timeout))(path) + return LoadStrategy(path, ioutil.ReadFile, loadHTTPBytes)(path) } // LoadStrategy returns a loader function for a given path or uri @@ -43,32 +31,19 @@ func LoadStrategy(path string, local, remote func(string) ([]byte, error)) func( if strings.HasPrefix(path, "http") { return remote } - return func(pth string) ([]byte, error) { return local(filepath.FromSlash(pth)) } + return local } -func loadHTTPBytes(timeout time.Duration) func(path string) ([]byte, error) { - return func(path string) ([]byte, error) { - client := &http.Client{Timeout: timeout} - req, err := http.NewRequest("GET", path, nil) - if err != nil { - return nil, err - } - resp, err := client.Do(req) - defer func() { - if resp != nil { - if e := resp.Body.Close(); e != nil { - log.Println(e) - } - } - }() - if err != nil { - return nil, err - } - - if resp.StatusCode != http.StatusOK { - return nil, fmt.Errorf("could not access document at %q [%s] ", path, resp.Status) - } - - return ioutil.ReadAll(resp.Body) +func loadHTTPBytes(path string) ([]byte, error) { + resp, err := http.Get(path) + if err != nil { + return nil, err } + defer resp.Body.Close() + + if resp.StatusCode != http.StatusOK { + return nil, fmt.Errorf("could not access document at %q [%s] ", path, resp.Status) + } + + return ioutil.ReadAll(resp.Body) } diff --git a/vendor/github.com/go-openapi/swag/util.go b/vendor/github.com/go-openapi/swag/util.go index d73b06743..d8b54ee61 100644 --- a/vendor/github.com/go-openapi/swag/util.go +++ b/vendor/github.com/go-openapi/swag/util.go @@ -22,9 +22,8 @@ import ( "strings" ) -// Taken from https://github.com/golang/lint/blob/3390df4df2787994aea98de825b964ac7944b817/lint.go#L732-L769 +// Taken from https://github.com/golang/lint/blob/1fab560e16097e5b69afb66eb93aab843ef77845/lint.go#L663-L698 var commonInitialisms = map[string]bool{ - "ACL": true, "API": true, "ASCII": true, "CPU": true, @@ -45,21 +44,19 @@ var commonInitialisms = map[string]bool{ "RPC": true, "SLA": true, "SMTP": true, - "SQL": true, "SSH": true, "TCP": true, "TLS": true, "TTL": true, "UDP": true, - "UI": true, - "UID": true, "UUID": true, + "UID": true, + "UI": true, "URI": true, "URL": true, "UTF8": true, "VM": true, "XML": true, - "XMPP": true, "XSRF": true, "XSS": true, } @@ -249,9 +246,6 @@ func ToJSONName(name string) string { // ToVarName camelcases a name which can be underscored or pascal cased func ToVarName(name string) string { res := ToGoName(name) - if _, ok := commonInitialisms[res]; ok { - return lower(res) - } if len(res) <= 1 { return lower(res) } diff --git a/vendor/github.com/google/gofuzz/fuzz.go b/vendor/github.com/google/gofuzz/fuzz.go index 4f888fbc8..42d9a48b3 100644 --- a/vendor/github.com/google/gofuzz/fuzz.go +++ b/vendor/github.com/google/gofuzz/fuzz.go @@ -129,7 +129,7 @@ func (f *Fuzzer) genElementCount() int { if f.minElements == f.maxElements { return f.minElements } - return f.minElements + f.r.Intn(f.maxElements-f.minElements+1) + return f.minElements + f.r.Intn(f.maxElements-f.minElements) } func (f *Fuzzer) genShouldFill() bool { @@ -229,19 +229,12 @@ func (f *Fuzzer) doFuzz(v reflect.Value, flags uint64) { return } v.Set(reflect.Zero(v.Type())) - case reflect.Array: - if f.genShouldFill() { - n := v.Len() - for i := 0; i < n; i++ { - f.doFuzz(v.Index(i), 0) - } - return - } - v.Set(reflect.Zero(v.Type())) case reflect.Struct: for i := 0; i < v.NumField(); i++ { f.doFuzz(v.Field(i), 0) } + case reflect.Array: + fallthrough case reflect.Chan: fallthrough case reflect.Func: diff --git a/vendor/github.com/mailru/easyjson/jlexer/lexer.go b/vendor/github.com/mailru/easyjson/jlexer/lexer.go index eac6cf5d2..d700c0a32 100644 --- a/vendor/github.com/mailru/easyjson/jlexer/lexer.go +++ b/vendor/github.com/mailru/easyjson/jlexer/lexer.go @@ -5,7 +5,6 @@ package jlexer import ( - "encoding/base64" "fmt" "io" "reflect" @@ -506,7 +505,7 @@ func (r *Lexer) SkipRecursive() { return } case c == '\\' && inQuotes: - wasEscape = !wasEscape + wasEscape = true continue case c == '"' && inQuotes: inQuotes = wasEscape @@ -516,11 +515,7 @@ func (r *Lexer) SkipRecursive() { wasEscape = false } r.pos = len(r.Data) - r.err = &LexerError{ - Reason: "EOF reached while skipping array/object or token", - Offset: r.pos, - Data: string(r.Data[r.pos:]), - } + r.err = io.EOF } // Raw fetches the next item recursively as a data slice @@ -532,34 +527,6 @@ func (r *Lexer) Raw() []byte { return r.Data[r.start:r.pos] } -// IsStart returns whether the lexer is positioned at the start -// of an input string. -func (r *Lexer) IsStart() bool { - return r.pos == 0 -} - -// Consumed reads all remaining bytes from the input, publishing an error if -// there is anything but whitespace remaining. -func (r *Lexer) Consumed() { - if r.pos > len(r.Data) { - return - } - - for _, c := range r.Data[r.pos:] { - if c != ' ' && c != '\t' && c != '\r' && c != '\n' { - r.err = &LexerError{ - Reason: "invalid character '" + string(c) + "' after top-level value", - Offset: r.pos, - Data: string(r.Data[r.pos:]), - } - return - } - - r.pos++ - r.start++ - } -} - // UnsafeString returns the string value if the token is a string literal. // // Warning: returned string may point to the input buffer, so the string should not outlive @@ -593,28 +560,6 @@ func (r *Lexer) String() string { return ret } -// Bytes reads a string literal and base64 decodes it into a byte slice. -func (r *Lexer) Bytes() []byte { - if r.token.kind == tokenUndef && r.Ok() { - r.fetchToken() - } - if !r.Ok() || r.token.kind != tokenString { - r.errInvalidToken("string") - return nil - } - ret := make([]byte, base64.StdEncoding.DecodedLen(len(r.token.byteValue))) - len, err := base64.StdEncoding.Decode(ret, r.token.byteValue) - if err != nil { - r.err = &LexerError{ - Reason: err.Error(), - } - return nil - } - - r.consume() - return ret[:len] -} - // Bool reads a true or false boolean keyword. func (r *Lexer) Bool() bool { if r.token.kind == tokenUndef && r.Ok() { diff --git a/vendor/github.com/mailru/easyjson/jwriter/writer.go b/vendor/github.com/mailru/easyjson/jwriter/writer.go index a3ef534d6..907675f9c 100644 --- a/vendor/github.com/mailru/easyjson/jwriter/writer.go +++ b/vendor/github.com/mailru/easyjson/jwriter/writer.go @@ -2,7 +2,6 @@ package jwriter import ( - "encoding/base64" "io" "strconv" "unicode/utf8" @@ -10,19 +9,8 @@ import ( "github.com/mailru/easyjson/buffer" ) -// Flags describe various encoding options. The behavior may be actually implemented in the encoder, but -// Flags field in Writer is used to set and pass them around. -type Flags int - -const ( - NilMapAsEmpty Flags = 1 << iota // Encode nil map as '{}' rather than 'null'. - NilSliceAsEmpty // Encode nil slice as '[]' rather than 'null'. -) - // Writer is a JSON writer. type Writer struct { - Flags Flags - Error error Buffer buffer.Buffer } @@ -71,19 +59,6 @@ func (w *Writer) Raw(data []byte, err error) { } } -// Base64Bytes appends data to the buffer after base64 encoding it -func (w *Writer) Base64Bytes(data []byte) { - if data == nil { - w.Buffer.AppendString("null") - return - } - w.Buffer.AppendByte('"') - dst := make([]byte, base64.StdEncoding.EncodedLen(len(data))) - base64.StdEncoding.Encode(dst, data) - w.Buffer.AppendBytes(dst) - w.Buffer.AppendByte('"') -} - func (w *Writer) Uint8(n uint8) { w.Buffer.EnsureSpace(3) w.Buffer.Buf = strconv.AppendUint(w.Buffer.Buf, uint64(n), 10) @@ -225,12 +200,6 @@ func (w *Writer) Bool(v bool) { const chars = "0123456789abcdef" -func isNotEscapedSingleChar(c byte) bool { - // Note: might make sense to use a table if there are more chars to escape. With 4 chars - // it benchmarks the same. - return c != '<' && c != '\\' && c != '"' && c != '>' && c >= 0x20 && c < utf8.RuneSelf -} - func (w *Writer) String(s string) { w.Buffer.AppendByte('"') @@ -240,32 +209,39 @@ func (w *Writer) String(s string) { p := 0 // last non-escape symbol for i := 0; i < len(s); { - c := s[i] - - if isNotEscapedSingleChar(c) { - // single-width character, no escaping is required - i++ - continue - } else if c < utf8.RuneSelf { - // single-with character, need to escape - w.Buffer.AppendString(s[p:i]) + // single-with character + if c := s[i]; c < utf8.RuneSelf { + var escape byte switch c { case '\t': - w.Buffer.AppendString(`\t`) + escape = 't' case '\r': - w.Buffer.AppendString(`\r`) + escape = 'r' case '\n': - w.Buffer.AppendString(`\n`) + escape = 'n' case '\\': - w.Buffer.AppendString(`\\`) + escape = '\\' case '"': - w.Buffer.AppendString(`\"`) + escape = '"' + case '<', '>': + // do nothing default: + if c >= 0x20 { + // no escaping is required + i++ + continue + } + } + if escape != 0 { + w.Buffer.AppendString(s[p:i]) + w.Buffer.AppendByte('\\') + w.Buffer.AppendByte(escape) + } else { + w.Buffer.AppendString(s[p:i]) w.Buffer.AppendString(`\u00`) w.Buffer.AppendByte(chars[c>>4]) w.Buffer.AppendByte(chars[c&0xf]) } - i++ p = i continue diff --git a/vendor/github.com/pborman/uuid/dce.go b/vendor/github.com/pborman/uuid/dce.go old mode 100644 new mode 100755 diff --git a/vendor/github.com/pborman/uuid/doc.go b/vendor/github.com/pborman/uuid/doc.go old mode 100644 new mode 100755 diff --git a/vendor/github.com/pborman/uuid/hash.go b/vendor/github.com/pborman/uuid/hash.go index a0420c1ef..cdd4192fd 100644 --- a/vendor/github.com/pborman/uuid/hash.go +++ b/vendor/github.com/pborman/uuid/hash.go @@ -19,7 +19,7 @@ var ( NIL = Parse("00000000-0000-0000-0000-000000000000") ) -// NewHash returns a new UUID derived from the hash of space concatenated with +// NewHash returns a new UUID dervied from the hash of space concatenated with // data generated by h. The hash should be at least 16 byte in length. The // first 16 bytes of the hash are used to form the UUID. The version of the // UUID will be the lower 4 bits of version. NewHash is used to implement diff --git a/vendor/github.com/pborman/uuid/json.go b/vendor/github.com/pborman/uuid/json.go index 9dda1dfba..760580a50 100644 --- a/vendor/github.com/pborman/uuid/json.go +++ b/vendor/github.com/pborman/uuid/json.go @@ -7,21 +7,17 @@ package uuid import "errors" func (u UUID) MarshalJSON() ([]byte, error) { - if len(u) != 16 { + if len(u) == 0 { return []byte(`""`), nil } - var js [38]byte - js[0] = '"' - encodeHex(js[1:], u) - js[37] = '"' - return js[:], nil + return []byte(`"` + u.String() + `"`), nil } func (u *UUID) UnmarshalJSON(data []byte) error { - if string(data) == `""` { + if len(data) == 0 || string(data) == `""` { return nil } - if data[0] != '"' { + if len(data) < 2 || data[0] != '"' || data[len(data)-1] != '"' { return errors.New("invalid UUID format") } data = data[1 : len(data)-1] diff --git a/vendor/github.com/pborman/uuid/node.go b/vendor/github.com/pborman/uuid/node.go old mode 100644 new mode 100755 index 42d60da8f..dd0a8ac18 --- a/vendor/github.com/pborman/uuid/node.go +++ b/vendor/github.com/pborman/uuid/node.go @@ -4,13 +4,9 @@ package uuid -import ( - "net" - "sync" -) +import "net" var ( - nodeMu sync.Mutex interfaces []net.Interface // cached list of interfaces ifname string // name of interface being used nodeID []byte // hardware for version 1 UUIDs @@ -20,8 +16,6 @@ var ( // derived. The interface "user" is returned if the NodeID was set by // SetNodeID. func NodeInterface() string { - defer nodeMu.Unlock() - nodeMu.Lock() return ifname } @@ -32,12 +26,6 @@ func NodeInterface() string { // // SetNodeInterface never fails when name is "". func SetNodeInterface(name string) bool { - defer nodeMu.Unlock() - nodeMu.Lock() - return setNodeInterface(name) -} - -func setNodeInterface(name string) bool { if interfaces == nil { var err error interfaces, err = net.Interfaces() @@ -71,10 +59,8 @@ func setNodeInterface(name string) bool { // NodeID returns a slice of a copy of the current Node ID, setting the Node ID // if not already set. func NodeID() []byte { - defer nodeMu.Unlock() - nodeMu.Lock() if nodeID == nil { - setNodeInterface("") + SetNodeInterface("") } nid := make([]byte, 6) copy(nid, nodeID) @@ -85,8 +71,6 @@ func NodeID() []byte { // of id are used. If id is less than 6 bytes then false is returned and the // Node ID is not set. func SetNodeID(id []byte) bool { - defer nodeMu.Unlock() - nodeMu.Lock() if setNodeID(id) { ifname = "user" return true diff --git a/vendor/github.com/pborman/uuid/sql.go b/vendor/github.com/pborman/uuid/sql.go deleted file mode 100644 index d015bfd13..000000000 --- a/vendor/github.com/pborman/uuid/sql.go +++ /dev/null @@ -1,66 +0,0 @@ -// Copyright 2015 Google Inc. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package uuid - -import ( - "database/sql/driver" - "errors" - "fmt" -) - -// Scan implements sql.Scanner so UUIDs can be read from databases transparently -// Currently, database types that map to string and []byte are supported. Please -// consult database-specific driver documentation for matching types. -func (uuid *UUID) Scan(src interface{}) error { - switch src.(type) { - case string: - // if an empty UUID comes from a table, we return a null UUID - if src.(string) == "" { - return nil - } - - // see uuid.Parse for required string format - parsed := Parse(src.(string)) - - if parsed == nil { - return errors.New("Scan: invalid UUID format") - } - - *uuid = parsed - case []byte: - b := src.([]byte) - - // if an empty UUID comes from a table, we return a null UUID - if len(b) == 0 { - return nil - } - - // assumes a simple slice of bytes if 16 bytes - // otherwise attempts to parse - if len(b) == 16 { - *uuid = UUID(b) - } else { - u := Parse(string(b)) - - if u == nil { - return errors.New("Scan: invalid UUID format") - } - - *uuid = u - } - - default: - return fmt.Errorf("Scan: unable to scan type %T into UUID", src) - } - - return nil -} - -// Value implements sql.Valuer so that UUIDs can be written to databases -// transparently. Currently, UUIDs map to strings. Please consult -// database-specific driver documentation for matching types. -func (uuid UUID) Value() (driver.Value, error) { - return uuid.String(), nil -} diff --git a/vendor/github.com/pborman/uuid/time.go b/vendor/github.com/pborman/uuid/time.go old mode 100644 new mode 100755 index eedf24219..7ebc9bef1 --- a/vendor/github.com/pborman/uuid/time.go +++ b/vendor/github.com/pborman/uuid/time.go @@ -23,7 +23,7 @@ const ( ) var ( - timeMu sync.Mutex + mu sync.Mutex lasttime uint64 // last time we returned clock_seq uint16 // clock sequence for this run @@ -43,8 +43,8 @@ func (t Time) UnixTime() (sec, nsec int64) { // clock sequence as well as adjusting the clock sequence as needed. An error // is returned if the current time cannot be determined. func GetTime() (Time, uint16, error) { - defer timeMu.Unlock() - timeMu.Lock() + defer mu.Unlock() + mu.Lock() return getTime() } @@ -75,8 +75,8 @@ func getTime() (Time, uint16, error) { // ClockSequence, GetTime, or NewUUID. (section 4.2.1.1) sequence is generated // for func ClockSequence() int { - defer timeMu.Unlock() - timeMu.Lock() + defer mu.Unlock() + mu.Lock() return clockSequence() } @@ -90,8 +90,8 @@ func clockSequence() int { // SetClockSeq sets the clock sequence to the lower 14 bits of seq. Setting to // -1 causes a new sequence to be generated. func SetClockSequence(seq int) { - defer timeMu.Unlock() - timeMu.Lock() + defer mu.Unlock() + mu.Lock() setClockSequence(seq) } diff --git a/vendor/github.com/pborman/uuid/util.go b/vendor/github.com/pborman/uuid/util.go index fc8e052c7..de40b102c 100644 --- a/vendor/github.com/pborman/uuid/util.go +++ b/vendor/github.com/pborman/uuid/util.go @@ -16,7 +16,7 @@ func randomBits(b []byte) { } // xvalues returns the value of a byte as a hexadecimal digit or 255. -var xvalues = [256]byte{ +var xvalues = []byte{ 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, 255, diff --git a/vendor/github.com/pborman/uuid/uuid.go b/vendor/github.com/pborman/uuid/uuid.go old mode 100644 new mode 100755 index 7c643cf0a..2920fae63 --- a/vendor/github.com/pborman/uuid/uuid.go +++ b/vendor/github.com/pborman/uuid/uuid.go @@ -7,26 +7,11 @@ package uuid import ( "bytes" "crypto/rand" - "encoding/hex" "fmt" "io" "strings" ) -// Array is a pass-by-value UUID that can be used as an effecient key in a map. -type Array [16]byte - -// UUID converts uuid into a slice. -func (uuid Array) UUID() UUID { - return uuid[:] -} - -// String returns the string representation of uuid, -// xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx. -func (uuid Array) String() string { - return uuid.UUID().String() -} - // A UUID is a 128 bit (16 byte) Universal Unique IDentifier as defined in RFC // 4122. type UUID []byte @@ -69,8 +54,8 @@ func Parse(s string) UUID { if s[8] != '-' || s[13] != '-' || s[18] != '-' || s[23] != '-' { return nil } - var uuid [16]byte - for i, x := range [16]int{ + uuid := make([]byte, 16) + for i, x := range []int{ 0, 2, 4, 6, 9, 11, 14, 16, @@ -82,7 +67,7 @@ func Parse(s string) UUID { uuid[i] = v } } - return uuid[:] + return uuid } // Equal returns true if uuid1 and uuid2 are equal. @@ -90,50 +75,26 @@ func Equal(uuid1, uuid2 UUID) bool { return bytes.Equal(uuid1, uuid2) } -// Array returns an array representation of uuid that can be used as a map key. -// Array panics if uuid is not valid. -func (uuid UUID) Array() Array { - if len(uuid) != 16 { - panic("invalid uuid") - } - var a Array - copy(a[:], uuid) - return a -} - // String returns the string form of uuid, xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx // , or "" if uuid is invalid. func (uuid UUID) String() string { - if len(uuid) != 16 { + if uuid == nil || len(uuid) != 16 { return "" } - var buf [36]byte - encodeHex(buf[:], uuid) - return string(buf[:]) + b := []byte(uuid) + return fmt.Sprintf("%08x-%04x-%04x-%04x-%012x", + b[:4], b[4:6], b[6:8], b[8:10], b[10:]) } // URN returns the RFC 2141 URN form of uuid, // urn:uuid:xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx, or "" if uuid is invalid. func (uuid UUID) URN() string { - if len(uuid) != 16 { + if uuid == nil || len(uuid) != 16 { return "" } - var buf [36 + 9]byte - copy(buf[:], "urn:uuid:") - encodeHex(buf[9:], uuid) - return string(buf[:]) -} - -func encodeHex(dst []byte, uuid UUID) { - hex.Encode(dst[:], uuid[:4]) - dst[8] = '-' - hex.Encode(dst[9:13], uuid[4:6]) - dst[13] = '-' - hex.Encode(dst[14:18], uuid[6:8]) - dst[18] = '-' - hex.Encode(dst[19:23], uuid[8:10]) - dst[23] = '-' - hex.Encode(dst[24:], uuid[10:]) + b := []byte(uuid) + return fmt.Sprintf("urn:uuid:%08x-%04x-%04x-%04x-%012x", + b[:4], b[4:6], b[6:8], b[8:10], b[10:]) } // Variant returns the variant encoded in uuid. It returns Invalid if @@ -152,9 +113,10 @@ func (uuid UUID) Variant() Variant { default: return Reserved } + panic("unreachable") } -// Version returns the version of uuid. It returns false if uuid is not +// Version returns the verison of uuid. It returns false if uuid is not // valid. func (uuid UUID) Version() (Version, bool) { if len(uuid) != 16 { @@ -186,7 +148,7 @@ func (v Variant) String() string { return fmt.Sprintf("BadVariant%d", int(v)) } -// SetRand sets the random number generator to r, which implements io.Reader. +// SetRand sets the random number generator to r, which implents io.Reader. // If r.Read returns an error when the package requests random data then // a panic will be issued. // diff --git a/vendor/golang.org/x/text/cases/cases.go b/vendor/golang.org/x/text/cases/cases.go new file mode 100644 index 000000000..02043726d --- /dev/null +++ b/vendor/golang.org/x/text/cases/cases.go @@ -0,0 +1,162 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_trieval.go + +// Package cases provides general and language-specific case mappers. +package cases // import "golang.org/x/text/cases" + +import ( + "golang.org/x/text/language" + "golang.org/x/text/transform" +) + +// References: +// - Unicode Reference Manual Chapter 3.13, 4.2, and 5.18. +// - http://www.unicode.org/reports/tr29/ +// - http://www.unicode.org/Public/6.3.0/ucd/CaseFolding.txt +// - http://www.unicode.org/Public/6.3.0/ucd/SpecialCasing.txt +// - http://www.unicode.org/Public/6.3.0/ucd/DerivedCoreProperties.txt +// - http://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakProperty.txt +// - http://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakTest.txt +// - http://userguide.icu-project.org/transforms/casemappings + +// TODO: +// - Case folding +// - Wide and Narrow? +// - Segmenter option for title casing. +// - ASCII fast paths +// - Encode Soft-Dotted property within trie somehow. + +// A Caser transforms given input to a certain case. It implements +// transform.Transformer. +// +// A Caser may be stateful and should therefore not be shared between +// goroutines. +type Caser struct { + t transform.SpanningTransformer +} + +// Bytes returns a new byte slice with the result of converting b to the case +// form implemented by c. +func (c Caser) Bytes(b []byte) []byte { + b, _, _ = transform.Bytes(c.t, b) + return b +} + +// String returns a string with the result of transforming s to the case form +// implemented by c. +func (c Caser) String(s string) string { + s, _, _ = transform.String(c.t, s) + return s +} + +// Reset resets the Caser to be reused for new input after a previous call to +// Transform. +func (c Caser) Reset() { c.t.Reset() } + +// Transform implements the transform.Transformer interface and transforms the +// given input to the case form implemented by c. +func (c Caser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + return c.t.Transform(dst, src, atEOF) +} + +// Span implements the transform.SpanningTransformer interface. +func (c Caser) Span(src []byte, atEOF bool) (n int, err error) { + return c.t.Span(src, atEOF) +} + +// Upper returns a Caser for language-specific uppercasing. +func Upper(t language.Tag, opts ...Option) Caser { + return Caser{makeUpper(t, getOpts(opts...))} +} + +// Lower returns a Caser for language-specific lowercasing. +func Lower(t language.Tag, opts ...Option) Caser { + return Caser{makeLower(t, getOpts(opts...))} +} + +// Title returns a Caser for language-specific title casing. It uses an +// approximation of the default Unicode Word Break algorithm. +func Title(t language.Tag, opts ...Option) Caser { + return Caser{makeTitle(t, getOpts(opts...))} +} + +// Fold returns a Caser that implements Unicode case folding. The returned Caser +// is stateless and safe to use concurrently by multiple goroutines. +// +// Case folding does not normalize the input and may not preserve a normal form. +// Use the collate or search package for more convenient and linguistically +// sound comparisons. Use unicode/precis for string comparisons where security +// aspects are a concern. +func Fold(opts ...Option) Caser { + return Caser{makeFold(getOpts(opts...))} +} + +// An Option is used to modify the behavior of a Caser. +type Option func(o options) options + +// TODO: consider these options to take a boolean as well, like FinalSigma. +// The advantage of using this approach is that other providers of a lower-case +// algorithm could set different defaults by prefixing a user-provided slice +// of options with their own. This is handy, for instance, for the precis +// package which would override the default to not handle the Greek final sigma. + +var ( + // NoLower disables the lowercasing of non-leading letters for a title + // caser. + NoLower Option = noLower + + // Compact omits mappings in case folding for characters that would grow the + // input. (Unimplemented.) + Compact Option = compact +) + +// TODO: option to preserve a normal form, if applicable? + +type options struct { + noLower bool + simple bool + + // TODO: segmenter, max ignorable, alternative versions, etc. + + ignoreFinalSigma bool +} + +func getOpts(o ...Option) (res options) { + for _, f := range o { + res = f(res) + } + return +} + +func noLower(o options) options { + o.noLower = true + return o +} + +func compact(o options) options { + o.simple = true + return o +} + +// HandleFinalSigma specifies whether the special handling of Greek final sigma +// should be enabled. Unicode prescribes handling the Greek final sigma for all +// locales, but standards like IDNA and PRECIS override this default. +func HandleFinalSigma(enable bool) Option { + if enable { + return handleFinalSigma + } + return ignoreFinalSigma +} + +func ignoreFinalSigma(o options) options { + o.ignoreFinalSigma = true + return o +} + +func handleFinalSigma(o options) options { + o.ignoreFinalSigma = false + return o +} diff --git a/vendor/golang.org/x/text/cases/context.go b/vendor/golang.org/x/text/cases/context.go new file mode 100644 index 000000000..e9aa9e193 --- /dev/null +++ b/vendor/golang.org/x/text/cases/context.go @@ -0,0 +1,376 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +import "golang.org/x/text/transform" + +// A context is used for iterating over source bytes, fetching case info and +// writing to a destination buffer. +// +// Casing operations may need more than one rune of context to decide how a rune +// should be cased. Casing implementations should call checkpoint on context +// whenever it is known to be safe to return the runes processed so far. +// +// It is recommended for implementations to not allow for more than 30 case +// ignorables as lookahead (analogous to the limit in norm) and to use state if +// unbounded lookahead is needed for cased runes. +type context struct { + dst, src []byte + atEOF bool + + pDst int // pDst points past the last written rune in dst. + pSrc int // pSrc points to the start of the currently scanned rune. + + // checkpoints safe to return in Transform, where nDst <= pDst and nSrc <= pSrc. + nDst, nSrc int + err error + + sz int // size of current rune + info info // case information of currently scanned rune + + // State preserved across calls to Transform. + isMidWord bool // false if next cased letter needs to be title-cased. +} + +func (c *context) Reset() { + c.isMidWord = false +} + +// ret returns the return values for the Transform method. It checks whether +// there were insufficient bytes in src to complete and introduces an error +// accordingly, if necessary. +func (c *context) ret() (nDst, nSrc int, err error) { + if c.err != nil || c.nSrc == len(c.src) { + return c.nDst, c.nSrc, c.err + } + // This point is only reached by mappers if there was no short destination + // buffer. This means that the source buffer was exhausted and that c.sz was + // set to 0 by next. + if c.atEOF && c.pSrc == len(c.src) { + return c.pDst, c.pSrc, nil + } + return c.nDst, c.nSrc, transform.ErrShortSrc +} + +// retSpan returns the return values for the Span method. It checks whether +// there were insufficient bytes in src to complete and introduces an error +// accordingly, if necessary. +func (c *context) retSpan() (n int, err error) { + _, nSrc, err := c.ret() + return nSrc, err +} + +// checkpoint sets the return value buffer points for Transform to the current +// positions. +func (c *context) checkpoint() { + if c.err == nil { + c.nDst, c.nSrc = c.pDst, c.pSrc+c.sz + } +} + +// unreadRune causes the last rune read by next to be reread on the next +// invocation of next. Only one unreadRune may be called after a call to next. +func (c *context) unreadRune() { + c.sz = 0 +} + +func (c *context) next() bool { + c.pSrc += c.sz + if c.pSrc == len(c.src) || c.err != nil { + c.info, c.sz = 0, 0 + return false + } + v, sz := trie.lookup(c.src[c.pSrc:]) + c.info, c.sz = info(v), sz + if c.sz == 0 { + if c.atEOF { + // A zero size means we have an incomplete rune. If we are atEOF, + // this means it is an illegal rune, which we will consume one + // byte at a time. + c.sz = 1 + } else { + c.err = transform.ErrShortSrc + return false + } + } + return true +} + +// writeBytes adds bytes to dst. +func (c *context) writeBytes(b []byte) bool { + if len(c.dst)-c.pDst < len(b) { + c.err = transform.ErrShortDst + return false + } + // This loop is faster than using copy. + for _, ch := range b { + c.dst[c.pDst] = ch + c.pDst++ + } + return true +} + +// writeString writes the given string to dst. +func (c *context) writeString(s string) bool { + if len(c.dst)-c.pDst < len(s) { + c.err = transform.ErrShortDst + return false + } + // This loop is faster than using copy. + for i := 0; i < len(s); i++ { + c.dst[c.pDst] = s[i] + c.pDst++ + } + return true +} + +// copy writes the current rune to dst. +func (c *context) copy() bool { + return c.writeBytes(c.src[c.pSrc : c.pSrc+c.sz]) +} + +// copyXOR copies the current rune to dst and modifies it by applying the XOR +// pattern of the case info. It is the responsibility of the caller to ensure +// that this is a rune with a XOR pattern defined. +func (c *context) copyXOR() bool { + if !c.copy() { + return false + } + if c.info&xorIndexBit == 0 { + // Fast path for 6-bit XOR pattern, which covers most cases. + c.dst[c.pDst-1] ^= byte(c.info >> xorShift) + } else { + // Interpret XOR bits as an index. + // TODO: test performance for unrolling this loop. Verify that we have + // at least two bytes and at most three. + idx := c.info >> xorShift + for p := c.pDst - 1; ; p-- { + c.dst[p] ^= xorData[idx] + idx-- + if xorData[idx] == 0 { + break + } + } + } + return true +} + +// hasPrefix returns true if src[pSrc:] starts with the given string. +func (c *context) hasPrefix(s string) bool { + b := c.src[c.pSrc:] + if len(b) < len(s) { + return false + } + for i, c := range b[:len(s)] { + if c != s[i] { + return false + } + } + return true +} + +// caseType returns an info with only the case bits, normalized to either +// cLower, cUpper, cTitle or cUncased. +func (c *context) caseType() info { + cm := c.info & 0x7 + if cm < 4 { + return cm + } + if cm >= cXORCase { + // xor the last bit of the rune with the case type bits. + b := c.src[c.pSrc+c.sz-1] + return info(b&1) ^ cm&0x3 + } + if cm == cIgnorableCased { + return cLower + } + return cUncased +} + +// lower writes the lowercase version of the current rune to dst. +func lower(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cLower { + return c.copy() + } + if c.info&exceptionBit == 0 { + return c.copyXOR() + } + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { + return c.writeString(e[offset : offset+nLower]) + } + return c.copy() +} + +func isLower(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cLower { + return true + } + if c.info&exceptionBit == 0 { + c.err = transform.ErrEndOfSpan + return false + } + e := exceptions[c.info>>exceptionShift:] + if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// upper writes the uppercase version of the current rune to dst. +func upper(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cUpper { + return c.copy() + } + if c.info&exceptionBit == 0 { + return c.copyXOR() + } + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + // Get length of first special case mapping. + n := (e[1] >> lengthBits) & lengthMask + if ct == cTitle { + // The first special case mapping is for lower. Set n to the second. + if n == noChange { + n = 0 + } + n, e = e[1]&lengthMask, e[n:] + } + if n != noChange { + return c.writeString(e[offset : offset+n]) + } + return c.copy() +} + +// isUpper writes the isUppercase version of the current rune to dst. +func isUpper(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cUpper { + return true + } + if c.info&exceptionBit == 0 { + c.err = transform.ErrEndOfSpan + return false + } + e := exceptions[c.info>>exceptionShift:] + // Get length of first special case mapping. + n := (e[1] >> lengthBits) & lengthMask + if ct == cTitle { + n = e[1] & lengthMask + } + if n != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// title writes the title case version of the current rune to dst. +func title(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cTitle { + return c.copy() + } + if c.info&exceptionBit == 0 { + if ct == cLower { + return c.copyXOR() + } + return c.copy() + } + // Get the exception data. + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + + nFirst := (e[1] >> lengthBits) & lengthMask + if nTitle := e[1] & lengthMask; nTitle != noChange { + if nFirst != noChange { + e = e[nFirst:] + } + return c.writeString(e[offset : offset+nTitle]) + } + if ct == cLower && nFirst != noChange { + // Use the uppercase version instead. + return c.writeString(e[offset : offset+nFirst]) + } + // Already in correct case. + return c.copy() +} + +// isTitle reports whether the current rune is in title case. +func isTitle(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cTitle { + return true + } + if c.info&exceptionBit == 0 { + if ct == cLower { + c.err = transform.ErrEndOfSpan + return false + } + return true + } + // Get the exception data. + e := exceptions[c.info>>exceptionShift:] + if nTitle := e[1] & lengthMask; nTitle != noChange { + c.err = transform.ErrEndOfSpan + return false + } + nFirst := (e[1] >> lengthBits) & lengthMask + if ct == cLower && nFirst != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// foldFull writes the foldFull version of the current rune to dst. +func foldFull(c *context) bool { + if c.info&hasMappingMask == 0 { + return c.copy() + } + ct := c.caseType() + if c.info&exceptionBit == 0 { + if ct != cLower || c.info&inverseFoldBit != 0 { + return c.copyXOR() + } + return c.copy() + } + e := exceptions[c.info>>exceptionShift:] + n := e[0] & lengthMask + if n == 0 { + if ct == cLower { + return c.copy() + } + n = (e[1] >> lengthBits) & lengthMask + } + return c.writeString(e[2 : 2+n]) +} + +// isFoldFull reports whether the current run is mapped to foldFull +func isFoldFull(c *context) bool { + if c.info&hasMappingMask == 0 { + return true + } + ct := c.caseType() + if c.info&exceptionBit == 0 { + if ct != cLower || c.info&inverseFoldBit != 0 { + c.err = transform.ErrEndOfSpan + return false + } + return true + } + e := exceptions[c.info>>exceptionShift:] + n := e[0] & lengthMask + if n == 0 && ct == cLower { + return true + } + c.err = transform.ErrEndOfSpan + return false +} diff --git a/vendor/golang.org/x/text/cases/fold.go b/vendor/golang.org/x/text/cases/fold.go new file mode 100644 index 000000000..85cc434fa --- /dev/null +++ b/vendor/golang.org/x/text/cases/fold.go @@ -0,0 +1,34 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +import "golang.org/x/text/transform" + +type caseFolder struct{ transform.NopResetter } + +// caseFolder implements the Transformer interface for doing case folding. +func (t *caseFolder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() { + foldFull(&c) + c.checkpoint() + } + return c.ret() +} + +func (t *caseFolder) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isFoldFull(&c) { + c.checkpoint() + } + return c.retSpan() +} + +func makeFold(o options) transform.SpanningTransformer { + // TODO: Special case folding, through option Language, Special/Turkic, or + // both. + // TODO: Implement Compact options. + return &caseFolder{} +} diff --git a/vendor/golang.org/x/text/cases/gen.go b/vendor/golang.org/x/text/cases/gen.go new file mode 100644 index 000000000..eb399baa7 --- /dev/null +++ b/vendor/golang.org/x/text/cases/gen.go @@ -0,0 +1,839 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +// This program generates the trie for casing operations. The Unicode casing +// algorithm requires the lookup of various properties and mappings for each +// rune. The table generated by this generator combines several of the most +// frequently used of these into a single trie so that they can be accessed +// with a single lookup. +package main + +import ( + "bytes" + "fmt" + "io" + "io/ioutil" + "log" + "reflect" + "strconv" + "strings" + "unicode" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/internal/triegen" + "golang.org/x/text/internal/ucd" + "golang.org/x/text/unicode/norm" +) + +func main() { + gen.Init() + genTables() + genTablesTest() + gen.Repackage("gen_trieval.go", "trieval.go", "cases") +} + +// runeInfo contains all information for a rune that we care about for casing +// operations. +type runeInfo struct { + Rune rune + + entry info // trie value for this rune. + + CaseMode info + + // Simple case mappings. + Simple [1 + maxCaseMode][]rune + + // Special casing + HasSpecial bool + Conditional bool + Special [1 + maxCaseMode][]rune + + // Folding + FoldSimple rune + FoldSpecial rune + FoldFull []rune + + // TODO: FC_NFKC, or equivalent data. + + // Properties + SoftDotted bool + CaseIgnorable bool + Cased bool + DecomposeGreek bool + BreakType string + BreakCat breakCategory + + // We care mostly about 0, Above, and IotaSubscript. + CCC byte +} + +type breakCategory int + +const ( + breakBreak breakCategory = iota + breakLetter + breakMid +) + +// mapping returns the case mapping for the given case type. +func (r *runeInfo) mapping(c info) string { + if r.HasSpecial { + return string(r.Special[c]) + } + if len(r.Simple[c]) != 0 { + return string(r.Simple[c]) + } + return string(r.Rune) +} + +func parse(file string, f func(p *ucd.Parser)) { + ucd.Parse(gen.OpenUCDFile(file), f) +} + +func parseUCD() []runeInfo { + chars := make([]runeInfo, unicode.MaxRune) + + get := func(r rune) *runeInfo { + c := &chars[r] + c.Rune = r + return c + } + + parse("UnicodeData.txt", func(p *ucd.Parser) { + ri := get(p.Rune(0)) + ri.CCC = byte(p.Int(ucd.CanonicalCombiningClass)) + ri.Simple[cLower] = p.Runes(ucd.SimpleLowercaseMapping) + ri.Simple[cUpper] = p.Runes(ucd.SimpleUppercaseMapping) + ri.Simple[cTitle] = p.Runes(ucd.SimpleTitlecaseMapping) + if p.String(ucd.GeneralCategory) == "Lt" { + ri.CaseMode = cTitle + } + }) + + // ; + parse("PropList.txt", func(p *ucd.Parser) { + if p.String(1) == "Soft_Dotted" { + chars[p.Rune(0)].SoftDotted = true + } + }) + + // ; + parse("DerivedCoreProperties.txt", func(p *ucd.Parser) { + ri := get(p.Rune(0)) + switch p.String(1) { + case "Case_Ignorable": + ri.CaseIgnorable = true + case "Cased": + ri.Cased = true + case "Lowercase": + ri.CaseMode = cLower + case "Uppercase": + ri.CaseMode = cUpper + } + }) + + // ; ; ; <upper> ; (<condition_list> ;)? + parse("SpecialCasing.txt", func(p *ucd.Parser) { + // We drop all conditional special casing and deal with them manually in + // the language-specific case mappers. Rune 0x03A3 is the only one with + // a conditional formatting that is not language-specific. However, + // dealing with this letter is tricky, especially in a streaming + // context, so we deal with it in the Caser for Greek specifically. + ri := get(p.Rune(0)) + if p.String(4) == "" { + ri.HasSpecial = true + ri.Special[cLower] = p.Runes(1) + ri.Special[cTitle] = p.Runes(2) + ri.Special[cUpper] = p.Runes(3) + } else { + ri.Conditional = true + } + }) + + // TODO: Use text breaking according to UAX #29. + // <code>; <word break type> + parse("auxiliary/WordBreakProperty.txt", func(p *ucd.Parser) { + ri := get(p.Rune(0)) + ri.BreakType = p.String(1) + + // We collapse the word breaking properties onto the categories we need. + switch p.String(1) { // TODO: officially we need to canonicalize. + case "MidLetter", "MidNumLet", "Single_Quote": + ri.BreakCat = breakMid + if !ri.CaseIgnorable { + // finalSigma relies on the fact that all breakMid runes are + // also a Case_Ignorable. Revisit this code when this changes. + log.Fatalf("Rune %U, which has a break category mid, is not a case ignorable", ri) + } + case "ALetter", "Hebrew_Letter", "Numeric", "Extend", "ExtendNumLet", "Format", "ZWJ": + ri.BreakCat = breakLetter + } + }) + + // <code>; <type>; <mapping> + parse("CaseFolding.txt", func(p *ucd.Parser) { + ri := get(p.Rune(0)) + switch p.String(1) { + case "C": + ri.FoldSimple = p.Rune(2) + ri.FoldFull = p.Runes(2) + case "S": + ri.FoldSimple = p.Rune(2) + case "T": + ri.FoldSpecial = p.Rune(2) + case "F": + ri.FoldFull = p.Runes(2) + default: + log.Fatalf("%U: unknown type: %s", p.Rune(0), p.String(1)) + } + }) + + return chars +} + +func genTables() { + chars := parseUCD() + verifyProperties(chars) + + t := triegen.NewTrie("case") + for i := range chars { + c := &chars[i] + makeEntry(c) + t.Insert(rune(i), uint64(c.entry)) + } + + w := gen.NewCodeWriter() + defer w.WriteGoFile("tables.go", "cases") + + gen.WriteUnicodeVersion(w) + + // TODO: write CLDR version after adding a mechanism to detect that the + // tables on which the manually created locale-sensitive casing code is + // based hasn't changed. + + w.WriteVar("xorData", string(xorData)) + w.WriteVar("exceptions", string(exceptionData)) + + sz, err := t.Gen(w, triegen.Compact(&sparseCompacter{})) + if err != nil { + log.Fatal(err) + } + w.Size += sz +} + +func makeEntry(ri *runeInfo) { + if ri.CaseIgnorable { + if ri.Cased { + ri.entry = cIgnorableCased + } else { + ri.entry = cIgnorableUncased + } + } else { + ri.entry = ri.CaseMode + } + + // TODO: handle soft-dotted. + + ccc := cccOther + switch ri.CCC { + case 0: // Not_Reordered + ccc = cccZero + case above: // Above + ccc = cccAbove + } + switch ri.BreakCat { + case breakBreak: + ccc = cccBreak + case breakMid: + ri.entry |= isMidBit + } + + ri.entry |= ccc + + if ri.CaseMode == cUncased { + return + } + + // Need to do something special. + if ri.CaseMode == cTitle || ri.HasSpecial || ri.mapping(cTitle) != ri.mapping(cUpper) { + makeException(ri) + return + } + if f := string(ri.FoldFull); len(f) > 0 && f != ri.mapping(cUpper) && f != ri.mapping(cLower) { + makeException(ri) + return + } + + // Rune is either lowercase or uppercase. + + orig := string(ri.Rune) + mapped := "" + if ri.CaseMode == cUpper { + mapped = ri.mapping(cLower) + } else { + mapped = ri.mapping(cUpper) + } + + if len(orig) != len(mapped) { + makeException(ri) + return + } + + if string(ri.FoldFull) == ri.mapping(cUpper) { + ri.entry |= inverseFoldBit + } + + n := len(orig) + + // Create per-byte XOR mask. + var b []byte + for i := 0; i < n; i++ { + b = append(b, orig[i]^mapped[i]) + } + + // Remove leading 0 bytes, but keep at least one byte. + for ; len(b) > 1 && b[0] == 0; b = b[1:] { + } + + if len(b) == 1 && b[0]&0xc0 == 0 { + ri.entry |= info(b[0]) << xorShift + return + } + + key := string(b) + x, ok := xorCache[key] + if !ok { + xorData = append(xorData, 0) // for detecting start of sequence + xorData = append(xorData, b...) + + x = len(xorData) - 1 + xorCache[key] = x + } + ri.entry |= info(x<<xorShift) | xorIndexBit +} + +var xorCache = map[string]int{} + +// xorData contains byte-wise XOR data for the least significant bytes of a +// UTF-8 encoded rune. An index points to the last byte. The sequence starts +// with a zero terminator. +var xorData = []byte{} + +// See the comments in gen_trieval.go re "the exceptions slice". +var exceptionData = []byte{0} + +// makeException encodes case mappings that cannot be expressed in a simple +// XOR diff. +func makeException(ri *runeInfo) { + ccc := ri.entry & cccMask + // Set exception bit and retain case type. + ri.entry &= 0x0007 + ri.entry |= exceptionBit + + if len(exceptionData) >= 1<<numExceptionBits { + log.Fatalf("%U:exceptionData too large %x > %d bits", ri.Rune, len(exceptionData), numExceptionBits) + } + + // Set the offset in the exceptionData array. + ri.entry |= info(len(exceptionData) << exceptionShift) + + orig := string(ri.Rune) + tc := ri.mapping(cTitle) + uc := ri.mapping(cUpper) + lc := ri.mapping(cLower) + ff := string(ri.FoldFull) + + // addString sets the length of a string and adds it to the expansions array. + addString := func(s string, b *byte) { + if len(s) == 0 { + // Zero-length mappings exist, but only for conditional casing, + // which we are representing outside of this table. + log.Fatalf("%U: has zero-length mapping.", ri.Rune) + } + *b <<= 3 + if s != orig { + n := len(s) + if n > 7 { + log.Fatalf("%U: mapping larger than 7 (%d)", ri.Rune, n) + } + *b |= byte(n) + exceptionData = append(exceptionData, s...) + } + } + + // byte 0: + exceptionData = append(exceptionData, byte(ccc)|byte(len(ff))) + + // byte 1: + p := len(exceptionData) + exceptionData = append(exceptionData, 0) + + if len(ff) > 7 { // May be zero-length. + log.Fatalf("%U: fold string larger than 7 (%d)", ri.Rune, len(ff)) + } + exceptionData = append(exceptionData, ff...) + ct := ri.CaseMode + if ct != cLower { + addString(lc, &exceptionData[p]) + } + if ct != cUpper { + addString(uc, &exceptionData[p]) + } + if ct != cTitle { + // If title is the same as upper, we set it to the original string so + // that it will be marked as not present. This implies title case is + // the same as upper case. + if tc == uc { + tc = orig + } + addString(tc, &exceptionData[p]) + } +} + +// sparseCompacter is a trie value block Compacter. There are many cases where +// successive runes alternate between lower- and upper-case. This Compacter +// exploits this by adding a special case type where the case value is obtained +// from or-ing it with the least-significant bit of the rune, creating large +// ranges of equal case values that compress well. +type sparseCompacter struct { + sparseBlocks [][]uint16 + sparseOffsets []uint16 + sparseCount int +} + +// makeSparse returns the number of elements that compact block would contain +// as well as the modified values. +func makeSparse(vals []uint64) ([]uint16, int) { + // Copy the values. + values := make([]uint16, len(vals)) + for i, v := range vals { + values[i] = uint16(v) + } + + alt := func(i int, v uint16) uint16 { + if cm := info(v & fullCasedMask); cm == cUpper || cm == cLower { + // Convert cLower or cUpper to cXORCase value, which has the form 11x. + xor := v + xor &^= 1 + xor |= uint16(i&1) ^ (v & 1) + xor |= 0x4 + return xor + } + return v + } + + var count int + var previous uint16 + for i, v := range values { + if v != 0 { + // Try if the unmodified value is equal to the previous. + if v == previous { + continue + } + + // Try if the xor-ed value is equal to the previous value. + a := alt(i, v) + if a == previous { + values[i] = a + continue + } + + // This is a new value. + count++ + + // Use the xor-ed value if it will be identical to the next value. + if p := i + 1; p < len(values) && alt(p, values[p]) == a { + values[i] = a + v = a + } + } + previous = v + } + return values, count +} + +func (s *sparseCompacter) Size(v []uint64) (int, bool) { + _, n := makeSparse(v) + + // We limit using this method to having 16 entries. + if n > 16 { + return 0, false + } + + return 2 + int(reflect.TypeOf(valueRange{}).Size())*n, true +} + +func (s *sparseCompacter) Store(v []uint64) uint32 { + h := uint32(len(s.sparseOffsets)) + values, sz := makeSparse(v) + s.sparseBlocks = append(s.sparseBlocks, values) + s.sparseOffsets = append(s.sparseOffsets, uint16(s.sparseCount)) + s.sparseCount += sz + return h +} + +func (s *sparseCompacter) Handler() string { + // The sparse global variable and its lookup method is defined in gen_trieval.go. + return "sparse.lookup" +} + +func (s *sparseCompacter) Print(w io.Writer) (retErr error) { + p := func(format string, args ...interface{}) { + _, err := fmt.Fprintf(w, format, args...) + if retErr == nil && err != nil { + retErr = err + } + } + + ls := len(s.sparseBlocks) + if ls == len(s.sparseOffsets) { + s.sparseOffsets = append(s.sparseOffsets, uint16(s.sparseCount)) + } + p("// sparseOffsets: %d entries, %d bytes\n", ls+1, (ls+1)*2) + p("var sparseOffsets = %#v\n\n", s.sparseOffsets) + + ns := s.sparseCount + p("// sparseValues: %d entries, %d bytes\n", ns, ns*4) + p("var sparseValues = [%d]valueRange {", ns) + for i, values := range s.sparseBlocks { + p("\n// Block %#x, offset %#x", i, s.sparseOffsets[i]) + var v uint16 + for i, nv := range values { + if nv != v { + if v != 0 { + p(",hi:%#02x},", 0x80+i-1) + } + if nv != 0 { + p("\n{value:%#04x,lo:%#02x", nv, 0x80+i) + } + } + v = nv + } + if v != 0 { + p(",hi:%#02x},", 0x80+len(values)-1) + } + } + p("\n}\n\n") + return +} + +// verifyProperties that properties of the runes that are relied upon in the +// implementation. Each property is marked with an identifier that is referred +// to in the places where it is used. +func verifyProperties(chars []runeInfo) { + for i, c := range chars { + r := rune(i) + + // Rune properties. + + // A.1: modifier never changes on lowercase. [ltLower] + if c.CCC > 0 && unicode.ToLower(r) != r { + log.Fatalf("%U: non-starter changes when lowercased", r) + } + + // A.2: properties of decompositions starting with I or J. [ltLower] + d := norm.NFD.PropertiesString(string(r)).Decomposition() + if len(d) > 0 { + if d[0] == 'I' || d[0] == 'J' { + // A.2.1: we expect at least an ASCII character and a modifier. + if len(d) < 3 { + log.Fatalf("%U: length of decomposition was %d; want >= 3", r, len(d)) + } + + // All subsequent runes are modifiers and all have the same CCC. + runes := []rune(string(d[1:])) + ccc := chars[runes[0]].CCC + + for _, mr := range runes[1:] { + mc := chars[mr] + + // A.2.2: all modifiers have a CCC of Above or less. + if ccc == 0 || ccc > above { + log.Fatalf("%U: CCC of successive rune (%U) was %d; want (0,230]", r, mr, ccc) + } + + // A.2.3: a sequence of modifiers all have the same CCC. + if mc.CCC != ccc { + log.Fatalf("%U: CCC of follow-up modifier (%U) was %d; want %d", r, mr, mc.CCC, ccc) + } + + // A.2.4: for each trailing r, r in [0x300, 0x311] <=> CCC == Above. + if (ccc == above) != (0x300 <= mr && mr <= 0x311) { + log.Fatalf("%U: modifier %U in [U+0300, U+0311] != ccc(%U) == 230", r, mr, mr) + } + + if i += len(string(mr)); i >= len(d) { + break + } + } + } + } + + // A.3: no U+0307 in decomposition of Soft-Dotted rune. [ltUpper] + if unicode.Is(unicode.Soft_Dotted, r) && strings.Contains(string(d), "\u0307") { + log.Fatalf("%U: decomposition of soft-dotted rune may not contain U+0307", r) + } + + // A.4: only rune U+0345 may be of CCC Iota_Subscript. [elUpper] + if c.CCC == iotaSubscript && r != 0x0345 { + log.Fatalf("%U: only rune U+0345 may have CCC Iota_Subscript", r) + } + + // A.5: soft-dotted runes do not have exceptions. + if c.SoftDotted && c.entry&exceptionBit != 0 { + log.Fatalf("%U: soft-dotted has exception", r) + } + + // A.6: Greek decomposition. [elUpper] + if unicode.Is(unicode.Greek, r) { + if b := norm.NFD.PropertiesString(string(r)).Decomposition(); b != nil { + runes := []rune(string(b)) + // A.6.1: If a Greek rune decomposes and the first rune of the + // decomposition is greater than U+00FF, the rune is always + // great and not a modifier. + if f := runes[0]; unicode.IsMark(f) || f > 0xFF && !unicode.Is(unicode.Greek, f) { + log.Fatalf("%U: expeced first rune of Greek decomposition to be letter, found %U", r, f) + } + // A.6.2: Any follow-up rune in a Greek decomposition is a + // modifier of which the first should be gobbled in + // decomposition. + for _, m := range runes[1:] { + switch m { + case 0x0313, 0x0314, 0x0301, 0x0300, 0x0306, 0x0342, 0x0308, 0x0304, 0x345: + default: + log.Fatalf("%U: modifier %U is outside of expeced Greek modifier set", r, m) + } + } + } + } + + // Breaking properties. + + // B.1: all runes with CCC > 0 are of break type Extend. + if c.CCC > 0 && c.BreakType != "Extend" { + log.Fatalf("%U: CCC == %d, but got break type %s; want Extend", r, c.CCC, c.BreakType) + } + + // B.2: all cased runes with c.CCC == 0 are of break type ALetter. + if c.CCC == 0 && c.Cased && c.BreakType != "ALetter" { + log.Fatalf("%U: cased, but got break type %s; want ALetter", r, c.BreakType) + } + + // B.3: letter category. + if c.CCC == 0 && c.BreakCat != breakBreak && !c.CaseIgnorable { + if c.BreakCat != breakLetter { + log.Fatalf("%U: check for letter break type gave %d; want %d", r, c.BreakCat, breakLetter) + } + } + } +} + +func genTablesTest() { + w := &bytes.Buffer{} + + fmt.Fprintln(w, "var (") + printProperties(w, "DerivedCoreProperties.txt", "Case_Ignorable", verifyIgnore) + + // We discard the output as we know we have perfect functions. We run them + // just to verify the properties are correct. + n := printProperties(ioutil.Discard, "DerivedCoreProperties.txt", "Cased", verifyCased) + n += printProperties(ioutil.Discard, "DerivedCoreProperties.txt", "Lowercase", verifyLower) + n += printProperties(ioutil.Discard, "DerivedCoreProperties.txt", "Uppercase", verifyUpper) + if n > 0 { + log.Fatalf("One of the discarded properties does not have a perfect filter.") + } + + // <code>; <lower> ; <title> ; <upper> ; (<condition_list> ;)? + fmt.Fprintln(w, "\tspecial = map[rune]struct{ toLower, toTitle, toUpper string }{") + parse("SpecialCasing.txt", func(p *ucd.Parser) { + // Skip conditional entries. + if p.String(4) != "" { + return + } + r := p.Rune(0) + fmt.Fprintf(w, "\t\t0x%04x: {%q, %q, %q},\n", + r, string(p.Runes(1)), string(p.Runes(2)), string(p.Runes(3))) + }) + fmt.Fprint(w, "\t}\n\n") + + // <code>; <type>; <runes> + table := map[rune]struct{ simple, full, special string }{} + parse("CaseFolding.txt", func(p *ucd.Parser) { + r := p.Rune(0) + t := p.String(1) + v := string(p.Runes(2)) + if t != "T" && v == string(unicode.ToLower(r)) { + return + } + x := table[r] + switch t { + case "C": + x.full = v + x.simple = v + case "S": + x.simple = v + case "F": + x.full = v + case "T": + x.special = v + } + table[r] = x + }) + fmt.Fprintln(w, "\tfoldMap = map[rune]struct{ simple, full, special string }{") + for r := rune(0); r < 0x10FFFF; r++ { + x, ok := table[r] + if !ok { + continue + } + fmt.Fprintf(w, "\t\t0x%04x: {%q, %q, %q},\n", r, x.simple, x.full, x.special) + } + fmt.Fprint(w, "\t}\n\n") + + // Break property + notBreak := map[rune]bool{} + parse("auxiliary/WordBreakProperty.txt", func(p *ucd.Parser) { + switch p.String(1) { + case "Extend", "Format", "MidLetter", "MidNumLet", "Single_Quote", + "ALetter", "Hebrew_Letter", "Numeric", "ExtendNumLet", "ZWJ": + notBreak[p.Rune(0)] = true + } + }) + + fmt.Fprintln(w, "\tbreakProp = []struct{ lo, hi rune }{") + inBreak := false + for r := rune(0); r <= lastRuneForTesting; r++ { + if isBreak := !notBreak[r]; isBreak != inBreak { + if isBreak { + fmt.Fprintf(w, "\t\t{0x%x, ", r) + } else { + fmt.Fprintf(w, "0x%x},\n", r-1) + } + inBreak = isBreak + } + } + if inBreak { + fmt.Fprintf(w, "0x%x},\n", lastRuneForTesting) + } + fmt.Fprint(w, "\t}\n\n") + + // Word break test + // Filter out all samples that do not contain cased characters. + cased := map[rune]bool{} + parse("DerivedCoreProperties.txt", func(p *ucd.Parser) { + if p.String(1) == "Cased" { + cased[p.Rune(0)] = true + } + }) + + fmt.Fprintln(w, "\tbreakTest = []string{") + parse("auxiliary/WordBreakTest.txt", func(p *ucd.Parser) { + c := strings.Split(p.String(0), " ") + + const sep = '|' + numCased := 0 + test := "" + for ; len(c) >= 2; c = c[2:] { + if c[0] == "÷" && test != "" { + test += string(sep) + } + i, err := strconv.ParseUint(c[1], 16, 32) + r := rune(i) + if err != nil { + log.Fatalf("Invalid rune %q.", c[1]) + } + if r == sep { + log.Fatalf("Separator %q not allowed in test data. Pick another one.", sep) + } + if cased[r] { + numCased++ + } + test += string(r) + } + if numCased > 1 { + fmt.Fprintf(w, "\t\t%q,\n", test) + } + }) + fmt.Fprintln(w, "\t}") + + fmt.Fprintln(w, ")") + + gen.WriteGoFile("tables_test.go", "cases", w.Bytes()) +} + +// These functions are just used for verification that their definition have not +// changed in the Unicode Standard. + +func verifyCased(r rune) bool { + return verifyLower(r) || verifyUpper(r) || unicode.IsTitle(r) +} + +func verifyLower(r rune) bool { + return unicode.IsLower(r) || unicode.Is(unicode.Other_Lowercase, r) +} + +func verifyUpper(r rune) bool { + return unicode.IsUpper(r) || unicode.Is(unicode.Other_Uppercase, r) +} + +// verifyIgnore is an approximation of the Case_Ignorable property using the +// core unicode package. It is used to reduce the size of the test data. +func verifyIgnore(r rune) bool { + props := []*unicode.RangeTable{ + unicode.Mn, + unicode.Me, + unicode.Cf, + unicode.Lm, + unicode.Sk, + } + for _, p := range props { + if unicode.Is(p, r) { + return true + } + } + return false +} + +// printProperties prints tables of rune properties from the given UCD file. +// A filter func f can be given to exclude certain values. A rune r will have +// the indicated property if it is in the generated table or if f(r). +func printProperties(w io.Writer, file, property string, f func(r rune) bool) int { + verify := map[rune]bool{} + n := 0 + varNameParts := strings.Split(property, "_") + varNameParts[0] = strings.ToLower(varNameParts[0]) + fmt.Fprintf(w, "\t%s = map[rune]bool{\n", strings.Join(varNameParts, "")) + parse(file, func(p *ucd.Parser) { + if p.String(1) == property { + r := p.Rune(0) + verify[r] = true + if !f(r) { + n++ + fmt.Fprintf(w, "\t\t0x%.4x: true,\n", r) + } + } + }) + fmt.Fprint(w, "\t}\n\n") + + // Verify that f is correct, that is, it represents a subset of the property. + for r := rune(0); r <= lastRuneForTesting; r++ { + if !verify[r] && f(r) { + log.Fatalf("Incorrect filter func for property %q.", property) + } + } + return n +} + +// The newCaseTrie, sparseValues and sparseOffsets definitions below are +// placeholders referred to by gen_trieval.go. The real definitions are +// generated by this program and written to tables.go. + +func newCaseTrie(int) int { return 0 } + +var ( + sparseValues [0]valueRange + sparseOffsets [0]uint16 +) diff --git a/vendor/golang.org/x/text/cases/gen_trieval.go b/vendor/golang.org/x/text/cases/gen_trieval.go new file mode 100644 index 000000000..376d22c8f --- /dev/null +++ b/vendor/golang.org/x/text/cases/gen_trieval.go @@ -0,0 +1,219 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +// This file contains definitions for interpreting the trie value of the case +// trie generated by "go run gen*.go". It is shared by both the generator +// program and the resultant package. Sharing is achieved by the generator +// copying gen_trieval.go to trieval.go and changing what's above this comment. + +// info holds case information for a single rune. It is the value returned +// by a trie lookup. Most mapping information can be stored in a single 16-bit +// value. If not, for example when a rune is mapped to multiple runes, the value +// stores some basic case data and an index into an array with additional data. +// +// The per-rune values have the following format: +// +// if (exception) { +// 15..5 unsigned exception index +// 4 unused +// } else { +// 15..8 XOR pattern or index to XOR pattern for case mapping +// Only 13..8 are used for XOR patterns. +// 7 inverseFold (fold to upper, not to lower) +// 6 index: interpret the XOR pattern as an index +// or isMid if case mode is cIgnorableUncased. +// 5..4 CCC: zero (normal or break), above or other +// } +// 3 exception: interpret this value as an exception index +// (TODO: is this bit necessary? Probably implied from case mode.) +// 2..0 case mode +// +// For the non-exceptional cases, a rune must be either uncased, lowercase or +// uppercase. If the rune is cased, the XOR pattern maps either a lowercase +// rune to uppercase or an uppercase rune to lowercase (applied to the 10 +// least-significant bits of the rune). +// +// See the definitions below for a more detailed description of the various +// bits. +type info uint16 + +const ( + casedMask = 0x0003 + fullCasedMask = 0x0007 + ignorableMask = 0x0006 + ignorableValue = 0x0004 + + inverseFoldBit = 1 << 7 + isMidBit = 1 << 6 + + exceptionBit = 1 << 3 + exceptionShift = 5 + numExceptionBits = 11 + + xorIndexBit = 1 << 6 + xorShift = 8 + + // There is no mapping if all xor bits and the exception bit are zero. + hasMappingMask = 0xff80 | exceptionBit +) + +// The case mode bits encodes the case type of a rune. This includes uncased, +// title, upper and lower case and case ignorable. (For a definition of these +// terms see Chapter 3 of The Unicode Standard Core Specification.) In some rare +// cases, a rune can be both cased and case-ignorable. This is encoded by +// cIgnorableCased. A rune of this type is always lower case. Some runes are +// cased while not having a mapping. +// +// A common pattern for scripts in the Unicode standard is for upper and lower +// case runes to alternate for increasing rune values (e.g. the accented Latin +// ranges starting from U+0100 and U+1E00 among others and some Cyrillic +// characters). We use this property by defining a cXORCase mode, where the case +// mode (always upper or lower case) is derived from the rune value. As the XOR +// pattern for case mappings is often identical for successive runes, using +// cXORCase can result in large series of identical trie values. This, in turn, +// allows us to better compress the trie blocks. +const ( + cUncased info = iota // 000 + cTitle // 001 + cLower // 010 + cUpper // 011 + cIgnorableUncased // 100 + cIgnorableCased // 101 // lower case if mappings exist + cXORCase // 11x // case is cLower | ((rune&1) ^ x) + + maxCaseMode = cUpper +) + +func (c info) isCased() bool { + return c&casedMask != 0 +} + +func (c info) isCaseIgnorable() bool { + return c&ignorableMask == ignorableValue +} + +func (c info) isNotCasedAndNotCaseIgnorable() bool { + return c&fullCasedMask == 0 +} + +func (c info) isCaseIgnorableAndNotCased() bool { + return c&fullCasedMask == cIgnorableUncased +} + +func (c info) isMid() bool { + return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased +} + +// The case mapping implementation will need to know about various Canonical +// Combining Class (CCC) values. We encode two of these in the trie value: +// cccZero (0) and cccAbove (230). If the value is cccOther, it means that +// CCC(r) > 0, but not 230. A value of cccBreak means that CCC(r) == 0 and that +// the rune also has the break category Break (see below). +const ( + cccBreak info = iota << 4 + cccZero + cccAbove + cccOther + + cccMask = cccBreak | cccZero | cccAbove | cccOther +) + +const ( + starter = 0 + above = 230 + iotaSubscript = 240 +) + +// The exceptions slice holds data that does not fit in a normal info entry. +// The entry is pointed to by the exception index in an entry. It has the +// following format: +// +// Header +// byte 0: +// 7..6 unused +// 5..4 CCC type (same bits as entry) +// 3 unused +// 2..0 length of fold +// +// byte 1: +// 7..6 unused +// 5..3 length of 1st mapping of case type +// 2..0 length of 2nd mapping of case type +// +// case 1st 2nd +// lower -> upper, title +// upper -> lower, title +// title -> lower, upper +// +// Lengths with the value 0x7 indicate no value and implies no change. +// A length of 0 indicates a mapping to zero-length string. +// +// Body bytes: +// case folding bytes +// lowercase mapping bytes +// uppercase mapping bytes +// titlecase mapping bytes +// closure mapping bytes (for NFKC_Casefold). (TODO) +// +// Fallbacks: +// missing fold -> lower +// missing title -> upper +// all missing -> original rune +// +// exceptions starts with a dummy byte to enforce that there is no zero index +// value. +const ( + lengthMask = 0x07 + lengthBits = 3 + noChange = 0 +) + +// References to generated trie. + +var trie = newCaseTrie(0) + +var sparse = sparseBlocks{ + values: sparseValues[:], + offsets: sparseOffsets[:], +} + +// Sparse block lookup code. + +// valueRange is an entry in a sparse block. +type valueRange struct { + value uint16 + lo, hi byte +} + +type sparseBlocks struct { + values []valueRange + offsets []uint16 +} + +// lookup returns the value from values block n for byte b using binary search. +func (s *sparseBlocks) lookup(n uint32, b byte) uint16 { + lo := s.offsets[n] + hi := s.offsets[n+1] + for lo < hi { + m := lo + (hi-lo)/2 + r := s.values[m] + if r.lo <= b && b <= r.hi { + return r.value + } + if b < r.lo { + hi = m + } else { + lo = m + 1 + } + } + return 0 +} + +// lastRuneForTesting is the last rune used for testing. Everything after this +// is boring. +const lastRuneForTesting = rune(0x1FFFF) diff --git a/vendor/golang.org/x/text/cases/icu.go b/vendor/golang.org/x/text/cases/icu.go new file mode 100644 index 000000000..46530d1e4 --- /dev/null +++ b/vendor/golang.org/x/text/cases/icu.go @@ -0,0 +1,61 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build icu + +package cases + +// Ideally these functions would be defined in a test file, but go test doesn't +// allow CGO in tests. The build tag should ensure either way that these +// functions will not end up in the package. + +// TODO: Ensure that the correct ICU version is set. + +/* +#cgo LDFLAGS: -licui18n.57 -licuuc.57 +#include <stdlib.h> +#include <unicode/ustring.h> +#include <unicode/utypes.h> +#include <unicode/localpointer.h> +#include <unicode/ucasemap.h> +*/ +import "C" + +import "unsafe" + +func doICU(tag, caser, input string) string { + err := C.UErrorCode(0) + loc := C.CString(tag) + cm := C.ucasemap_open(loc, C.uint32_t(0), &err) + + buf := make([]byte, len(input)*4) + dst := (*C.char)(unsafe.Pointer(&buf[0])) + src := C.CString(input) + + cn := C.int32_t(0) + + switch caser { + case "fold": + cn = C.ucasemap_utf8FoldCase(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "lower": + cn = C.ucasemap_utf8ToLower(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "upper": + cn = C.ucasemap_utf8ToUpper(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "title": + cn = C.ucasemap_utf8ToTitle(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + } + return string(buf[:cn]) +} diff --git a/vendor/golang.org/x/text/cases/info.go b/vendor/golang.org/x/text/cases/info.go new file mode 100644 index 000000000..3b51f03d6 --- /dev/null +++ b/vendor/golang.org/x/text/cases/info.go @@ -0,0 +1,82 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +func (c info) cccVal() info { + if c&exceptionBit != 0 { + return info(exceptions[c>>exceptionShift]) & cccMask + } + return c & cccMask +} + +func (c info) cccType() info { + ccc := c.cccVal() + if ccc <= cccZero { + return cccZero + } + return ccc +} + +// TODO: Implement full Unicode breaking algorithm: +// 1) Implement breaking in separate package. +// 2) Use the breaker here. +// 3) Compare table size and performance of using the more generic breaker. +// +// Note that we can extend the current algorithm to be much more accurate. This +// only makes sense, though, if the performance and/or space penalty of using +// the generic breaker is big. Extra data will only be needed for non-cased +// runes, which means there are sufficient bits left in the caseType. +// ICU prohibits breaking in such cases as well. + +// For the purpose of title casing we use an approximation of the Unicode Word +// Breaking algorithm defined in Annex #29: +// http://www.unicode.org/reports/tr29/#Default_Grapheme_Cluster_Table. +// +// For our approximation, we group the Word Break types into the following +// categories, with associated rules: +// +// 1) Letter: +// ALetter, Hebrew_Letter, Numeric, ExtendNumLet, Extend, Format_FE, ZWJ. +// Rule: Never break between consecutive runes of this category. +// +// 2) Mid: +// MidLetter, MidNumLet, Single_Quote. +// (Cf. case-ignorable: MidLetter, MidNumLet, Single_Quote or cat is Mn, +// Me, Cf, Lm or Sk). +// Rule: Don't break between Letter and Mid, but break between two Mids. +// +// 3) Break: +// Any other category: NewLine, MidNum, CR, LF, Double_Quote, Katakana, and +// Other. +// These categories should always result in a break between two cased letters. +// Rule: Always break. +// +// Note 1: the Katakana and MidNum categories can, in esoteric cases, result in +// preventing a break between two cased letters. For now we will ignore this +// (e.g. [ALetter] [ExtendNumLet] [Katakana] [ExtendNumLet] [ALetter] and +// [ALetter] [Numeric] [MidNum] [Numeric] [ALetter].) +// +// Note 2: the rule for Mid is very approximate, but works in most cases. To +// improve, we could store the categories in the trie value and use a FA to +// manage breaks. See TODO comment above. +// +// Note 3: according to the spec, it is possible for the Extend category to +// introduce breaks between other categories grouped in Letter. However, this +// is undesirable for our purposes. ICU prevents breaks in such cases as well. + +// isBreak returns whether this rune should introduce a break. +func (c info) isBreak() bool { + return c.cccVal() == cccBreak +} + +// isLetter returns whether the rune is of break type ALetter, Hebrew_Letter, +// Numeric, ExtendNumLet, or Extend. +func (c info) isLetter() bool { + ccc := c.cccVal() + if ccc == cccZero { + return !c.isCaseIgnorable() + } + return ccc != cccBreak +} diff --git a/vendor/golang.org/x/text/cases/map.go b/vendor/golang.org/x/text/cases/map.go new file mode 100644 index 000000000..4baebaaa6 --- /dev/null +++ b/vendor/golang.org/x/text/cases/map.go @@ -0,0 +1,816 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +// This file contains the definitions of case mappings for all supported +// languages. The rules for the language-specific tailorings were taken and +// modified from the CLDR transform definitions in common/transforms. + +import ( + "strings" + "unicode" + "unicode/utf8" + + "golang.org/x/text/internal" + "golang.org/x/text/language" + "golang.org/x/text/transform" + "golang.org/x/text/unicode/norm" +) + +// A mapFunc takes a context set to the current rune and writes the mapped +// version to the same context. It may advance the context to the next rune. It +// returns whether a checkpoint is possible: whether the pDst bytes written to +// dst so far won't need changing as we see more source bytes. +type mapFunc func(*context) bool + +// A spanFunc takes a context set to the current rune and returns whether this +// rune would be altered when written to the output. It may advance the context +// to the next rune. It returns whether a checkpoint is possible. +type spanFunc func(*context) bool + +// maxIgnorable defines the maximum number of ignorables to consider for +// lookahead operations. +const maxIgnorable = 30 + +// supported lists the language tags for which we have tailorings. +const supported = "und af az el lt nl tr" + +func init() { + tags := []language.Tag{} + for _, s := range strings.Split(supported, " ") { + tags = append(tags, language.MustParse(s)) + } + matcher = internal.NewInheritanceMatcher(tags) + Supported = language.NewCoverage(tags) +} + +var ( + matcher *internal.InheritanceMatcher + + Supported language.Coverage + + // We keep the following lists separate, instead of having a single per- + // language struct, to give the compiler a chance to remove unused code. + + // Some uppercase mappers are stateless, so we can precompute the + // Transformers and save a bit on runtime allocations. + upperFunc = []struct { + upper mapFunc + span spanFunc + }{ + {nil, nil}, // und + {nil, nil}, // af + {aztrUpper(upper), isUpper}, // az + {elUpper, noSpan}, // el + {ltUpper(upper), noSpan}, // lt + {nil, nil}, // nl + {aztrUpper(upper), isUpper}, // tr + } + + undUpper transform.SpanningTransformer = &undUpperCaser{} + undLower transform.SpanningTransformer = &undLowerCaser{} + undLowerIgnoreSigma transform.SpanningTransformer = &undLowerIgnoreSigmaCaser{} + + lowerFunc = []mapFunc{ + nil, // und + nil, // af + aztrLower, // az + nil, // el + ltLower, // lt + nil, // nl + aztrLower, // tr + } + + titleInfos = []struct { + title mapFunc + lower mapFunc + titleSpan spanFunc + rewrite func(*context) + }{ + {title, lower, isTitle, nil}, // und + {title, lower, isTitle, afnlRewrite}, // af + {aztrUpper(title), aztrLower, isTitle, nil}, // az + {title, lower, isTitle, nil}, // el + {ltUpper(title), ltLower, noSpan, nil}, // lt + {nlTitle, lower, nlTitleSpan, afnlRewrite}, // nl + {aztrUpper(title), aztrLower, isTitle, nil}, // tr + } +) + +func makeUpper(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + f := upperFunc[i].upper + if f == nil { + return undUpper + } + return &simpleCaser{f: f, span: upperFunc[i].span} +} + +func makeLower(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + f := lowerFunc[i] + if f == nil { + if o.ignoreFinalSigma { + return undLowerIgnoreSigma + } + return undLower + } + if o.ignoreFinalSigma { + return &simpleCaser{f: f, span: isLower} + } + return &lowerCaser{ + first: f, + midWord: finalSigma(f), + } +} + +func makeTitle(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + x := &titleInfos[i] + lower := x.lower + if o.noLower { + lower = (*context).copy + } else if !o.ignoreFinalSigma { + lower = finalSigma(lower) + } + return &titleCaser{ + title: x.title, + lower: lower, + titleSpan: x.titleSpan, + rewrite: x.rewrite, + } +} + +func noSpan(c *context) bool { + c.err = transform.ErrEndOfSpan + return false +} + +// TODO: consider a similar special case for the fast majority lower case. This +// is a bit more involved so will require some more precise benchmarking to +// justify it. + +type undUpperCaser struct{ transform.NopResetter } + +// undUpperCaser implements the Transformer interface for doing an upper case +// mapping for the root locale (und). It eliminates the need for an allocation +// as it prevents escaping by not using function pointers. +func (t undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() { + upper(&c) + c.checkpoint() + } + return c.ret() +} + +func (t undUpperCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isUpper(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// undLowerIgnoreSigmaCaser implements the Transformer interface for doing +// a lower case mapping for the root locale (und) ignoring final sigma +// handling. This casing algorithm is used in some performance-critical packages +// like secure/precis and x/net/http/idna, which warrants its special-casing. +type undLowerIgnoreSigmaCaser struct{ transform.NopResetter } + +func (t undLowerIgnoreSigmaCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() && lower(&c) { + c.checkpoint() + } + return c.ret() + +} + +// Span implements a generic lower-casing. This is possible as isLower works +// for all lowercasing variants. All lowercase variants only vary in how they +// transform a non-lowercase letter. They will never change an already lowercase +// letter. In addition, there is no state. +func (t undLowerIgnoreSigmaCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isLower(&c) { + c.checkpoint() + } + return c.retSpan() +} + +type simpleCaser struct { + context + f mapFunc + span spanFunc +} + +// simpleCaser implements the Transformer interface for doing a case operation +// on a rune-by-rune basis. +func (t *simpleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() && t.f(&c) { + c.checkpoint() + } + return c.ret() +} + +func (t *simpleCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && t.span(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// undLowerCaser implements the Transformer interface for doing a lower case +// mapping for the root locale (und) ignoring final sigma handling. This casing +// algorithm is used in some performance-critical packages like secure/precis +// and x/net/http/idna, which warrants its special-casing. +type undLowerCaser struct{ transform.NopResetter } + +func (t undLowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + + for isInterWord := true; c.next(); { + if isInterWord { + if c.info.isCased() { + if !lower(&c) { + break + } + isInterWord = false + } else if !c.copy() { + break + } + } else { + if c.info.isNotCasedAndNotCaseIgnorable() { + if !c.copy() { + break + } + isInterWord = true + } else if !c.hasPrefix("Σ") { + if !lower(&c) { + break + } + } else if !finalSigmaBody(&c) { + break + } + } + c.checkpoint() + } + return c.ret() +} + +func (t undLowerCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isLower(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// lowerCaser implements the Transformer interface. The default Unicode lower +// casing requires different treatment for the first and subsequent characters +// of a word, most notably to handle the Greek final Sigma. +type lowerCaser struct { + undLowerIgnoreSigmaCaser + + context + + first, midWord mapFunc +} + +func (t *lowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + t.context = context{dst: dst, src: src, atEOF: atEOF} + c := &t.context + + for isInterWord := true; c.next(); { + if isInterWord { + if c.info.isCased() { + if !t.first(c) { + break + } + isInterWord = false + } else if !c.copy() { + break + } + } else { + if c.info.isNotCasedAndNotCaseIgnorable() { + if !c.copy() { + break + } + isInterWord = true + } else if !t.midWord(c) { + break + } + } + c.checkpoint() + } + return c.ret() +} + +// titleCaser implements the Transformer interface. Title casing algorithms +// distinguish between the first letter of a word and subsequent letters of the +// same word. It uses state to avoid requiring a potentially infinite lookahead. +type titleCaser struct { + context + + // rune mappings used by the actual casing algorithms. + title mapFunc + lower mapFunc + titleSpan spanFunc + + rewrite func(*context) +} + +// Transform implements the standard Unicode title case algorithm as defined in +// Chapter 3 of The Unicode Standard: +// toTitlecase(X): Find the word boundaries in X according to Unicode Standard +// Annex #29, "Unicode Text Segmentation." For each word boundary, find the +// first cased character F following the word boundary. If F exists, map F to +// Titlecase_Mapping(F); then map all characters C between F and the following +// word boundary to Lowercase_Mapping(C). +func (t *titleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + t.context = context{dst: dst, src: src, atEOF: atEOF, isMidWord: t.isMidWord} + c := &t.context + + if !c.next() { + return c.ret() + } + + for { + p := c.info + if t.rewrite != nil { + t.rewrite(c) + } + + wasMid := p.isMid() + // Break out of this loop on failure to ensure we do not modify the + // state incorrectly. + if p.isCased() { + if !c.isMidWord { + if !t.title(c) { + break + } + c.isMidWord = true + } else if !t.lower(c) { + break + } + } else if !c.copy() { + break + } else if p.isBreak() { + c.isMidWord = false + } + + // As we save the state of the transformer, it is safe to call + // checkpoint after any successful write. + if !(c.isMidWord && wasMid) { + c.checkpoint() + } + + if !c.next() { + break + } + if wasMid && c.info.isMid() { + c.isMidWord = false + } + } + return c.ret() +} + +func (t *titleCaser) Span(src []byte, atEOF bool) (n int, err error) { + t.context = context{src: src, atEOF: atEOF, isMidWord: t.isMidWord} + c := &t.context + + if !c.next() { + return c.retSpan() + } + + for { + p := c.info + if t.rewrite != nil { + t.rewrite(c) + } + + wasMid := p.isMid() + // Break out of this loop on failure to ensure we do not modify the + // state incorrectly. + if p.isCased() { + if !c.isMidWord { + if !t.titleSpan(c) { + break + } + c.isMidWord = true + } else if !isLower(c) { + break + } + } else if p.isBreak() { + c.isMidWord = false + } + // As we save the state of the transformer, it is safe to call + // checkpoint after any successful write. + if !(c.isMidWord && wasMid) { + c.checkpoint() + } + + if !c.next() { + break + } + if wasMid && c.info.isMid() { + c.isMidWord = false + } + } + return c.retSpan() +} + +// finalSigma adds Greek final Sigma handing to another casing function. It +// determines whether a lowercased sigma should be σ or ς, by looking ahead for +// case-ignorables and a cased letters. +func finalSigma(f mapFunc) mapFunc { + return func(c *context) bool { + if !c.hasPrefix("Σ") { + return f(c) + } + return finalSigmaBody(c) + } +} + +func finalSigmaBody(c *context) bool { + // Current rune must be ∑. + + // ::NFD(); + // # 03A3; 03C2; 03A3; 03A3; Final_Sigma; # GREEK CAPITAL LETTER SIGMA + // Σ } [:case-ignorable:]* [:cased:] → σ; + // [:cased:] [:case-ignorable:]* { Σ → ς; + // ::Any-Lower; + // ::NFC(); + + p := c.pDst + c.writeString("ς") + + // TODO: we should do this here, but right now this will never have an + // effect as this is called when the prefix is Sigma, whereas Dutch and + // Afrikaans only test for an apostrophe. + // + // if t.rewrite != nil { + // t.rewrite(c) + // } + + // We need to do one more iteration after maxIgnorable, as a cased + // letter is not an ignorable and may modify the result. + wasMid := false + for i := 0; i < maxIgnorable+1; i++ { + if !c.next() { + return false + } + if !c.info.isCaseIgnorable() { + // All Midword runes are also case ignorable, so we are + // guaranteed to have a letter or word break here. As we are + // unreading the run, there is no need to unset c.isMidWord; + // the title caser will handle this. + if c.info.isCased() { + // p+1 is guaranteed to be in bounds: if writing ς was + // successful, p+1 will contain the second byte of ς. If not, + // this function will have returned after c.next returned false. + c.dst[p+1]++ // ς → σ + } + c.unreadRune() + return true + } + // A case ignorable may also introduce a word break, so we may need + // to continue searching even after detecting a break. + isMid := c.info.isMid() + if (wasMid && isMid) || c.info.isBreak() { + c.isMidWord = false + } + wasMid = isMid + c.copy() + } + return true +} + +// finalSigmaSpan would be the same as isLower. + +// elUpper implements Greek upper casing, which entails removing a predefined +// set of non-blocked modifiers. Note that these accents should not be removed +// for title casing! +// Example: "Οδός" -> "ΟΔΟΣ". +func elUpper(c *context) bool { + // From CLDR: + // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Above:]]*? { [\u0313\u0314\u0301\u0300\u0306\u0342\u0308\u0304] → ; + // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Iota_Subscript:]]*? { \u0345 → ; + + r, _ := utf8.DecodeRune(c.src[c.pSrc:]) + oldPDst := c.pDst + if !upper(c) { + return false + } + if !unicode.Is(unicode.Greek, r) { + return true + } + i := 0 + // Take the properties of the uppercased rune that is already written to the + // destination. This saves us the trouble of having to uppercase the + // decomposed rune again. + if b := norm.NFD.Properties(c.dst[oldPDst:]).Decomposition(); b != nil { + // Restore the destination position and process the decomposed rune. + r, sz := utf8.DecodeRune(b) + if r <= 0xFF { // See A.6.1 + return true + } + c.pDst = oldPDst + // Insert the first rune and ignore the modifiers. See A.6.2. + c.writeBytes(b[:sz]) + i = len(b[sz:]) / 2 // Greek modifiers are always of length 2. + } + + for ; i < maxIgnorable && c.next(); i++ { + switch r, _ := utf8.DecodeRune(c.src[c.pSrc:]); r { + // Above and Iota Subscript + case 0x0300, // U+0300 COMBINING GRAVE ACCENT + 0x0301, // U+0301 COMBINING ACUTE ACCENT + 0x0304, // U+0304 COMBINING MACRON + 0x0306, // U+0306 COMBINING BREVE + 0x0308, // U+0308 COMBINING DIAERESIS + 0x0313, // U+0313 COMBINING COMMA ABOVE + 0x0314, // U+0314 COMBINING REVERSED COMMA ABOVE + 0x0342, // U+0342 COMBINING GREEK PERISPOMENI + 0x0345: // U+0345 COMBINING GREEK YPOGEGRAMMENI + // No-op. Gobble the modifier. + + default: + switch v, _ := trie.lookup(c.src[c.pSrc:]); info(v).cccType() { + case cccZero: + c.unreadRune() + return true + + // We don't need to test for IotaSubscript as the only rune that + // qualifies (U+0345) was already excluded in the switch statement + // above. See A.4. + + case cccAbove: + return c.copy() + default: + // Some other modifier. We're still allowed to gobble Greek + // modifiers after this. + c.copy() + } + } + } + return i == maxIgnorable +} + +// TODO: implement elUpperSpan (low-priority: complex and infrequent). + +func ltLower(c *context) bool { + // From CLDR: + // # Introduce an explicit dot above when lowercasing capital I's and J's + // # whenever there are more accents above. + // # (of the accents used in Lithuanian: grave, acute, tilde above, and ogonek) + // # 0049; 0069 0307; 0049; 0049; lt More_Above; # LATIN CAPITAL LETTER I + // # 004A; 006A 0307; 004A; 004A; lt More_Above; # LATIN CAPITAL LETTER J + // # 012E; 012F 0307; 012E; 012E; lt More_Above; # LATIN CAPITAL LETTER I WITH OGONEK + // # 00CC; 0069 0307 0300; 00CC; 00CC; lt; # LATIN CAPITAL LETTER I WITH GRAVE + // # 00CD; 0069 0307 0301; 00CD; 00CD; lt; # LATIN CAPITAL LETTER I WITH ACUTE + // # 0128; 0069 0307 0303; 0128; 0128; lt; # LATIN CAPITAL LETTER I WITH TILDE + // ::NFD(); + // I } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0307; + // J } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → j \u0307; + // I \u0328 (Į) } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0328 \u0307; + // I \u0300 (Ì) → i \u0307 \u0300; + // I \u0301 (Í) → i \u0307 \u0301; + // I \u0303 (Ĩ) → i \u0307 \u0303; + // ::Any-Lower(); + // ::NFC(); + + i := 0 + if r := c.src[c.pSrc]; r < utf8.RuneSelf { + lower(c) + if r != 'I' && r != 'J' { + return true + } + } else { + p := norm.NFD.Properties(c.src[c.pSrc:]) + if d := p.Decomposition(); len(d) >= 3 && (d[0] == 'I' || d[0] == 'J') { + // UTF-8 optimization: the decomposition will only have an above + // modifier if the last rune of the decomposition is in [U+300-U+311]. + // In all other cases, a decomposition starting with I is always + // an I followed by modifiers that are not cased themselves. See A.2. + if d[1] == 0xCC && d[2] <= 0x91 { // A.2.4. + if !c.writeBytes(d[:1]) { + return false + } + c.dst[c.pDst-1] += 'a' - 'A' // lower + + // Assumption: modifier never changes on lowercase. See A.1. + // Assumption: all modifiers added have CCC = Above. See A.2.3. + return c.writeString("\u0307") && c.writeBytes(d[1:]) + } + // In all other cases the additional modifiers will have a CCC + // that is less than 230 (Above). We will insert the U+0307, if + // needed, after these modifiers so that a string in FCD form + // will remain so. See A.2.2. + lower(c) + i = 1 + } else { + return lower(c) + } + } + + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccZero: + c.unreadRune() + return true + case cccAbove: + return c.writeString("\u0307") && c.copy() // See A.1. + default: + c.copy() // See A.1. + } + } + return i == maxIgnorable +} + +// ltLowerSpan would be the same as isLower. + +func ltUpper(f mapFunc) mapFunc { + return func(c *context) bool { + // Unicode: + // 0307; 0307; ; ; lt After_Soft_Dotted; # COMBINING DOT ABOVE + // + // From CLDR: + // # Remove \u0307 following soft-dotteds (i, j, and the like), with possible + // # intervening non-230 marks. + // ::NFD(); + // [:Soft_Dotted:] [^[:ccc=Not_Reordered:][:ccc=Above:]]* { \u0307 → ; + // ::Any-Upper(); + // ::NFC(); + + // TODO: See A.5. A soft-dotted rune never has an exception. This would + // allow us to overload the exception bit and encode this property in + // info. Need to measure performance impact of this. + r, _ := utf8.DecodeRune(c.src[c.pSrc:]) + oldPDst := c.pDst + if !f(c) { + return false + } + if !unicode.Is(unicode.Soft_Dotted, r) { + return true + } + + // We don't need to do an NFD normalization, as a soft-dotted rune never + // contains U+0307. See A.3. + + i := 0 + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccZero: + c.unreadRune() + return true + case cccAbove: + if c.hasPrefix("\u0307") { + // We don't do a full NFC, but rather combine runes for + // some of the common cases. (Returning NFC or + // preserving normal form is neither a requirement nor + // a possibility anyway). + if !c.next() { + return false + } + if c.dst[oldPDst] == 'I' && c.pDst == oldPDst+1 && c.src[c.pSrc] == 0xcc { + s := "" + switch c.src[c.pSrc+1] { + case 0x80: // U+0300 COMBINING GRAVE ACCENT + s = "\u00cc" // U+00CC LATIN CAPITAL LETTER I WITH GRAVE + case 0x81: // U+0301 COMBINING ACUTE ACCENT + s = "\u00cd" // U+00CD LATIN CAPITAL LETTER I WITH ACUTE + case 0x83: // U+0303 COMBINING TILDE + s = "\u0128" // U+0128 LATIN CAPITAL LETTER I WITH TILDE + case 0x88: // U+0308 COMBINING DIAERESIS + s = "\u00cf" // U+00CF LATIN CAPITAL LETTER I WITH DIAERESIS + default: + } + if s != "" { + c.pDst = oldPDst + return c.writeString(s) + } + } + } + return c.copy() + default: + c.copy() + } + } + return i == maxIgnorable + } +} + +// TODO: implement ltUpperSpan (low priority: complex and infrequent). + +func aztrUpper(f mapFunc) mapFunc { + return func(c *context) bool { + // i→İ; + if c.src[c.pSrc] == 'i' { + return c.writeString("İ") + } + return f(c) + } +} + +func aztrLower(c *context) (done bool) { + // From CLDR: + // # I and i-dotless; I-dot and i are case pairs in Turkish and Azeri + // # 0130; 0069; 0130; 0130; tr; # LATIN CAPITAL LETTER I WITH DOT ABOVE + // İ→i; + // # When lowercasing, remove dot_above in the sequence I + dot_above, which will turn into i. + // # This matches the behavior of the canonically equivalent I-dot_above + // # 0307; ; 0307; 0307; tr After_I; # COMBINING DOT ABOVE + // # When lowercasing, unless an I is before a dot_above, it turns into a dotless i. + // # 0049; 0131; 0049; 0049; tr Not_Before_Dot; # LATIN CAPITAL LETTER I + // I([^[:ccc=Not_Reordered:][:ccc=Above:]]*)\u0307 → i$1 ; + // I→ı ; + // ::Any-Lower(); + if c.hasPrefix("\u0130") { // İ + return c.writeString("i") + } + if c.src[c.pSrc] != 'I' { + return lower(c) + } + + // We ignore the lower-case I for now, but insert it later when we know + // which form we need. + start := c.pSrc + c.sz + + i := 0 +Loop: + // We check for up to n ignorables before \u0307. As \u0307 is an + // ignorable as well, n is maxIgnorable-1. + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccAbove: + if c.hasPrefix("\u0307") { + return c.writeString("i") && c.writeBytes(c.src[start:c.pSrc]) // ignore U+0307 + } + done = true + break Loop + case cccZero: + c.unreadRune() + done = true + break Loop + default: + // We'll write this rune after we know which starter to use. + } + } + if i == maxIgnorable { + done = true + } + return c.writeString("ı") && c.writeBytes(c.src[start:c.pSrc+c.sz]) && done +} + +// aztrLowerSpan would be the same as isLower. + +func nlTitle(c *context) bool { + // From CLDR: + // # Special titlecasing for Dutch initial "ij". + // ::Any-Title(); + // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) + // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; + if c.src[c.pSrc] != 'I' && c.src[c.pSrc] != 'i' { + return title(c) + } + + if !c.writeString("I") || !c.next() { + return false + } + if c.src[c.pSrc] == 'j' || c.src[c.pSrc] == 'J' { + return c.writeString("J") + } + c.unreadRune() + return true +} + +func nlTitleSpan(c *context) bool { + // From CLDR: + // # Special titlecasing for Dutch initial "ij". + // ::Any-Title(); + // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) + // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; + if c.src[c.pSrc] != 'I' { + return isTitle(c) + } + if !c.next() || c.src[c.pSrc] == 'j' { + return false + } + if c.src[c.pSrc] != 'J' { + c.unreadRune() + } + return true +} + +// Not part of CLDR, but see http://unicode.org/cldr/trac/ticket/7078. +func afnlRewrite(c *context) { + if c.hasPrefix("'") || c.hasPrefix("’") { + c.isMidWord = true + } +} diff --git a/vendor/golang.org/x/text/cases/tables.go b/vendor/golang.org/x/text/cases/tables.go new file mode 100644 index 000000000..32ee8fadb --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables.go @@ -0,0 +1,2211 @@ +// This file was generated by go generate; DO NOT EDIT + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "9.0.0" + +var xorData string = "" + // Size: 185 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a\x00\x02:" + + "\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&\x00\x01*" + + "\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 1852 bytes + "\x00\x12\x10μΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x08I\x13\x18ʼnʼN\x11\x08sS" + + "\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj\x12\x12" + + "njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x18ǰJ̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10\x12DZDz" + + "\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x18Ȿ\x10\x18Ɀ\x10\x18Ɐ\x10\x18Ɑ\x10\x18Ɒ\x10" + + "\x18Ɜ\x10\x18Ɡ\x10\x18Ɥ\x10\x18Ɦ\x10\x18Ɪ\x10\x18Ɫ\x10\x18Ɬ\x10\x18Ɱ\x10" + + "\x18Ɽ\x10\x18Ʇ\x10\x18Ʝ\x10\x18Ʞ2\x10ιΙ\x160ΐΪ́\x160ΰΫ́\x12\x10σΣ" + + "\x12\x10βΒ\x12\x10θΘ\x12\x10φΦ\x12\x10πΠ\x12\x10κΚ\x12\x10ρΡ\x12\x10εΕ" + + "\x14$եւԵՒԵւ\x12\x10вВ\x12\x10дД\x12\x10оО\x12\x10сС\x12\x10тТ\x12\x10тТ" + + "\x12\x10ъЪ\x12\x10ѣѢ\x13\x18ꙋꙊ\x13\x18ẖH̱\x13\x18ẗT̈\x13\x18ẘW̊\x13" + + "\x18ẙY̊\x13\x18aʾAʾ\x13\x18ṡṠ\x12\x10ssß\x14 ὐΥ̓\x160ὒΥ̓̀\x160ὔΥ̓́" + + "\x160ὖΥ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" + + "\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" + + "\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" + + "\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" + + "Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" + + "\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" + + "\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" + + "\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" + + "ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14 ᾶΑ͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x10ι" + + "Ι\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14 ῆΗ͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ" + + "\x160ῒΪ̀\x160ΐΪ́\x14 ῖΙ͂\x160ῗΪ͂\x160ῢΫ̀\x160ΰΫ́\x14 ῤΡ" + + "̓\x14 ῦΥ͂\x160ῧΫ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ\x14 ῶΩ͂\x166ῶιΩ" + + "͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ" + + "\x10\x10Ⱥ\x10\x10Ⱦ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12" + + "\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12" + + "\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFFFf\x12\x12fiFIFi\x12\x12flFLFl\x13" + + "\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12stSTSt\x12\x12stSTSt\x14$մնՄՆՄն" + + "\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄխ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 11742 bytes (11.47 KiB). Checksum: 147a11466b427436. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 18: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 18 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 20 blocks, 1280 entries, 2560 bytes +// The third block is the zero block. +var caseValues = [1280]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x04cb, 0x105: 0x05c9, + 0x106: 0x06ca, 0x107: 0x078b, 0x108: 0x0889, 0x109: 0x098a, 0x10a: 0x0a4b, 0x10b: 0x0b49, + 0x10c: 0x0c4a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x0d0a, 0x131: 0x0e0b, 0x132: 0x0f09, 0x133: 0x100a, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x136a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x140a, 0x151: 0x14aa, + 0x152: 0x154a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x15ea, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x168a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x172a, 0x166: 0x17ca, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x186a, 0x16b: 0x190a, 0x16c: 0x19aa, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x1a4a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x1aea, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x1b8a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x1c2a, + 0x19e: 0x1cca, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x1d6d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x1e2a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x1fea, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x21aa, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x226a, 0x251: 0x232a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x23ea, 0x256: 0x24aa, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x256a, 0x271: 0x262a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x26ea, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x0812, 0x281: 0x0812, 0x282: 0x0812, 0x283: 0x0812, 0x284: 0x0812, 0x285: 0x0812, + 0x288: 0x0813, 0x289: 0x0813, 0x28a: 0x0813, 0x28b: 0x0813, + 0x28c: 0x0813, 0x28d: 0x0813, 0x290: 0x372a, 0x291: 0x0812, + 0x292: 0x386a, 0x293: 0x0812, 0x294: 0x3a2a, 0x295: 0x0812, 0x296: 0x3bea, 0x297: 0x0812, + 0x299: 0x0813, 0x29b: 0x0813, 0x29d: 0x0813, + 0x29f: 0x0813, 0x2a0: 0x0812, 0x2a1: 0x0812, 0x2a2: 0x0812, 0x2a3: 0x0812, + 0x2a4: 0x0812, 0x2a5: 0x0812, 0x2a6: 0x0812, 0x2a7: 0x0812, 0x2a8: 0x0813, 0x2a9: 0x0813, + 0x2aa: 0x0813, 0x2ab: 0x0813, 0x2ac: 0x0813, 0x2ad: 0x0813, 0x2ae: 0x0813, 0x2af: 0x0813, + 0x2b0: 0x8b52, 0x2b1: 0x8b52, 0x2b2: 0x8e52, 0x2b3: 0x8e52, 0x2b4: 0x9152, 0x2b5: 0x9152, + 0x2b6: 0x9452, 0x2b7: 0x9452, 0x2b8: 0x9752, 0x2b9: 0x9752, 0x2ba: 0x9a52, 0x2bb: 0x9a52, + 0x2bc: 0x4d52, 0x2bd: 0x4d52, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x3daa, 0x2c1: 0x3f8a, 0x2c2: 0x416a, 0x2c3: 0x434a, 0x2c4: 0x452a, 0x2c5: 0x470a, + 0x2c6: 0x48ea, 0x2c7: 0x4aca, 0x2c8: 0x4ca9, 0x2c9: 0x4e89, 0x2ca: 0x5069, 0x2cb: 0x5249, + 0x2cc: 0x5429, 0x2cd: 0x5609, 0x2ce: 0x57e9, 0x2cf: 0x59c9, 0x2d0: 0x5baa, 0x2d1: 0x5d8a, + 0x2d2: 0x5f6a, 0x2d3: 0x614a, 0x2d4: 0x632a, 0x2d5: 0x650a, 0x2d6: 0x66ea, 0x2d7: 0x68ca, + 0x2d8: 0x6aa9, 0x2d9: 0x6c89, 0x2da: 0x6e69, 0x2db: 0x7049, 0x2dc: 0x7229, 0x2dd: 0x7409, + 0x2de: 0x75e9, 0x2df: 0x77c9, 0x2e0: 0x79aa, 0x2e1: 0x7b8a, 0x2e2: 0x7d6a, 0x2e3: 0x7f4a, + 0x2e4: 0x812a, 0x2e5: 0x830a, 0x2e6: 0x84ea, 0x2e7: 0x86ca, 0x2e8: 0x88a9, 0x2e9: 0x8a89, + 0x2ea: 0x8c69, 0x2eb: 0x8e49, 0x2ec: 0x9029, 0x2ed: 0x9209, 0x2ee: 0x93e9, 0x2ef: 0x95c9, + 0x2f0: 0x0812, 0x2f1: 0x0812, 0x2f2: 0x97aa, 0x2f3: 0x99ca, 0x2f4: 0x9b6a, + 0x2f6: 0x9d2a, 0x2f7: 0x9e6a, 0x2f8: 0x0813, 0x2f9: 0x0813, 0x2fa: 0x8b53, 0x2fb: 0x8b53, + 0x2fc: 0xa0e9, 0x2fd: 0x0004, 0x2fe: 0xa28a, 0x2ff: 0x0004, + // Block 0xc, offset 0x300 + 0x300: 0x0004, 0x301: 0x0004, 0x302: 0xa34a, 0x303: 0xa56a, 0x304: 0xa70a, + 0x306: 0xa8ca, 0x307: 0xaa0a, 0x308: 0x8e53, 0x309: 0x8e53, 0x30a: 0x9153, 0x30b: 0x9153, + 0x30c: 0xac89, 0x30d: 0x0004, 0x30e: 0x0004, 0x30f: 0x0004, 0x310: 0x0812, 0x311: 0x0812, + 0x312: 0xae2a, 0x313: 0xafea, 0x316: 0xb1aa, 0x317: 0xb2ea, + 0x318: 0x0813, 0x319: 0x0813, 0x31a: 0x9453, 0x31b: 0x9453, 0x31d: 0x0004, + 0x31e: 0x0004, 0x31f: 0x0004, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0xb4aa, 0x323: 0xb66a, + 0x324: 0xb82a, 0x325: 0x0912, 0x326: 0xb96a, 0x327: 0xbaaa, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x9a53, 0x32b: 0x9a53, 0x32c: 0x0913, 0x32d: 0x0004, 0x32e: 0x0004, 0x32f: 0x0004, + 0x332: 0xbc6a, 0x333: 0xbe8a, 0x334: 0xc02a, + 0x336: 0xc1ea, 0x337: 0xc32a, 0x338: 0x9753, 0x339: 0x9753, 0x33a: 0x4d53, 0x33b: 0x4d53, + 0x33c: 0xc5a9, 0x33d: 0x0004, 0x33e: 0x0004, + // Block 0xd, offset 0x340 + 0x342: 0x0013, + 0x347: 0x0013, 0x34a: 0x0012, 0x34b: 0x0013, + 0x34c: 0x0013, 0x34d: 0x0013, 0x34e: 0x0012, 0x34f: 0x0012, 0x350: 0x0013, 0x351: 0x0013, + 0x352: 0x0013, 0x353: 0x0012, 0x355: 0x0013, + 0x359: 0x0013, 0x35a: 0x0013, 0x35b: 0x0013, 0x35c: 0x0013, 0x35d: 0x0013, + 0x364: 0x0013, 0x366: 0xc74b, 0x368: 0x0013, + 0x36a: 0xc80b, 0x36b: 0xc88b, 0x36c: 0x0013, 0x36d: 0x0013, 0x36f: 0x0012, + 0x370: 0x0013, 0x371: 0x0013, 0x372: 0x9d53, 0x373: 0x0013, 0x374: 0x0012, 0x375: 0x0010, + 0x376: 0x0010, 0x377: 0x0010, 0x378: 0x0010, 0x379: 0x0012, + 0x37c: 0x0012, 0x37d: 0x0012, 0x37e: 0x0013, 0x37f: 0x0013, + // Block 0xe, offset 0x380 + 0x380: 0x1a13, 0x381: 0x1a13, 0x382: 0x1e13, 0x383: 0x1e13, 0x384: 0x1a13, 0x385: 0x1a13, + 0x386: 0x2613, 0x387: 0x2613, 0x388: 0x2a13, 0x389: 0x2a13, 0x38a: 0x2e13, 0x38b: 0x2e13, + 0x38c: 0x2a13, 0x38d: 0x2a13, 0x38e: 0x2613, 0x38f: 0x2613, 0x390: 0xa052, 0x391: 0xa052, + 0x392: 0xa352, 0x393: 0xa352, 0x394: 0xa652, 0x395: 0xa652, 0x396: 0xa352, 0x397: 0xa352, + 0x398: 0xa052, 0x399: 0xa052, 0x39a: 0x1a12, 0x39b: 0x1a12, 0x39c: 0x1e12, 0x39d: 0x1e12, + 0x39e: 0x1a12, 0x39f: 0x1a12, 0x3a0: 0x2612, 0x3a1: 0x2612, 0x3a2: 0x2a12, 0x3a3: 0x2a12, + 0x3a4: 0x2e12, 0x3a5: 0x2e12, 0x3a6: 0x2a12, 0x3a7: 0x2a12, 0x3a8: 0x2612, 0x3a9: 0x2612, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x6552, 0x3c1: 0x6552, 0x3c2: 0x6552, 0x3c3: 0x6552, 0x3c4: 0x6552, 0x3c5: 0x6552, + 0x3c6: 0x6552, 0x3c7: 0x6552, 0x3c8: 0x6552, 0x3c9: 0x6552, 0x3ca: 0x6552, 0x3cb: 0x6552, + 0x3cc: 0x6552, 0x3cd: 0x6552, 0x3ce: 0x6552, 0x3cf: 0x6552, 0x3d0: 0xa952, 0x3d1: 0xa952, + 0x3d2: 0xa952, 0x3d3: 0xa952, 0x3d4: 0xa952, 0x3d5: 0xa952, 0x3d6: 0xa952, 0x3d7: 0xa952, + 0x3d8: 0xa952, 0x3d9: 0xa952, 0x3da: 0xa952, 0x3db: 0xa952, 0x3dc: 0xa952, 0x3dd: 0xa952, + 0x3de: 0xa952, 0x3e0: 0x0113, 0x3e1: 0x0112, 0x3e2: 0xc94b, 0x3e3: 0x8853, + 0x3e4: 0xca0b, 0x3e5: 0xcaca, 0x3e6: 0xcb4a, 0x3e7: 0x0f13, 0x3e8: 0x0f12, 0x3e9: 0x0313, + 0x3ea: 0x0312, 0x3eb: 0x0713, 0x3ec: 0x0712, 0x3ed: 0xcbcb, 0x3ee: 0xcc8b, 0x3ef: 0xcd4b, + 0x3f0: 0xce0b, 0x3f1: 0x0012, 0x3f2: 0x0113, 0x3f3: 0x0112, 0x3f4: 0x0012, 0x3f5: 0x0313, + 0x3f6: 0x0312, 0x3f7: 0x0012, 0x3f8: 0x0012, 0x3f9: 0x0012, 0x3fa: 0x0012, 0x3fb: 0x0012, + 0x3fc: 0x0015, 0x3fd: 0x0015, 0x3fe: 0xcecb, 0x3ff: 0xcf8b, + // Block 0x10, offset 0x400 + 0x400: 0x0113, 0x401: 0x0112, 0x402: 0x0113, 0x403: 0x0112, 0x404: 0x0113, 0x405: 0x0112, + 0x406: 0x0113, 0x407: 0x0112, 0x408: 0x0014, 0x409: 0x0004, 0x40a: 0x0004, 0x40b: 0x0713, + 0x40c: 0x0712, 0x40d: 0xd04b, 0x40e: 0x0012, 0x40f: 0x0010, 0x410: 0x0113, 0x411: 0x0112, + 0x412: 0x0113, 0x413: 0x0112, 0x414: 0x0012, 0x415: 0x0012, 0x416: 0x0113, 0x417: 0x0112, + 0x418: 0x0113, 0x419: 0x0112, 0x41a: 0x0113, 0x41b: 0x0112, 0x41c: 0x0113, 0x41d: 0x0112, + 0x41e: 0x0113, 0x41f: 0x0112, 0x420: 0x0113, 0x421: 0x0112, 0x422: 0x0113, 0x423: 0x0112, + 0x424: 0x0113, 0x425: 0x0112, 0x426: 0x0113, 0x427: 0x0112, 0x428: 0x0113, 0x429: 0x0112, + 0x42a: 0xd10b, 0x42b: 0xd1cb, 0x42c: 0xd28b, 0x42d: 0xd34b, 0x42e: 0xd40b, + 0x430: 0xd4cb, 0x431: 0xd58b, 0x432: 0xd64b, 0x433: 0xac53, 0x434: 0x0113, 0x435: 0x0112, + 0x436: 0x0113, 0x437: 0x0112, + // Block 0x11, offset 0x440 + 0x440: 0xd70a, 0x441: 0xd80a, 0x442: 0xd90a, 0x443: 0xda0a, 0x444: 0xdb6a, 0x445: 0xdcca, + 0x446: 0xddca, + 0x453: 0xdeca, 0x454: 0xe08a, 0x455: 0xe24a, 0x456: 0xe40a, 0x457: 0xe5ca, + 0x45d: 0x0010, + 0x45e: 0x0034, 0x45f: 0x0010, 0x460: 0x0010, 0x461: 0x0010, 0x462: 0x0010, 0x463: 0x0010, + 0x464: 0x0010, 0x465: 0x0010, 0x466: 0x0010, 0x467: 0x0010, 0x468: 0x0010, + 0x46a: 0x0010, 0x46b: 0x0010, 0x46c: 0x0010, 0x46d: 0x0010, 0x46e: 0x0010, 0x46f: 0x0010, + 0x470: 0x0010, 0x471: 0x0010, 0x472: 0x0010, 0x473: 0x0010, 0x474: 0x0010, 0x475: 0x0010, + 0x476: 0x0010, 0x478: 0x0010, 0x479: 0x0010, 0x47a: 0x0010, 0x47b: 0x0010, + 0x47c: 0x0010, 0x47e: 0x0010, + // Block 0x12, offset 0x480 + 0x480: 0x2213, 0x481: 0x2213, 0x482: 0x2613, 0x483: 0x2613, 0x484: 0x2213, 0x485: 0x2213, + 0x486: 0x2e13, 0x487: 0x2e13, 0x488: 0x2213, 0x489: 0x2213, 0x48a: 0x2613, 0x48b: 0x2613, + 0x48c: 0x2213, 0x48d: 0x2213, 0x48e: 0x3e13, 0x48f: 0x3e13, 0x490: 0x2213, 0x491: 0x2213, + 0x492: 0x2613, 0x493: 0x2613, 0x494: 0x2213, 0x495: 0x2213, 0x496: 0x2e13, 0x497: 0x2e13, + 0x498: 0x2213, 0x499: 0x2213, 0x49a: 0x2613, 0x49b: 0x2613, 0x49c: 0x2213, 0x49d: 0x2213, + 0x49e: 0xb553, 0x49f: 0xb553, 0x4a0: 0xb853, 0x4a1: 0xb853, 0x4a2: 0x2212, 0x4a3: 0x2212, + 0x4a4: 0x2612, 0x4a5: 0x2612, 0x4a6: 0x2212, 0x4a7: 0x2212, 0x4a8: 0x2e12, 0x4a9: 0x2e12, + 0x4aa: 0x2212, 0x4ab: 0x2212, 0x4ac: 0x2612, 0x4ad: 0x2612, 0x4ae: 0x2212, 0x4af: 0x2212, + 0x4b0: 0x3e12, 0x4b1: 0x3e12, 0x4b2: 0x2212, 0x4b3: 0x2212, 0x4b4: 0x2612, 0x4b5: 0x2612, + 0x4b6: 0x2212, 0x4b7: 0x2212, 0x4b8: 0x2e12, 0x4b9: 0x2e12, 0x4ba: 0x2212, 0x4bb: 0x2212, + 0x4bc: 0x2612, 0x4bd: 0x2612, 0x4be: 0x2212, 0x4bf: 0x2212, + // Block 0x13, offset 0x4c0 + 0x4c2: 0x0010, + 0x4c7: 0x0010, 0x4c9: 0x0010, 0x4cb: 0x0010, + 0x4cd: 0x0010, 0x4ce: 0x0010, 0x4cf: 0x0010, 0x4d1: 0x0010, + 0x4d2: 0x0010, 0x4d4: 0x0010, 0x4d7: 0x0010, + 0x4d9: 0x0010, 0x4db: 0x0010, 0x4dd: 0x0010, + 0x4df: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, + 0x4e4: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, 0x4e9: 0x0010, + 0x4ea: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f7: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x12, 0xc3: 0x13, 0xc4: 0x14, 0xc5: 0x15, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x16, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x17, 0xcc: 0x18, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x19, 0xd1: 0x1a, 0xd2: 0x1b, 0xd3: 0x1c, 0xd4: 0x1d, 0xd5: 0x1e, 0xd6: 0x1f, 0xd7: 0x20, + 0xd8: 0x21, 0xd9: 0x22, 0xda: 0x23, 0xdb: 0x24, 0xdc: 0x25, 0xdd: 0x26, 0xde: 0x27, 0xdf: 0x28, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x29, 0x121: 0x2a, 0x122: 0x2b, 0x123: 0x2c, 0x124: 0x2d, 0x125: 0x2e, 0x126: 0x2f, 0x127: 0x30, + 0x128: 0x31, 0x129: 0x32, 0x12a: 0x33, 0x12b: 0x34, 0x12c: 0x35, 0x12d: 0x36, 0x12e: 0x37, 0x12f: 0x38, + 0x130: 0x39, 0x131: 0x3a, 0x132: 0x3b, 0x133: 0x3c, 0x134: 0x3d, 0x135: 0x3e, 0x136: 0x3f, 0x137: 0x40, + 0x138: 0x41, 0x139: 0x42, 0x13a: 0x43, 0x13b: 0x44, 0x13c: 0x45, 0x13d: 0x46, 0x13e: 0x47, 0x13f: 0x48, + // Block 0x5, offset 0x140 + 0x140: 0x49, 0x141: 0x4a, 0x142: 0x4b, 0x143: 0x4c, 0x144: 0x23, 0x145: 0x23, 0x146: 0x23, 0x147: 0x23, + 0x148: 0x23, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x23, 0x152: 0x23, 0x153: 0x23, 0x154: 0x23, 0x155: 0x23, 0x156: 0x23, 0x157: 0x23, + 0x158: 0x23, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x08, 0x17e: 0x09, 0x17f: 0x0a, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0b, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0c, + 0x1b0: 0x7c, 0x1b1: 0x0d, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x23, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x23, 0x202: 0x23, 0x203: 0x23, 0x204: 0x23, 0x205: 0x23, 0x206: 0x23, 0x207: 0x23, + 0x208: 0x23, 0x209: 0x23, 0x20a: 0x23, 0x20b: 0x23, 0x20c: 0x23, 0x20d: 0x23, 0x20e: 0x23, 0x20f: 0x23, + 0x210: 0x23, 0x211: 0x23, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x23, 0x215: 0x23, 0x216: 0x23, 0x217: 0x23, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x0e, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x23, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x23, 0x231: 0x23, 0x232: 0x23, 0x233: 0x23, 0x234: 0x23, 0x235: 0x23, 0x236: 0x23, 0x237: 0x23, + 0x238: 0x23, 0x239: 0x23, 0x23a: 0x23, 0x23b: 0x23, 0x23c: 0x23, 0x23d: 0x23, 0x23e: 0x23, 0x23f: 0x23, + // Block 0x9, offset 0x240 + 0x240: 0x23, 0x241: 0x23, 0x242: 0x23, 0x243: 0x23, 0x244: 0x23, 0x245: 0x23, 0x246: 0x23, 0x247: 0x23, + 0x248: 0x23, 0x249: 0x23, 0x24a: 0x23, 0x24b: 0x23, 0x24c: 0x23, 0x24d: 0x23, 0x24e: 0x23, 0x24f: 0x23, + 0x250: 0x23, 0x251: 0x23, 0x252: 0x23, 0x253: 0x23, 0x254: 0x23, 0x255: 0x23, 0x256: 0x23, 0x257: 0x23, + 0x258: 0x23, 0x259: 0x23, 0x25a: 0x23, 0x25b: 0x23, 0x25c: 0x23, 0x25d: 0x23, 0x25e: 0x23, 0x25f: 0x23, + 0x260: 0x23, 0x261: 0x23, 0x262: 0x23, 0x263: 0x23, 0x264: 0x23, 0x265: 0x23, 0x266: 0x23, 0x267: 0x23, + 0x268: 0x23, 0x269: 0x23, 0x26a: 0x23, 0x26b: 0x23, 0x26c: 0x23, 0x26d: 0x23, 0x26e: 0x23, 0x26f: 0x23, + 0x270: 0x23, 0x271: 0x23, 0x272: 0x23, 0x273: 0x23, 0x274: 0x23, 0x275: 0x23, 0x276: 0x23, 0x277: 0x23, + 0x278: 0x23, 0x279: 0x23, 0x27a: 0x23, 0x27b: 0x23, 0x27c: 0x23, 0x27d: 0x23, 0x27e: 0x23, 0x27f: 0x23, + // Block 0xa, offset 0x280 + 0x280: 0x23, 0x281: 0x23, 0x282: 0x23, 0x283: 0x23, 0x284: 0x23, 0x285: 0x23, 0x286: 0x23, 0x287: 0x23, + 0x288: 0x23, 0x289: 0x23, 0x28a: 0x23, 0x28b: 0x23, 0x28c: 0x23, 0x28d: 0x23, 0x28e: 0x23, 0x28f: 0x23, + 0x290: 0x23, 0x291: 0x23, 0x292: 0x23, 0x293: 0x23, 0x294: 0x23, 0x295: 0x23, 0x296: 0x23, 0x297: 0x23, + 0x298: 0x23, 0x299: 0x23, 0x29a: 0x23, 0x29b: 0x23, 0x29c: 0x23, 0x29d: 0x23, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x0f, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x23, 0x2f1: 0x23, 0x2f2: 0x23, 0x2f3: 0x23, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x23, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x23, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x23, 0x319: 0x23, 0x31a: 0x23, 0x31b: 0x23, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x23, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, + // Block 0xd, offset 0x340 + 0x340: 0xd3, 0x341: 0xd4, 0x342: 0xd5, 0x343: 0xd6, 0x344: 0xd7, 0x345: 0xd8, 0x346: 0xd9, 0x347: 0xda, + 0x348: 0xdb, 0x34a: 0xdc, 0x34b: 0xdd, 0x34c: 0xde, 0x34d: 0xdf, + 0x350: 0xe0, 0x351: 0xe1, 0x352: 0xe2, 0x353: 0xe3, 0x356: 0xe4, 0x357: 0xe5, + 0x358: 0xe6, 0x359: 0xe7, 0x35a: 0xe8, 0x35b: 0xe9, 0x35c: 0xea, + 0x362: 0xeb, 0x363: 0xec, + 0x36b: 0xed, + 0x370: 0xee, 0x371: 0xef, 0x372: 0xf0, + // Block 0xe, offset 0x380 + 0x380: 0x23, 0x381: 0x23, 0x382: 0x23, 0x383: 0x23, 0x384: 0x23, 0x385: 0x23, 0x386: 0x23, 0x387: 0x23, + 0x388: 0x23, 0x389: 0x23, 0x38a: 0x23, 0x38b: 0x23, 0x38c: 0x23, 0x38d: 0x23, 0x38e: 0xf1, + 0x390: 0x23, 0x391: 0xf2, 0x392: 0x23, 0x393: 0x23, 0x394: 0x23, 0x395: 0xf3, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x23, 0x3c1: 0x23, 0x3c2: 0x23, 0x3c3: 0x23, 0x3c4: 0x23, 0x3c5: 0x23, 0x3c6: 0x23, 0x3c7: 0x23, + 0x3c8: 0x23, 0x3c9: 0x23, 0x3ca: 0x23, 0x3cb: 0x23, 0x3cc: 0x23, 0x3cd: 0x23, 0x3ce: 0x23, 0x3cf: 0x23, + 0x3d0: 0xf2, + // Block 0x10, offset 0x400 + 0x410: 0x23, 0x411: 0x23, 0x412: 0x23, 0x413: 0x23, 0x414: 0x23, 0x415: 0x23, 0x416: 0x23, 0x417: 0x23, + 0x418: 0x23, 0x419: 0xf4, + // Block 0x11, offset 0x440 + 0x460: 0x23, 0x461: 0x23, 0x462: 0x23, 0x463: 0x23, 0x464: 0x23, 0x465: 0x23, 0x466: 0x23, 0x467: 0x23, + 0x468: 0xed, 0x469: 0xf5, 0x46b: 0xf6, 0x46c: 0xf7, 0x46d: 0xf8, 0x46e: 0xf9, + 0x47c: 0x23, 0x47d: 0xfa, 0x47e: 0xfb, 0x47f: 0xfc, + // Block 0x12, offset 0x480 + 0x4b0: 0x23, 0x4b1: 0xfd, 0x4b2: 0xfe, + // Block 0x13, offset 0x4c0 + 0x4c5: 0xff, 0x4c6: 0x100, + 0x4c9: 0x101, + 0x4d0: 0x102, 0x4d1: 0x103, 0x4d2: 0x104, 0x4d3: 0x105, 0x4d4: 0x106, 0x4d5: 0x107, 0x4d6: 0x108, 0x4d7: 0x109, + 0x4d8: 0x10a, 0x4d9: 0x10b, 0x4da: 0x10c, 0x4db: 0x10d, 0x4dc: 0x10e, 0x4dd: 0x10f, 0x4de: 0x110, 0x4df: 0x111, + 0x4e8: 0x112, 0x4e9: 0x113, 0x4ea: 0x114, + // Block 0x14, offset 0x500 + 0x500: 0x115, + 0x520: 0x23, 0x521: 0x23, 0x522: 0x23, 0x523: 0x116, 0x524: 0x10, 0x525: 0x117, + 0x538: 0x118, 0x539: 0x11, 0x53a: 0x119, + // Block 0x15, offset 0x540 + 0x544: 0x11a, 0x545: 0x11b, 0x546: 0x11c, + 0x54f: 0x11d, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x11e, 0x5c1: 0x11f, 0x5c4: 0x11f, 0x5c5: 0x11f, 0x5c6: 0x11f, 0x5c7: 0x120, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 272 entries, 544 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x3a, 0x3d, 0x41, 0x44, 0x48, 0x52, 0x54, 0x59, 0x69, 0x70, 0x75, 0x83, 0x84, 0x92, 0xa1, 0xab, 0xae, 0xb4, 0xbc, 0xbe, 0xc0, 0xce, 0xd4, 0xe2, 0xed, 0xf8, 0x103, 0x10f, 0x119, 0x124, 0x12f, 0x13b, 0x147, 0x14f, 0x157, 0x161, 0x16c, 0x178, 0x17e, 0x189, 0x18e, 0x196, 0x199, 0x19e, 0x1a2, 0x1a6, 0x1ad, 0x1b6, 0x1be, 0x1bf, 0x1c8, 0x1cf, 0x1d7, 0x1dd, 0x1e3, 0x1e8, 0x1ec, 0x1ef, 0x1f1, 0x1f4, 0x1f9, 0x1fa, 0x1fc, 0x1fe, 0x200, 0x207, 0x20c, 0x210, 0x219, 0x21c, 0x21f, 0x225, 0x226, 0x231, 0x232, 0x233, 0x238, 0x245, 0x24d, 0x255, 0x25e, 0x267, 0x270, 0x275, 0x278, 0x281, 0x28e, 0x290, 0x297, 0x299, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x327, 0x32e, 0x332, 0x33b, 0x33c, 0x344, 0x348, 0x34d, 0x355, 0x35b, 0x361, 0x36b, 0x370, 0x379, 0x37f, 0x386, 0x38a, 0x392, 0x394, 0x396, 0x399, 0x39b, 0x39d, 0x39e, 0x39f, 0x3a1, 0x3a3, 0x3a9, 0x3ae, 0x3b0, 0x3b6, 0x3b9, 0x3bb, 0x3c1, 0x3c6, 0x3c8, 0x3c9, 0x3ca, 0x3cb, 0x3cd, 0x3cf, 0x3d1, 0x3d4, 0x3d6, 0x3d9, 0x3e1, 0x3e4, 0x3e8, 0x3f0, 0x3f2, 0x3f3, 0x3f4, 0x3f6, 0x3fc, 0x3fe, 0x3ff, 0x401, 0x403, 0x405, 0x412, 0x413, 0x414, 0x418, 0x41a, 0x41b, 0x41c, 0x41d, 0x41e, 0x422, 0x426, 0x42c, 0x42e, 0x435, 0x438, 0x43c, 0x442, 0x44b, 0x451, 0x457, 0x461, 0x46b, 0x46d, 0x474, 0x47a, 0x480, 0x486, 0x489, 0x48f, 0x492, 0x49a, 0x49b, 0x4a2, 0x4a3, 0x4a6, 0x4a7, 0x4ad, 0x4b0, 0x4b8, 0x4b9, 0x4ba, 0x4bb, 0x4bc, 0x4be, 0x4c0, 0x4c2, 0x4c6, 0x4c7, 0x4c9, 0x4ca, 0x4cb, 0x4cd, 0x4d2, 0x4d7, 0x4db, 0x4dc, 0x4df, 0x4e3, 0x4ee, 0x4f2, 0x4fa, 0x4ff, 0x503, 0x506, 0x50a, 0x50d, 0x510, 0x515, 0x519, 0x51d, 0x521, 0x525, 0x527, 0x529, 0x52c, 0x531, 0x533, 0x538, 0x541, 0x546, 0x547, 0x54a, 0x54b, 0x54c, 0x54e, 0x54f, 0x550} + +// sparseValues: 1360 entries, 5440 bytes +var sparseValues = [1360]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x002a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x00ea, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x01eb, lo: 0xb0, hi: 0xb0}, + {value: 0x02ea, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x034a, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x044a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x10cb, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x11cb, lo: 0xbe, hi: 0xbe}, + {value: 0x12ca, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0004, lo: 0x82, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x91}, + {value: 0x0004, lo: 0x92, hi: 0x96}, + {value: 0x0054, lo: 0x97, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xac}, + {value: 0x0004, lo: 0xad, hi: 0xad}, + {value: 0x0014, lo: 0xae, hi: 0xae}, + {value: 0x0004, lo: 0xaf, hi: 0xbf}, + // Block 0x6, offset 0x3a + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x3d + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x41 + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x44 + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x48 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x52 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x54 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x59 + {value: 0x6852, lo: 0x80, hi: 0x86}, + {value: 0x27aa, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0024, lo: 0x92, hi: 0x95}, + {value: 0x0034, lo: 0x96, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x99}, + {value: 0x0034, lo: 0x9a, hi: 0x9b}, + {value: 0x0024, lo: 0x9c, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa7}, + {value: 0x0024, lo: 0xa8, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xbd}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe, offset 0x69 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xf, offset 0x70 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x10, offset 0x75 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x11, offset 0x83 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x12, offset 0x84 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x92 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x14, offset 0xa1 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x15, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x16, offset 0xae + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + // Block 0x17, offset 0xb4 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x18, offset 0xbc + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + // Block 0x19, offset 0xbe + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x1a, offset 0xc0 + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1b, offset 0xce + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1c, offset 0xd4 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1d, offset 0xe2 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1e, offset 0xed + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + // Block 0x1f, offset 0xf8 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x20, offset 0x103 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x21, offset 0x10f + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x22, offset 0x119 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + // Block 0x23, offset 0x124 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x24, offset 0x12f + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x26, offset 0x147 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x27, offset 0x14f + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x28, offset 0x157 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x29, offset 0x161 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x2a, offset 0x16c + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2b, offset 0x178 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2c, offset 0x17e + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2d, offset 0x189 + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2e, offset 0x18e + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2f, offset 0x196 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x30, offset 0x199 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x31, offset 0x19e + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xb9}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x32, offset 0x1a2 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x33, offset 0x1a6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x34, offset 0x1ad + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x35, offset 0x1b6 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x36, offset 0x1be + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x37, offset 0x1bf + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x38, offset 0x1c8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x39, offset 0x1cf + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d7 + {value: 0x7053, lo: 0x80, hi: 0x85}, + {value: 0x7053, lo: 0x87, hi: 0x87}, + {value: 0x7053, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x3b, offset 0x1dd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3c, offset 0x1e3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3d, offset 0x1e8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3e, offset 0x1ec + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3f, offset 0x1ef + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x40, offset 0x1f1 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x41, offset 0x1f4 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x42, offset 0x1f9 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x43, offset 0x1fa + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x44, offset 0x1fc + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x45, offset 0x1fe + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x46, offset 0x200 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x47, offset 0x207 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x48, offset 0x20c + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x49, offset 0x210 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x4a, offset 0x219 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x4b, offset 0x21c + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb7}, + // Block 0x4c, offset 0x21f + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4d, offset 0x225 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4e, offset 0x226 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4f, offset 0x231 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x50, offset 0x232 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x51, offset 0x233 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x52, offset 0x238 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x53, offset 0x245 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x54, offset 0x24d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x55, offset 0x255 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x56, offset 0x25e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x57, offset 0x267 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x58, offset 0x270 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x59, offset 0x275 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x5a, offset 0x278 + {value: 0x296a, lo: 0x80, hi: 0x80}, + {value: 0x2a2a, lo: 0x81, hi: 0x81}, + {value: 0x2aea, lo: 0x82, hi: 0x82}, + {value: 0x2baa, lo: 0x83, hi: 0x83}, + {value: 0x2c6a, lo: 0x84, hi: 0x84}, + {value: 0x2d2a, lo: 0x85, hi: 0x85}, + {value: 0x2dea, lo: 0x86, hi: 0x86}, + {value: 0x2eaa, lo: 0x87, hi: 0x87}, + {value: 0x2f6a, lo: 0x88, hi: 0x88}, + // Block 0x5b, offset 0x281 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + // Block 0x5c, offset 0x28e + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5d, offset 0x290 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8452, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8852, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5e, offset 0x297 + {value: 0x0012, lo: 0x80, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5f, offset 0x299 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x60, offset 0x2a4 + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x61, offset 0x2a5 + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x306a, lo: 0x96, hi: 0x96}, + {value: 0x316a, lo: 0x97, hi: 0x97}, + {value: 0x326a, lo: 0x98, hi: 0x98}, + {value: 0x336a, lo: 0x99, hi: 0x99}, + {value: 0x346a, lo: 0x9a, hi: 0x9a}, + {value: 0x356a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x366b, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x62, offset 0x2b0 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x63, offset 0x2b8 + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x2c0 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x65, offset 0x2c6 + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x66, offset 0x2c7 + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x67, offset 0x2d5 + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0x9d52, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x68, offset 0x2da + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x69, offset 0x2dd + {value: 0xa053, lo: 0xb6, hi: 0xb7}, + {value: 0xa353, lo: 0xb8, hi: 0xb9}, + {value: 0xa653, lo: 0xba, hi: 0xbb}, + {value: 0xa353, lo: 0xbc, hi: 0xbd}, + {value: 0xa053, lo: 0xbe, hi: 0xbf}, + // Block 0x6a, offset 0x2e2 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xa953, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e6 + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6c, offset 0x2ec + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6d, offset 0x2f1 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6e, offset 0x2f4 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6f, offset 0x2f9 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x70, offset 0x2fe + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x71, offset 0x2ff + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x72, offset 0x305 + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x73, offset 0x307 + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x74, offset 0x308 + {value: 0x0010, lo: 0x85, hi: 0xad}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x75, offset 0x30a + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x76, offset 0x30c + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x77, offset 0x30f + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x78, offset 0x310 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x79, offset 0x312 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x7a, offset 0x315 + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x31b + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7c, offset 0x31f + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7d, offset 0x321 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0x9f}, + {value: 0x0004, lo: 0xa0, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7e, offset 0x327 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8453, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7f, offset 0x32e + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x80, offset 0x332 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x81, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x82, offset 0x33c + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x83, offset 0x344 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x84, offset 0x348 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x85, offset 0x34d + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x86, offset 0x355 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x87, offset 0x35b + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x88, offset 0x361 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x89, offset 0x36b + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x8a, offset 0x370 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x8b, offset 0x379 + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x37f + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xac52, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa5}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8d, offset 0x386 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x38a + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8f, offset 0x392 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x90, offset 0x394 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x91, offset 0x396 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x92, offset 0x399 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x93, offset 0x39b + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x94, offset 0x39d + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x95, offset 0x39e + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x96, offset 0x39f + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x97, offset 0x3a1 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x98, offset 0x3a3 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x99, offset 0x3a9 + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x9a, offset 0x3ae + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x3b0 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9c, offset 0x3b6 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9d, offset 0x3b9 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9e, offset 0x3bb + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9f, offset 0x3c1 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xa0, offset 0x3c6 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0xa1, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa2, offset 0x3c9 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa3, offset 0x3ca + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa4, offset 0x3cb + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa5, offset 0x3cd + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa6, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xa7, offset 0x3d1 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa8, offset 0x3d4 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa9, offset 0x3d6 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xaa, offset 0x3d9 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xaf53, lo: 0x98, hi: 0x9f}, + {value: 0xb253, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3e1 + {value: 0xaf52, lo: 0x80, hi: 0x87}, + {value: 0xb252, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xac, offset 0x3e4 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb253, lo: 0xb0, hi: 0xb7}, + {value: 0xaf53, lo: 0xb8, hi: 0xbf}, + // Block 0xad, offset 0x3e8 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb252, lo: 0x98, hi: 0x9f}, + {value: 0xaf52, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xae, offset 0x3f0 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xaf, offset 0x3f2 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xb0, offset 0x3f3 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xb1, offset 0x3f4 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb2, offset 0x3f6 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb3, offset 0x3fc + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb4, offset 0x3fe + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb5, offset 0x3ff + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb6, offset 0x401 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb7, offset 0x403 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb8, offset 0x405 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb3}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb9, offset 0x412 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xba, offset 0x413 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xbb, offset 0x414 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbc, offset 0x418 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbd, offset 0x41a + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbe, offset 0x41b + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbf, offset 0x41c + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x41d + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc1, offset 0x41e + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc2, offset 0x422 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc3, offset 0x426 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc4, offset 0x42c + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc5, offset 0x42e + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc6, offset 0x435 + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc7, offset 0x438 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xc8, offset 0x43c + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xc9, offset 0x442 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xca, offset 0x44b + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcb, offset 0x451 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcc, offset 0x457 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xcd, offset 0x461 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xce, offset 0x46b + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xcf, offset 0x46d + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd0, offset 0x474 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd1, offset 0x47a + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd2, offset 0x480 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd3, offset 0x486 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd4, offset 0x489 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x48f + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd6, offset 0x492 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0xd7, offset 0x49a + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xd8, offset 0x49b + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd9, offset 0x4a2 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xda, offset 0x4a3 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xdb, offset 0x4a6 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xdc, offset 0x4a7 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xdd, offset 0x4ad + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xde, offset 0x4b0 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xdf, offset 0x4b8 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xe0, offset 0x4b9 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xe1, offset 0x4ba + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xe2, offset 0x4bb + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xe3, offset 0x4bc + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xe4, offset 0x4be + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xe5, offset 0x4c0 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xe6, offset 0x4c2 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xe7, offset 0x4c6 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xe8, offset 0x4c7 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0xbe}, + // Block 0xe9, offset 0x4c9 + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xea, offset 0x4ca + {value: 0x0014, lo: 0xa0, hi: 0xa0}, + // Block 0xeb, offset 0x4cb + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xec, offset 0x4cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xed, offset 0x4d2 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xee, offset 0x4d7 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xef, offset 0x4db + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xf0, offset 0x4dc + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xf1, offset 0x4df + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xf2, offset 0x4e3 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0xf3, offset 0x4ee + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xf4, offset 0x4f2 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0xf5, offset 0x4fa + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0xf6, offset 0x4ff + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0xf7, offset 0x503 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0xf8, offset 0x506 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0xf9, offset 0x50a + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0xfa, offset 0x50d + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xfb, offset 0x510 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0xfc, offset 0x515 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0xfd, offset 0x519 + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0xfe, offset 0x51d + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xff, offset 0x521 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x100, offset 0x525 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x101, offset 0x527 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x102, offset 0x529 + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x103, offset 0x52c + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x104, offset 0x531 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x105, offset 0x533 + {value: 0xb552, lo: 0x80, hi: 0x81}, + {value: 0xb852, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x106, offset 0x538 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x107, offset 0x541 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x108, offset 0x546 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x109, offset 0x547 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10a, offset 0x54a + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x10b, offset 0x54b + {value: 0x0004, lo: 0xbb, hi: 0xbf}, + // Block 0x10c, offset 0x54c + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x10d, offset 0x54e + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x10e, offset 0x54f + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 13811 bytes (13KiB); checksum: 4CC48DA3 diff --git a/vendor/golang.org/x/text/cases/trieval.go b/vendor/golang.org/x/text/cases/trieval.go new file mode 100644 index 000000000..a2edb1057 --- /dev/null +++ b/vendor/golang.org/x/text/cases/trieval.go @@ -0,0 +1,215 @@ +// This file was generated by go generate; DO NOT EDIT + +package cases + +// This file contains definitions for interpreting the trie value of the case +// trie generated by "go run gen*.go". It is shared by both the generator +// program and the resultant package. Sharing is achieved by the generator +// copying gen_trieval.go to trieval.go and changing what's above this comment. + +// info holds case information for a single rune. It is the value returned +// by a trie lookup. Most mapping information can be stored in a single 16-bit +// value. If not, for example when a rune is mapped to multiple runes, the value +// stores some basic case data and an index into an array with additional data. +// +// The per-rune values have the following format: +// +// if (exception) { +// 15..5 unsigned exception index +// 4 unused +// } else { +// 15..8 XOR pattern or index to XOR pattern for case mapping +// Only 13..8 are used for XOR patterns. +// 7 inverseFold (fold to upper, not to lower) +// 6 index: interpret the XOR pattern as an index +// or isMid if case mode is cIgnorableUncased. +// 5..4 CCC: zero (normal or break), above or other +// } +// 3 exception: interpret this value as an exception index +// (TODO: is this bit necessary? Probably implied from case mode.) +// 2..0 case mode +// +// For the non-exceptional cases, a rune must be either uncased, lowercase or +// uppercase. If the rune is cased, the XOR pattern maps either a lowercase +// rune to uppercase or an uppercase rune to lowercase (applied to the 10 +// least-significant bits of the rune). +// +// See the definitions below for a more detailed description of the various +// bits. +type info uint16 + +const ( + casedMask = 0x0003 + fullCasedMask = 0x0007 + ignorableMask = 0x0006 + ignorableValue = 0x0004 + + inverseFoldBit = 1 << 7 + isMidBit = 1 << 6 + + exceptionBit = 1 << 3 + exceptionShift = 5 + numExceptionBits = 11 + + xorIndexBit = 1 << 6 + xorShift = 8 + + // There is no mapping if all xor bits and the exception bit are zero. + hasMappingMask = 0xff80 | exceptionBit +) + +// The case mode bits encodes the case type of a rune. This includes uncased, +// title, upper and lower case and case ignorable. (For a definition of these +// terms see Chapter 3 of The Unicode Standard Core Specification.) In some rare +// cases, a rune can be both cased and case-ignorable. This is encoded by +// cIgnorableCased. A rune of this type is always lower case. Some runes are +// cased while not having a mapping. +// +// A common pattern for scripts in the Unicode standard is for upper and lower +// case runes to alternate for increasing rune values (e.g. the accented Latin +// ranges starting from U+0100 and U+1E00 among others and some Cyrillic +// characters). We use this property by defining a cXORCase mode, where the case +// mode (always upper or lower case) is derived from the rune value. As the XOR +// pattern for case mappings is often identical for successive runes, using +// cXORCase can result in large series of identical trie values. This, in turn, +// allows us to better compress the trie blocks. +const ( + cUncased info = iota // 000 + cTitle // 001 + cLower // 010 + cUpper // 011 + cIgnorableUncased // 100 + cIgnorableCased // 101 // lower case if mappings exist + cXORCase // 11x // case is cLower | ((rune&1) ^ x) + + maxCaseMode = cUpper +) + +func (c info) isCased() bool { + return c&casedMask != 0 +} + +func (c info) isCaseIgnorable() bool { + return c&ignorableMask == ignorableValue +} + +func (c info) isNotCasedAndNotCaseIgnorable() bool { + return c&fullCasedMask == 0 +} + +func (c info) isCaseIgnorableAndNotCased() bool { + return c&fullCasedMask == cIgnorableUncased +} + +func (c info) isMid() bool { + return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased +} + +// The case mapping implementation will need to know about various Canonical +// Combining Class (CCC) values. We encode two of these in the trie value: +// cccZero (0) and cccAbove (230). If the value is cccOther, it means that +// CCC(r) > 0, but not 230. A value of cccBreak means that CCC(r) == 0 and that +// the rune also has the break category Break (see below). +const ( + cccBreak info = iota << 4 + cccZero + cccAbove + cccOther + + cccMask = cccBreak | cccZero | cccAbove | cccOther +) + +const ( + starter = 0 + above = 230 + iotaSubscript = 240 +) + +// The exceptions slice holds data that does not fit in a normal info entry. +// The entry is pointed to by the exception index in an entry. It has the +// following format: +// +// Header +// byte 0: +// 7..6 unused +// 5..4 CCC type (same bits as entry) +// 3 unused +// 2..0 length of fold +// +// byte 1: +// 7..6 unused +// 5..3 length of 1st mapping of case type +// 2..0 length of 2nd mapping of case type +// +// case 1st 2nd +// lower -> upper, title +// upper -> lower, title +// title -> lower, upper +// +// Lengths with the value 0x7 indicate no value and implies no change. +// A length of 0 indicates a mapping to zero-length string. +// +// Body bytes: +// case folding bytes +// lowercase mapping bytes +// uppercase mapping bytes +// titlecase mapping bytes +// closure mapping bytes (for NFKC_Casefold). (TODO) +// +// Fallbacks: +// missing fold -> lower +// missing title -> upper +// all missing -> original rune +// +// exceptions starts with a dummy byte to enforce that there is no zero index +// value. +const ( + lengthMask = 0x07 + lengthBits = 3 + noChange = 0 +) + +// References to generated trie. + +var trie = newCaseTrie(0) + +var sparse = sparseBlocks{ + values: sparseValues[:], + offsets: sparseOffsets[:], +} + +// Sparse block lookup code. + +// valueRange is an entry in a sparse block. +type valueRange struct { + value uint16 + lo, hi byte +} + +type sparseBlocks struct { + values []valueRange + offsets []uint16 +} + +// lookup returns the value from values block n for byte b using binary search. +func (s *sparseBlocks) lookup(n uint32, b byte) uint16 { + lo := s.offsets[n] + hi := s.offsets[n+1] + for lo < hi { + m := lo + (hi-lo)/2 + r := s.values[m] + if r.lo <= b && b <= r.hi { + return r.value + } + if b < r.lo { + hi = m + } else { + lo = m + 1 + } + } + return 0 +} + +// lastRuneForTesting is the last rune used for testing. Everything after this +// is boring. +const lastRuneForTesting = rune(0x1FFFF) diff --git a/vendor/golang.org/x/text/internal/gen.go b/vendor/golang.org/x/text/internal/gen.go new file mode 100644 index 000000000..1d678af57 --- /dev/null +++ b/vendor/golang.org/x/text/internal/gen.go @@ -0,0 +1,52 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +import ( + "log" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/language" + "golang.org/x/text/unicode/cldr" +) + +func main() { + r := gen.OpenCLDRCoreZip() + defer r.Close() + + d := &cldr.Decoder{} + data, err := d.DecodeZip(r) + if err != nil { + log.Fatalf("DecodeZip: %v", err) + } + + w := gen.NewCodeWriter() + defer w.WriteGoFile("tables.go", "internal") + + // Create parents table. + parents := make([]uint16, language.NumCompactTags) + for _, loc := range data.Locales() { + tag := language.MustParse(loc) + index, ok := language.CompactIndex(tag) + if !ok { + continue + } + parentIndex := 0 // und + for p := tag.Parent(); p != language.Und; p = p.Parent() { + if x, ok := language.CompactIndex(p); ok { + parentIndex = x + break + } + } + parents[index] = uint16(parentIndex) + } + + w.WriteComment(` + Parent maps a compact index of a tag to the compact index of the parent of + this tag.`) + w.WriteVar("Parent", parents) +} diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go new file mode 100644 index 000000000..eac832850 --- /dev/null +++ b/vendor/golang.org/x/text/internal/internal.go @@ -0,0 +1,51 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go + +// Package internal contains non-exported functionality that are used by +// packages in the text repository. +package internal // import "golang.org/x/text/internal" + +import ( + "sort" + + "golang.org/x/text/language" +) + +// SortTags sorts tags in place. +func SortTags(tags []language.Tag) { + sort.Sort(sorter(tags)) +} + +type sorter []language.Tag + +func (s sorter) Len() int { + return len(s) +} + +func (s sorter) Swap(i, j int) { + s[i], s[j] = s[j], s[i] +} + +func (s sorter) Less(i, j int) bool { + return s[i].String() < s[j].String() +} + +// UniqueTags sorts and filters duplicate tags in place and returns a slice with +// only unique tags. +func UniqueTags(tags []language.Tag) []language.Tag { + if len(tags) <= 1 { + return tags + } + SortTags(tags) + k := 0 + for i := 1; i < len(tags); i++ { + if tags[k].String() < tags[i].String() { + k++ + tags[k] = tags[i] + } + } + return tags[:k+1] +} diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go new file mode 100644 index 000000000..a67fcaca1 --- /dev/null +++ b/vendor/golang.org/x/text/internal/match.go @@ -0,0 +1,67 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package internal + +// This file contains matchers that implement CLDR inheritance. +// +// See http://unicode.org/reports/tr35/#Locale_Inheritance. +// +// Some of the inheritance described in this document is already handled by +// the cldr package. + +import ( + "golang.org/x/text/language" +) + +// TODO: consider if (some of the) matching algorithm needs to be public after +// getting some feel about what is generic and what is specific. + +// NewInheritanceMatcher returns a matcher that matches based on the inheritance +// chain. +// +// The matcher uses canonicalization and the parent relationship to find a +// match. The resulting match will always be either Und or a language with the +// same language and script as the requested language. It will not match +// languages for which there is understood to be mutual or one-directional +// intelligibility. +// +// A Match will indicate an Exact match if the language matches after +// canonicalization and High if the matched tag is a parent. +func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher { + tags := &InheritanceMatcher{make(map[language.Tag]int)} + for i, tag := range t { + ct, err := language.All.Canonicalize(tag) + if err != nil { + ct = tag + } + tags.index[ct] = i + } + return tags +} + +type InheritanceMatcher struct { + index map[language.Tag]int +} + +func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) { + for _, t := range want { + ct, err := language.All.Canonicalize(t) + if err != nil { + ct = t + } + conf := language.Exact + for { + if index, ok := m.index[ct]; ok { + return ct, index, conf + } + if ct == language.Und { + break + } + ct = ct.Parent() + conf = language.High + } + } + return language.Und, 0, language.No +} diff --git a/vendor/golang.org/x/text/internal/tables.go b/vendor/golang.org/x/text/internal/tables.go new file mode 100644 index 000000000..5e8f5fa6d --- /dev/null +++ b/vendor/golang.org/x/text/internal/tables.go @@ -0,0 +1,116 @@ +// This file was generated by go generate; DO NOT EDIT + +package internal + +// Parent maps a compact index of a tag to the compact index of the parent of +// this tag. +var Parent = []uint16{ // 752 elements + // Entry 0 - 3F + 0x0000, 0x0053, 0x00e5, 0x0000, 0x0003, 0x0003, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x0000, 0x000c, 0x000c, 0x000c, + 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, + 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, + 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, + 0x000c, 0x0000, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x002e, + 0x0000, 0x0000, 0x0031, 0x0030, 0x0030, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x003d, 0x0000, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0000, 0x0042, 0x0042, 0x0000, 0x0045, 0x0045, + 0x0000, 0x0048, 0x0000, 0x004a, 0x0000, 0x0000, 0x004d, 0x004c, + 0x004c, 0x0000, 0x0051, 0x0051, 0x0051, 0x0051, 0x0000, 0x0056, + 0x0000, 0x0058, 0x0000, 0x005a, 0x0000, 0x005c, 0x005c, 0x0000, + 0x005f, 0x0000, 0x0061, 0x0000, 0x0063, 0x0000, 0x0065, 0x0065, + 0x0000, 0x0068, 0x0000, 0x006a, 0x006a, 0x006a, 0x006a, 0x006a, + 0x006a, 0x006a, 0x0000, 0x0072, 0x0000, 0x0074, 0x0000, 0x0076, + 0x0000, 0x0000, 0x0079, 0x0000, 0x007b, 0x0000, 0x007d, 0x0000, + // Entry 80 - BF + 0x007f, 0x007f, 0x0000, 0x0082, 0x0082, 0x0000, 0x0085, 0x0086, + 0x0086, 0x0086, 0x0085, 0x0087, 0x0086, 0x0086, 0x0086, 0x0085, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0087, 0x0086, + 0x0086, 0x0086, 0x0086, 0x0087, 0x0086, 0x0087, 0x0086, 0x0086, + 0x0087, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, + 0x0086, 0x0086, 0x0085, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0085, 0x0086, 0x0085, 0x0086, + // Entry C0 - FF + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0087, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0085, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0087, 0x0086, 0x0086, + 0x0087, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0085, 0x0085, 0x0086, 0x0086, + 0x0085, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0000, 0x00ee, + 0x0000, 0x00f0, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f1, + 0x00f1, 0x00f1, 0x00f0, 0x00f1, 0x00f0, 0x00f0, 0x00f1, 0x00f1, + // Entry 100 - 13F + 0x00f0, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f0, 0x00f1, 0x00f1, + 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x0000, 0x010c, 0x0000, 0x010e, + 0x0000, 0x0110, 0x0000, 0x0112, 0x0112, 0x0000, 0x0115, 0x0115, + 0x0115, 0x0115, 0x0000, 0x011a, 0x0000, 0x011c, 0x0000, 0x011e, + 0x011e, 0x0000, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, + 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, + 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, + 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, + // Entry 140 - 17F + 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, + 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, 0x0121, + 0x0000, 0x0150, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, + 0x0000, 0x0158, 0x0000, 0x015a, 0x015a, 0x015a, 0x0000, 0x015e, + 0x0000, 0x0000, 0x0161, 0x0000, 0x0163, 0x0000, 0x0165, 0x0165, + 0x0165, 0x0000, 0x0169, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, + 0x016f, 0x016f, 0x0000, 0x0172, 0x0000, 0x0174, 0x0000, 0x0176, + 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, + // Entry 180 - 1BF + 0x0000, 0x0180, 0x0180, 0x0180, 0x0000, 0x0000, 0x0185, 0x0000, + 0x0000, 0x0188, 0x0000, 0x018a, 0x0000, 0x0000, 0x018d, 0x0000, + 0x018f, 0x0000, 0x0000, 0x0192, 0x0000, 0x0000, 0x0195, 0x0000, + 0x0197, 0x0000, 0x0199, 0x0000, 0x019b, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x01a9, 0x0000, 0x01ac, 0x0000, 0x01ae, + 0x0000, 0x01b0, 0x0000, 0x01b2, 0x0000, 0x01b4, 0x0000, 0x0000, + 0x01b7, 0x0000, 0x01b9, 0x0000, 0x01bb, 0x0000, 0x01bd, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x01c3, 0x01c3, 0x01c3, + 0x0000, 0x01c8, 0x0000, 0x01ca, 0x01ca, 0x0000, 0x01cd, 0x0000, + 0x01cf, 0x0000, 0x01d1, 0x0000, 0x01d3, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x01d7, 0x0000, 0x01da, 0x0000, 0x01dc, 0x0000, 0x01de, + 0x0000, 0x01e0, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x01ec, 0x01ec, + 0x0000, 0x01f0, 0x0000, 0x01f2, 0x0000, 0x01f4, 0x0000, 0x01f6, + 0x0000, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x01fb, 0x0000, 0x01fe, + // Entry 200 - 23F + 0x0000, 0x0200, 0x0200, 0x0000, 0x0203, 0x0203, 0x0000, 0x0206, + 0x0206, 0x0206, 0x0206, 0x0206, 0x0206, 0x0206, 0x0000, 0x020e, + 0x0000, 0x0210, 0x0000, 0x0212, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0218, 0x0000, 0x0000, 0x021b, 0x0000, 0x021d, 0x021d, + 0x0000, 0x0220, 0x0000, 0x0222, 0x0222, 0x0000, 0x0000, 0x0226, + 0x0225, 0x0225, 0x0000, 0x0000, 0x022b, 0x0000, 0x022d, 0x0000, + 0x022f, 0x0000, 0x023b, 0x0231, 0x023b, 0x023b, 0x023b, 0x023b, + 0x023b, 0x023b, 0x023b, 0x0231, 0x023b, 0x023b, 0x0000, 0x023e, + // Entry 240 - 27F + 0x023e, 0x023e, 0x0000, 0x0242, 0x0000, 0x0244, 0x0000, 0x0246, + 0x0246, 0x0000, 0x0249, 0x0000, 0x024b, 0x024b, 0x024b, 0x024b, + 0x024b, 0x024b, 0x0000, 0x0252, 0x0000, 0x0254, 0x0000, 0x0256, + 0x0000, 0x0258, 0x0000, 0x025a, 0x0000, 0x0000, 0x025d, 0x025d, + 0x025d, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0000, 0x0268, 0x0267, 0x0267, 0x0000, 0x026c, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0000, 0x0275, 0x0000, + 0x0000, 0x0278, 0x0000, 0x027a, 0x027a, 0x027a, 0x027a, 0x0000, + // Entry 280 - 2BF + 0x027f, 0x027f, 0x027f, 0x0000, 0x0283, 0x0283, 0x0283, 0x0283, + 0x0283, 0x0000, 0x0289, 0x0289, 0x0289, 0x0289, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0291, 0x0291, 0x0291, 0x0000, 0x0295, 0x0295, + 0x0295, 0x0295, 0x0000, 0x0000, 0x029b, 0x029b, 0x029b, 0x029b, + 0x0000, 0x02a0, 0x0000, 0x02a2, 0x02a2, 0x0000, 0x02a5, 0x0000, + 0x02a7, 0x02a7, 0x0000, 0x0000, 0x02ab, 0x0000, 0x0000, 0x02ae, + 0x0000, 0x02b0, 0x02b0, 0x0000, 0x0000, 0x02b4, 0x0000, 0x02b6, + 0x0000, 0x02b8, 0x0000, 0x02ba, 0x0000, 0x02bc, 0x02bc, 0x0000, + // Entry 2C0 - 2FF + 0x0000, 0x02c0, 0x0000, 0x02c2, 0x02bf, 0x02bf, 0x0000, 0x0000, + 0x02c7, 0x02c6, 0x02c6, 0x0000, 0x0000, 0x02cc, 0x0000, 0x02ce, + 0x0000, 0x02d0, 0x0000, 0x0000, 0x02d3, 0x0000, 0x0000, 0x0000, + 0x02d7, 0x0000, 0x02d9, 0x0000, 0x02db, 0x0000, 0x02dd, 0x02dd, + 0x0000, 0x02e0, 0x0000, 0x02e2, 0x0000, 0x02e4, 0x02e4, 0x02e4, + 0x02e4, 0x02e4, 0x0000, 0x02ea, 0x02eb, 0x02ea, 0x0000, 0x02ee, +} // Size: 1528 bytes + +// Total table size 1528 bytes (1KiB); checksum: B99CF952 diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go new file mode 100644 index 000000000..b5d348891 --- /dev/null +++ b/vendor/golang.org/x/text/internal/tag/tag.go @@ -0,0 +1,100 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package tag contains functionality handling tags and related data. +package tag // import "golang.org/x/text/internal/tag" + +import "sort" + +// An Index converts tags to a compact numeric value. +// +// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can +// be used to store additional information about the tag. +type Index string + +// Elem returns the element data at the given index. +func (s Index) Elem(x int) string { + return string(s[x*4 : x*4+4]) +} + +// Index reports the index of the given key or -1 if it could not be found. +// Only the first len(key) bytes from the start of the 4-byte entries will be +// considered for the search and the first match in Index will be returned. +func (s Index) Index(key []byte) int { + n := len(key) + // search the index of the first entry with an equal or higher value than + // key in s. + index := sort.Search(len(s)/4, func(i int) bool { + return cmp(s[i*4:i*4+n], key) != -1 + }) + i := index * 4 + if cmp(s[i:i+len(key)], key) != 0 { + return -1 + } + return index +} + +// Next finds the next occurrence of key after index x, which must have been +// obtained from a call to Index using the same key. It returns x+1 or -1. +func (s Index) Next(key []byte, x int) int { + if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { + return x + } + return -1 +} + +// cmp returns an integer comparing a and b lexicographically. +func cmp(a Index, b []byte) int { + n := len(a) + if len(b) < n { + n = len(b) + } + for i, c := range b[:n] { + switch { + case a[i] > c: + return 1 + case a[i] < c: + return -1 + } + } + switch { + case len(a) < len(b): + return -1 + case len(a) > len(b): + return 1 + } + return 0 +} + +// Compare returns an integer comparing a and b lexicographically. +func Compare(a string, b []byte) int { + return cmp(Index(a), b) +} + +// FixCase reformats b to the same pattern of cases as form. +// If returns false if string b is malformed. +func FixCase(form string, b []byte) bool { + if len(form) != len(b) { + return false + } + for i, c := range b { + if form[i] <= 'Z' { + if c >= 'a' { + c -= 'z' - 'Z' + } + if c < 'A' || 'Z' < c { + return false + } + } else { + if c <= 'Z' { + c += 'z' - 'Z' + } + if c < 'a' || 'z' < c { + return false + } + } + b[i] = c + } + return true +} diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/language/common.go new file mode 100644 index 000000000..a255bb0a5 --- /dev/null +++ b/vendor/golang.org/x/text/language/common.go @@ -0,0 +1,16 @@ +// This file was generated by go generate; DO NOT EDIT + +package language + +// This file contains code common to the maketables.go and the package code. + +// langAliasType is the type of an alias in langAliasMap. +type langAliasType int8 + +const ( + langDeprecated langAliasType = iota + langMacro + langLegacy + + langAliasTypeUnknown langAliasType = -1 +) diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go new file mode 100644 index 000000000..101fd23c1 --- /dev/null +++ b/vendor/golang.org/x/text/language/coverage.go @@ -0,0 +1,197 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "fmt" + "sort" +) + +// The Coverage interface is used to define the level of coverage of an +// internationalization service. Note that not all types are supported by all +// services. As lists may be generated on the fly, it is recommended that users +// of a Coverage cache the results. +type Coverage interface { + // Tags returns the list of supported tags. + Tags() []Tag + + // BaseLanguages returns the list of supported base languages. + BaseLanguages() []Base + + // Scripts returns the list of supported scripts. + Scripts() []Script + + // Regions returns the list of supported regions. + Regions() []Region +} + +var ( + // Supported defines a Coverage that lists all supported subtags. Tags + // always returns nil. + Supported Coverage = allSubtags{} +) + +// TODO: +// - Support Variants, numbering systems. +// - CLDR coverage levels. +// - Set of common tags defined in this package. + +type allSubtags struct{} + +// Regions returns the list of supported regions. As all regions are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" region is not returned. +func (s allSubtags) Regions() []Region { + reg := make([]Region, numRegions) + for i := range reg { + reg[i] = Region{regionID(i + 1)} + } + return reg +} + +// Scripts returns the list of supported scripts. As all scripts are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" script is not returned. +func (s allSubtags) Scripts() []Script { + scr := make([]Script, numScripts) + for i := range scr { + scr[i] = Script{scriptID(i + 1)} + } + return scr +} + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func (s allSubtags) BaseLanguages() []Base { + base := make([]Base, 0, numLanguages) + for i := 0; i < langNoIndexOffset; i++ { + // We included "und" already for the value 0. + if i != nonCanonicalUnd { + base = append(base, Base{langID(i)}) + } + } + i := langNoIndexOffset + for _, v := range langNoIndex { + for k := 0; k < 8; k++ { + if v&1 == 1 { + base = append(base, Base{langID(i)}) + } + v >>= 1 + i++ + } + } + return base +} + +// Tags always returns nil. +func (s allSubtags) Tags() []Tag { + return nil +} + +// coverage is used used by NewCoverage which is used as a convenient way for +// creating Coverage implementations for partially defined data. Very often a +// package will only need to define a subset of slices. coverage provides a +// convenient way to do this. Moreover, packages using NewCoverage, instead of +// their own implementation, will not break if later new slice types are added. +type coverage struct { + tags func() []Tag + bases func() []Base + scripts func() []Script + regions func() []Region +} + +func (s *coverage) Tags() []Tag { + if s.tags == nil { + return nil + } + return s.tags() +} + +// bases implements sort.Interface and is used to sort base languages. +type bases []Base + +func (b bases) Len() int { + return len(b) +} + +func (b bases) Swap(i, j int) { + b[i], b[j] = b[j], b[i] +} + +func (b bases) Less(i, j int) bool { + return b[i].langID < b[j].langID +} + +// BaseLanguages returns the result from calling s.bases if it is specified or +// otherwise derives the set of supported base languages from tags. +func (s *coverage) BaseLanguages() []Base { + if s.bases == nil { + tags := s.Tags() + if len(tags) == 0 { + return nil + } + a := make([]Base, len(tags)) + for i, t := range tags { + a[i] = Base{langID(t.lang)} + } + sort.Sort(bases(a)) + k := 0 + for i := 1; i < len(a); i++ { + if a[k] != a[i] { + k++ + a[k] = a[i] + } + } + return a[:k+1] + } + return s.bases() +} + +func (s *coverage) Scripts() []Script { + if s.scripts == nil { + return nil + } + return s.scripts() +} + +func (s *coverage) Regions() []Region { + if s.regions == nil { + return nil + } + return s.regions() +} + +// NewCoverage returns a Coverage for the given lists. It is typically used by +// packages providing internationalization services to define their level of +// coverage. A list may be of type []T or func() []T, where T is either Tag, +// Base, Script or Region. The returned Coverage derives the value for Bases +// from Tags if no func or slice for []Base is specified. For other unspecified +// types the returned Coverage will return nil for the respective methods. +func NewCoverage(list ...interface{}) Coverage { + s := &coverage{} + for _, x := range list { + switch v := x.(type) { + case func() []Base: + s.bases = v + case func() []Script: + s.scripts = v + case func() []Region: + s.regions = v + case func() []Tag: + s.tags = v + case []Base: + s.bases = func() []Base { return v } + case []Script: + s.scripts = func() []Script { return v } + case []Region: + s.regions = func() []Region { return v } + case []Tag: + s.tags = func() []Tag { return v } + default: + panic(fmt.Sprintf("language: unsupported set type %T", v)) + } + } + return s +} diff --git a/vendor/golang.org/x/text/language/gen_common.go b/vendor/golang.org/x/text/language/gen_common.go new file mode 100644 index 000000000..83ce18013 --- /dev/null +++ b/vendor/golang.org/x/text/language/gen_common.go @@ -0,0 +1,20 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +// This file contains code common to the maketables.go and the package code. + +// langAliasType is the type of an alias in langAliasMap. +type langAliasType int8 + +const ( + langDeprecated langAliasType = iota + langMacro + langLegacy + + langAliasTypeUnknown langAliasType = -1 +) diff --git a/vendor/golang.org/x/text/language/gen_index.go b/vendor/golang.org/x/text/language/gen_index.go new file mode 100644 index 000000000..eef555cd3 --- /dev/null +++ b/vendor/golang.org/x/text/language/gen_index.go @@ -0,0 +1,162 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +// This file generates derivative tables based on the language package itself. + +import ( + "bytes" + "flag" + "fmt" + "io/ioutil" + "log" + "reflect" + "sort" + "strings" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/language" + "golang.org/x/text/unicode/cldr" +) + +var ( + test = flag.Bool("test", false, + "test existing tables; can be used to compare web data with package data.") + + draft = flag.String("draft", + "contributed", + `Minimal draft requirements (approved, contributed, provisional, unconfirmed).`) +) + +func main() { + gen.Init() + + // Read the CLDR zip file. + r := gen.OpenCLDRCoreZip() + defer r.Close() + + d := &cldr.Decoder{} + data, err := d.DecodeZip(r) + if err != nil { + log.Fatalf("DecodeZip: %v", err) + } + + w := gen.NewCodeWriter() + defer func() { + buf := &bytes.Buffer{} + + if _, err = w.WriteGo(buf, "language"); err != nil { + log.Fatalf("Error formatting file index.go: %v", err) + } + + // Since we're generating a table for our own package we need to rewrite + // doing the equivalent of go fmt -r 'language.b -> b'. Using + // bytes.Replace will do. + out := bytes.Replace(buf.Bytes(), []byte("language."), nil, -1) + if err := ioutil.WriteFile("index.go", out, 0600); err != nil { + log.Fatalf("Could not create file index.go: %v", err) + } + }() + + m := map[language.Tag]bool{} + for _, lang := range data.Locales() { + // We include all locales unconditionally to be consistent with en_US. + // We want en_US, even though it has no data associated with it. + + // TODO: put any of the languages for which no data exists at the end + // of the index. This allows all components based on ICU to use that + // as the cutoff point. + // if x := data.RawLDML(lang); false || + // x.LocaleDisplayNames != nil || + // x.Characters != nil || + // x.Delimiters != nil || + // x.Measurement != nil || + // x.Dates != nil || + // x.Numbers != nil || + // x.Units != nil || + // x.ListPatterns != nil || + // x.Collations != nil || + // x.Segmentations != nil || + // x.Rbnf != nil || + // x.Annotations != nil || + // x.Metadata != nil { + + // TODO: support POSIX natively, albeit non-standard. + tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1)) + m[tag] = true + // } + } + // Include locales for plural rules, which uses a different structure. + for _, plurals := range data.Supplemental().Plurals { + for _, rules := range plurals.PluralRules { + for _, lang := range strings.Split(rules.Locales, " ") { + m[language.Make(lang)] = true + } + } + } + + var core, special []language.Tag + + for t := range m { + if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" { + log.Fatalf("Unexpected extension %v in %v", x, t) + } + if len(t.Variants()) == 0 && len(t.Extensions()) == 0 { + core = append(core, t) + } else { + special = append(special, t) + } + } + + w.WriteComment(` + NumCompactTags is the number of common tags. The maximum tag is + NumCompactTags-1.`) + w.WriteConst("NumCompactTags", len(core)+len(special)) + + sort.Sort(byAlpha(special)) + w.WriteVar("specialTags", special) + + // TODO: order by frequency? + sort.Sort(byAlpha(core)) + + // Size computations are just an estimate. + w.Size += int(reflect.TypeOf(map[uint32]uint16{}).Size()) + w.Size += len(core) * 6 // size of uint32 and uint16 + + fmt.Fprintln(w) + fmt.Fprintln(w, "var coreTags = map[uint32]uint16{") + fmt.Fprintln(w, "0x0: 0, // und") + i := len(special) + 1 // Und and special tags already written. + for _, t := range core { + if t == language.Und { + continue + } + fmt.Fprint(w.Hash, t, i) + b, s, r := t.Raw() + fmt.Fprintf(w, "0x%s%s%s: %d, // %s\n", + getIndex(b, 3), // 3 is enough as it is guaranteed to be a compact number + getIndex(s, 2), + getIndex(r, 3), + i, t) + i++ + } + fmt.Fprintln(w, "}") +} + +// getIndex prints the subtag type and extracts its index of size nibble. +// If the index is less than n nibbles, the result is prefixed with 0s. +func getIndex(x interface{}, n int) string { + s := fmt.Sprintf("%#v", x) // s is of form Type{typeID: 0x00} + s = s[strings.Index(s, "0x")+2 : len(s)-1] + return strings.Repeat("0", n-len(s)) + s +} + +type byAlpha []language.Tag + +func (a byAlpha) Len() int { return len(a) } +func (a byAlpha) Swap(i, j int) { a[i], a[j] = a[j], a[i] } +func (a byAlpha) Less(i, j int) bool { return a[i].String() < a[j].String() } diff --git a/vendor/golang.org/x/text/language/go1_1.go b/vendor/golang.org/x/text/language/go1_1.go new file mode 100644 index 000000000..380f4c09f --- /dev/null +++ b/vendor/golang.org/x/text/language/go1_1.go @@ -0,0 +1,38 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !go1.2 + +package language + +import "sort" + +func sortStable(s sort.Interface) { + ss := stableSort{ + s: s, + pos: make([]int, s.Len()), + } + for i := range ss.pos { + ss.pos[i] = i + } + sort.Sort(&ss) +} + +type stableSort struct { + s sort.Interface + pos []int +} + +func (s *stableSort) Len() int { + return len(s.pos) +} + +func (s *stableSort) Less(i, j int) bool { + return s.s.Less(i, j) || !s.s.Less(j, i) && s.pos[i] < s.pos[j] +} + +func (s *stableSort) Swap(i, j int) { + s.s.Swap(i, j) + s.pos[i], s.pos[j] = s.pos[j], s.pos[i] +} diff --git a/vendor/golang.org/x/text/language/go1_2.go b/vendor/golang.org/x/text/language/go1_2.go new file mode 100644 index 000000000..38268c57a --- /dev/null +++ b/vendor/golang.org/x/text/language/go1_2.go @@ -0,0 +1,11 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build go1.2 + +package language + +import "sort" + +var sortStable = sort.Stable diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go new file mode 100644 index 000000000..50c752186 --- /dev/null +++ b/vendor/golang.org/x/text/language/index.go @@ -0,0 +1,767 @@ +// This file was generated by go generate; DO NOT EDIT + +package language + +// NumCompactTags is the number of common tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = 752 + +var specialTags = []Tag{ // 2 elements + 0: {lang: 0xd5, region: 0x6d, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"}, + 1: {lang: 0x134, region: 0x134, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"}, +} // Size: 72 bytes + +var coreTags = map[uint32]uint16{ + 0x0: 0, // und + 0x01500000: 3, // af + 0x015000d1: 4, // af-NA + 0x01500160: 5, // af-ZA + 0x01b00000: 6, // agq + 0x01b00051: 7, // agq-CM + 0x02000000: 8, // ak + 0x0200007f: 9, // ak-GH + 0x02600000: 10, // am + 0x0260006e: 11, // am-ET + 0x03900000: 12, // ar + 0x03900001: 13, // ar-001 + 0x03900022: 14, // ar-AE + 0x03900038: 15, // ar-BH + 0x03900061: 16, // ar-DJ + 0x03900066: 17, // ar-DZ + 0x0390006a: 18, // ar-EG + 0x0390006b: 19, // ar-EH + 0x0390006c: 20, // ar-ER + 0x03900096: 21, // ar-IL + 0x0390009a: 22, // ar-IQ + 0x039000a0: 23, // ar-JO + 0x039000a7: 24, // ar-KM + 0x039000ab: 25, // ar-KW + 0x039000af: 26, // ar-LB + 0x039000b8: 27, // ar-LY + 0x039000b9: 28, // ar-MA + 0x039000c8: 29, // ar-MR + 0x039000e0: 30, // ar-OM + 0x039000ec: 31, // ar-PS + 0x039000f2: 32, // ar-QA + 0x03900107: 33, // ar-SA + 0x0390010a: 34, // ar-SD + 0x03900114: 35, // ar-SO + 0x03900116: 36, // ar-SS + 0x0390011b: 37, // ar-SY + 0x0390011f: 38, // ar-TD + 0x03900127: 39, // ar-TN + 0x0390015d: 40, // ar-YE + 0x03f00000: 41, // ars + 0x04200000: 42, // as + 0x04200098: 43, // as-IN + 0x04300000: 44, // asa + 0x0430012e: 45, // asa-TZ + 0x04700000: 46, // ast + 0x0470006d: 47, // ast-ES + 0x05700000: 48, // az + 0x0571e000: 49, // az-Cyrl + 0x0571e031: 50, // az-Cyrl-AZ + 0x05752000: 51, // az-Latn + 0x05752031: 52, // az-Latn-AZ + 0x05d00000: 53, // bas + 0x05d00051: 54, // bas-CM + 0x07000000: 55, // be + 0x07000046: 56, // be-BY + 0x07400000: 57, // bem + 0x07400161: 58, // bem-ZM + 0x07800000: 59, // bez + 0x0780012e: 60, // bez-TZ + 0x07d00000: 61, // bg + 0x07d00037: 62, // bg-BG + 0x08100000: 63, // bh + 0x09e00000: 64, // bm + 0x09e000c2: 65, // bm-ML + 0x0a300000: 66, // bn + 0x0a300034: 67, // bn-BD + 0x0a300098: 68, // bn-IN + 0x0a700000: 69, // bo + 0x0a700052: 70, // bo-CN + 0x0a700098: 71, // bo-IN + 0x0b000000: 72, // br + 0x0b000077: 73, // br-FR + 0x0b300000: 74, // brx + 0x0b300098: 75, // brx-IN + 0x0b500000: 76, // bs + 0x0b51e000: 77, // bs-Cyrl + 0x0b51e032: 78, // bs-Cyrl-BA + 0x0b552000: 79, // bs-Latn + 0x0b552032: 80, // bs-Latn-BA + 0x0d500000: 81, // ca + 0x0d500021: 82, // ca-AD + 0x0d50006d: 83, // ca-ES + 0x0d500077: 84, // ca-FR + 0x0d50009d: 85, // ca-IT + 0x0da00000: 86, // ce + 0x0da00105: 87, // ce-RU + 0x0dd00000: 88, // cgg + 0x0dd00130: 89, // cgg-UG + 0x0e300000: 90, // chr + 0x0e300134: 91, // chr-US + 0x0e700000: 92, // ckb + 0x0e70009a: 93, // ckb-IQ + 0x0e70009b: 94, // ckb-IR + 0x0f600000: 95, // cs + 0x0f60005d: 96, // cs-CZ + 0x0fa00000: 97, // cu + 0x0fa00105: 98, // cu-RU + 0x0fc00000: 99, // cy + 0x0fc0007a: 100, // cy-GB + 0x0fd00000: 101, // da + 0x0fd00062: 102, // da-DK + 0x0fd00081: 103, // da-GL + 0x10400000: 104, // dav + 0x104000a3: 105, // dav-KE + 0x10900000: 106, // de + 0x1090002d: 107, // de-AT + 0x10900035: 108, // de-BE + 0x1090004d: 109, // de-CH + 0x1090005f: 110, // de-DE + 0x1090009d: 111, // de-IT + 0x109000b1: 112, // de-LI + 0x109000b6: 113, // de-LU + 0x11300000: 114, // dje + 0x113000d3: 115, // dje-NE + 0x11b00000: 116, // dsb + 0x11b0005f: 117, // dsb-DE + 0x12000000: 118, // dua + 0x12000051: 119, // dua-CM + 0x12400000: 120, // dv + 0x12700000: 121, // dyo + 0x12700113: 122, // dyo-SN + 0x12900000: 123, // dz + 0x12900042: 124, // dz-BT + 0x12b00000: 125, // ebu + 0x12b000a3: 126, // ebu-KE + 0x12c00000: 127, // ee + 0x12c0007f: 128, // ee-GH + 0x12c00121: 129, // ee-TG + 0x13100000: 130, // el + 0x1310005c: 131, // el-CY + 0x13100086: 132, // el-GR + 0x13400000: 133, // en + 0x13400001: 134, // en-001 + 0x1340001a: 135, // en-150 + 0x13400024: 136, // en-AG + 0x13400025: 137, // en-AI + 0x1340002c: 138, // en-AS + 0x1340002d: 139, // en-AT + 0x1340002e: 140, // en-AU + 0x13400033: 141, // en-BB + 0x13400035: 142, // en-BE + 0x13400039: 143, // en-BI + 0x1340003c: 144, // en-BM + 0x13400041: 145, // en-BS + 0x13400045: 146, // en-BW + 0x13400047: 147, // en-BZ + 0x13400048: 148, // en-CA + 0x13400049: 149, // en-CC + 0x1340004d: 150, // en-CH + 0x1340004f: 151, // en-CK + 0x13400051: 152, // en-CM + 0x1340005b: 153, // en-CX + 0x1340005c: 154, // en-CY + 0x1340005f: 155, // en-DE + 0x13400060: 156, // en-DG + 0x13400062: 157, // en-DK + 0x13400063: 158, // en-DM + 0x1340006c: 159, // en-ER + 0x13400071: 160, // en-FI + 0x13400072: 161, // en-FJ + 0x13400073: 162, // en-FK + 0x13400074: 163, // en-FM + 0x1340007a: 164, // en-GB + 0x1340007b: 165, // en-GD + 0x1340007e: 166, // en-GG + 0x1340007f: 167, // en-GH + 0x13400080: 168, // en-GI + 0x13400082: 169, // en-GM + 0x13400089: 170, // en-GU + 0x1340008b: 171, // en-GY + 0x1340008c: 172, // en-HK + 0x13400095: 173, // en-IE + 0x13400096: 174, // en-IL + 0x13400097: 175, // en-IM + 0x13400098: 176, // en-IN + 0x13400099: 177, // en-IO + 0x1340009e: 178, // en-JE + 0x1340009f: 179, // en-JM + 0x134000a3: 180, // en-KE + 0x134000a6: 181, // en-KI + 0x134000a8: 182, // en-KN + 0x134000ac: 183, // en-KY + 0x134000b0: 184, // en-LC + 0x134000b3: 185, // en-LR + 0x134000b4: 186, // en-LS + 0x134000be: 187, // en-MG + 0x134000bf: 188, // en-MH + 0x134000c5: 189, // en-MO + 0x134000c6: 190, // en-MP + 0x134000c9: 191, // en-MS + 0x134000ca: 192, // en-MT + 0x134000cb: 193, // en-MU + 0x134000cd: 194, // en-MW + 0x134000cf: 195, // en-MY + 0x134000d1: 196, // en-NA + 0x134000d4: 197, // en-NF + 0x134000d5: 198, // en-NG + 0x134000d8: 199, // en-NL + 0x134000dc: 200, // en-NR + 0x134000de: 201, // en-NU + 0x134000df: 202, // en-NZ + 0x134000e5: 203, // en-PG + 0x134000e6: 204, // en-PH + 0x134000e7: 205, // en-PK + 0x134000ea: 206, // en-PN + 0x134000eb: 207, // en-PR + 0x134000ef: 208, // en-PW + 0x13400106: 209, // en-RW + 0x13400108: 210, // en-SB + 0x13400109: 211, // en-SC + 0x1340010a: 212, // en-SD + 0x1340010b: 213, // en-SE + 0x1340010c: 214, // en-SG + 0x1340010d: 215, // en-SH + 0x1340010e: 216, // en-SI + 0x13400111: 217, // en-SL + 0x13400116: 218, // en-SS + 0x1340011a: 219, // en-SX + 0x1340011c: 220, // en-SZ + 0x1340011e: 221, // en-TC + 0x13400124: 222, // en-TK + 0x13400128: 223, // en-TO + 0x1340012b: 224, // en-TT + 0x1340012c: 225, // en-TV + 0x1340012e: 226, // en-TZ + 0x13400130: 227, // en-UG + 0x13400132: 228, // en-UM + 0x13400134: 229, // en-US + 0x13400138: 230, // en-VC + 0x1340013b: 231, // en-VG + 0x1340013c: 232, // en-VI + 0x1340013e: 233, // en-VU + 0x13400141: 234, // en-WS + 0x13400160: 235, // en-ZA + 0x13400161: 236, // en-ZM + 0x13400163: 237, // en-ZW + 0x13700000: 238, // eo + 0x13700001: 239, // eo-001 + 0x13900000: 240, // es + 0x1390001e: 241, // es-419 + 0x1390002b: 242, // es-AR + 0x1390003e: 243, // es-BO + 0x13900040: 244, // es-BR + 0x13900050: 245, // es-CL + 0x13900053: 246, // es-CO + 0x13900055: 247, // es-CR + 0x13900058: 248, // es-CU + 0x13900064: 249, // es-DO + 0x13900067: 250, // es-EA + 0x13900068: 251, // es-EC + 0x1390006d: 252, // es-ES + 0x13900085: 253, // es-GQ + 0x13900088: 254, // es-GT + 0x1390008e: 255, // es-HN + 0x13900093: 256, // es-IC + 0x139000ce: 257, // es-MX + 0x139000d7: 258, // es-NI + 0x139000e1: 259, // es-PA + 0x139000e3: 260, // es-PE + 0x139000e6: 261, // es-PH + 0x139000eb: 262, // es-PR + 0x139000f0: 263, // es-PY + 0x13900119: 264, // es-SV + 0x13900134: 265, // es-US + 0x13900135: 266, // es-UY + 0x1390013a: 267, // es-VE + 0x13b00000: 268, // et + 0x13b00069: 269, // et-EE + 0x14000000: 270, // eu + 0x1400006d: 271, // eu-ES + 0x14100000: 272, // ewo + 0x14100051: 273, // ewo-CM + 0x14300000: 274, // fa + 0x14300023: 275, // fa-AF + 0x1430009b: 276, // fa-IR + 0x14900000: 277, // ff + 0x14900051: 278, // ff-CM + 0x14900083: 279, // ff-GN + 0x149000c8: 280, // ff-MR + 0x14900113: 281, // ff-SN + 0x14c00000: 282, // fi + 0x14c00071: 283, // fi-FI + 0x14e00000: 284, // fil + 0x14e000e6: 285, // fil-PH + 0x15300000: 286, // fo + 0x15300062: 287, // fo-DK + 0x15300075: 288, // fo-FO + 0x15900000: 289, // fr + 0x15900035: 290, // fr-BE + 0x15900036: 291, // fr-BF + 0x15900039: 292, // fr-BI + 0x1590003a: 293, // fr-BJ + 0x1590003b: 294, // fr-BL + 0x15900048: 295, // fr-CA + 0x1590004a: 296, // fr-CD + 0x1590004b: 297, // fr-CF + 0x1590004c: 298, // fr-CG + 0x1590004d: 299, // fr-CH + 0x1590004e: 300, // fr-CI + 0x15900051: 301, // fr-CM + 0x15900061: 302, // fr-DJ + 0x15900066: 303, // fr-DZ + 0x15900077: 304, // fr-FR + 0x15900079: 305, // fr-GA + 0x1590007d: 306, // fr-GF + 0x15900083: 307, // fr-GN + 0x15900084: 308, // fr-GP + 0x15900085: 309, // fr-GQ + 0x15900090: 310, // fr-HT + 0x159000a7: 311, // fr-KM + 0x159000b6: 312, // fr-LU + 0x159000b9: 313, // fr-MA + 0x159000ba: 314, // fr-MC + 0x159000bd: 315, // fr-MF + 0x159000be: 316, // fr-MG + 0x159000c2: 317, // fr-ML + 0x159000c7: 318, // fr-MQ + 0x159000c8: 319, // fr-MR + 0x159000cb: 320, // fr-MU + 0x159000d2: 321, // fr-NC + 0x159000d3: 322, // fr-NE + 0x159000e4: 323, // fr-PF + 0x159000e9: 324, // fr-PM + 0x15900101: 325, // fr-RE + 0x15900106: 326, // fr-RW + 0x15900109: 327, // fr-SC + 0x15900113: 328, // fr-SN + 0x1590011b: 329, // fr-SY + 0x1590011f: 330, // fr-TD + 0x15900121: 331, // fr-TG + 0x15900127: 332, // fr-TN + 0x1590013e: 333, // fr-VU + 0x1590013f: 334, // fr-WF + 0x1590015e: 335, // fr-YT + 0x16400000: 336, // fur + 0x1640009d: 337, // fur-IT + 0x16800000: 338, // fy + 0x168000d8: 339, // fy-NL + 0x16900000: 340, // ga + 0x16900095: 341, // ga-IE + 0x17800000: 342, // gd + 0x1780007a: 343, // gd-GB + 0x18a00000: 344, // gl + 0x18a0006d: 345, // gl-ES + 0x19c00000: 346, // gsw + 0x19c0004d: 347, // gsw-CH + 0x19c00077: 348, // gsw-FR + 0x19c000b1: 349, // gsw-LI + 0x19d00000: 350, // gu + 0x19d00098: 351, // gu-IN + 0x1a200000: 352, // guw + 0x1a400000: 353, // guz + 0x1a4000a3: 354, // guz-KE + 0x1a500000: 355, // gv + 0x1a500097: 356, // gv-IM + 0x1ad00000: 357, // ha + 0x1ad0007f: 358, // ha-GH + 0x1ad000d3: 359, // ha-NE + 0x1ad000d5: 360, // ha-NG + 0x1b100000: 361, // haw + 0x1b100134: 362, // haw-US + 0x1b500000: 363, // he + 0x1b500096: 364, // he-IL + 0x1b700000: 365, // hi + 0x1b700098: 366, // hi-IN + 0x1ca00000: 367, // hr + 0x1ca00032: 368, // hr-BA + 0x1ca0008f: 369, // hr-HR + 0x1cb00000: 370, // hsb + 0x1cb0005f: 371, // hsb-DE + 0x1ce00000: 372, // hu + 0x1ce00091: 373, // hu-HU + 0x1d000000: 374, // hy + 0x1d000027: 375, // hy-AM + 0x1da00000: 376, // id + 0x1da00094: 377, // id-ID + 0x1df00000: 378, // ig + 0x1df000d5: 379, // ig-NG + 0x1e200000: 380, // ii + 0x1e200052: 381, // ii-CN + 0x1f000000: 382, // is + 0x1f00009c: 383, // is-IS + 0x1f100000: 384, // it + 0x1f10004d: 385, // it-CH + 0x1f10009d: 386, // it-IT + 0x1f100112: 387, // it-SM + 0x1f200000: 388, // iu + 0x1f800000: 389, // ja + 0x1f8000a1: 390, // ja-JP + 0x1fb00000: 391, // jbo + 0x1ff00000: 392, // jgo + 0x1ff00051: 393, // jgo-CM + 0x20200000: 394, // jmc + 0x2020012e: 395, // jmc-TZ + 0x20600000: 396, // jv + 0x20800000: 397, // ka + 0x2080007c: 398, // ka-GE + 0x20a00000: 399, // kab + 0x20a00066: 400, // kab-DZ + 0x20e00000: 401, // kaj + 0x20f00000: 402, // kam + 0x20f000a3: 403, // kam-KE + 0x21700000: 404, // kcg + 0x21b00000: 405, // kde + 0x21b0012e: 406, // kde-TZ + 0x21f00000: 407, // kea + 0x21f00059: 408, // kea-CV + 0x22c00000: 409, // khq + 0x22c000c2: 410, // khq-ML + 0x23100000: 411, // ki + 0x231000a3: 412, // ki-KE + 0x23a00000: 413, // kk + 0x23a000ad: 414, // kk-KZ + 0x23c00000: 415, // kkj + 0x23c00051: 416, // kkj-CM + 0x23d00000: 417, // kl + 0x23d00081: 418, // kl-GL + 0x23e00000: 419, // kln + 0x23e000a3: 420, // kln-KE + 0x24200000: 421, // km + 0x242000a5: 422, // km-KH + 0x24900000: 423, // kn + 0x24900098: 424, // kn-IN + 0x24b00000: 425, // ko + 0x24b000a9: 426, // ko-KP + 0x24b000aa: 427, // ko-KR + 0x24d00000: 428, // kok + 0x24d00098: 429, // kok-IN + 0x26100000: 430, // ks + 0x26100098: 431, // ks-IN + 0x26200000: 432, // ksb + 0x2620012e: 433, // ksb-TZ + 0x26400000: 434, // ksf + 0x26400051: 435, // ksf-CM + 0x26500000: 436, // ksh + 0x2650005f: 437, // ksh-DE + 0x26b00000: 438, // ku + 0x27800000: 439, // kw + 0x2780007a: 440, // kw-GB + 0x28100000: 441, // ky + 0x281000a4: 442, // ky-KG + 0x28800000: 443, // lag + 0x2880012e: 444, // lag-TZ + 0x28c00000: 445, // lb + 0x28c000b6: 446, // lb-LU + 0x29a00000: 447, // lg + 0x29a00130: 448, // lg-UG + 0x2a600000: 449, // lkt + 0x2a600134: 450, // lkt-US + 0x2ac00000: 451, // ln + 0x2ac00029: 452, // ln-AO + 0x2ac0004a: 453, // ln-CD + 0x2ac0004b: 454, // ln-CF + 0x2ac0004c: 455, // ln-CG + 0x2af00000: 456, // lo + 0x2af000ae: 457, // lo-LA + 0x2b600000: 458, // lrc + 0x2b60009a: 459, // lrc-IQ + 0x2b60009b: 460, // lrc-IR + 0x2b700000: 461, // lt + 0x2b7000b5: 462, // lt-LT + 0x2b900000: 463, // lu + 0x2b90004a: 464, // lu-CD + 0x2bb00000: 465, // luo + 0x2bb000a3: 466, // luo-KE + 0x2bc00000: 467, // luy + 0x2bc000a3: 468, // luy-KE + 0x2be00000: 469, // lv + 0x2be000b7: 470, // lv-LV + 0x2c800000: 471, // mas + 0x2c8000a3: 472, // mas-KE + 0x2c80012e: 473, // mas-TZ + 0x2e000000: 474, // mer + 0x2e0000a3: 475, // mer-KE + 0x2e400000: 476, // mfe + 0x2e4000cb: 477, // mfe-MU + 0x2e800000: 478, // mg + 0x2e8000be: 479, // mg-MG + 0x2e900000: 480, // mgh + 0x2e9000d0: 481, // mgh-MZ + 0x2eb00000: 482, // mgo + 0x2eb00051: 483, // mgo-CM + 0x2f600000: 484, // mk + 0x2f6000c1: 485, // mk-MK + 0x2fb00000: 486, // ml + 0x2fb00098: 487, // ml-IN + 0x30200000: 488, // mn + 0x302000c4: 489, // mn-MN + 0x31200000: 490, // mr + 0x31200098: 491, // mr-IN + 0x31600000: 492, // ms + 0x3160003d: 493, // ms-BN + 0x316000cf: 494, // ms-MY + 0x3160010c: 495, // ms-SG + 0x31700000: 496, // mt + 0x317000ca: 497, // mt-MT + 0x31c00000: 498, // mua + 0x31c00051: 499, // mua-CM + 0x32800000: 500, // my + 0x328000c3: 501, // my-MM + 0x33100000: 502, // mzn + 0x3310009b: 503, // mzn-IR + 0x33800000: 504, // nah + 0x33c00000: 505, // naq + 0x33c000d1: 506, // naq-NA + 0x33e00000: 507, // nb + 0x33e000d9: 508, // nb-NO + 0x33e0010f: 509, // nb-SJ + 0x34500000: 510, // nd + 0x34500163: 511, // nd-ZW + 0x34700000: 512, // nds + 0x3470005f: 513, // nds-DE + 0x347000d8: 514, // nds-NL + 0x34800000: 515, // ne + 0x34800098: 516, // ne-IN + 0x348000da: 517, // ne-NP + 0x35e00000: 518, // nl + 0x35e0002f: 519, // nl-AW + 0x35e00035: 520, // nl-BE + 0x35e0003f: 521, // nl-BQ + 0x35e0005a: 522, // nl-CW + 0x35e000d8: 523, // nl-NL + 0x35e00115: 524, // nl-SR + 0x35e0011a: 525, // nl-SX + 0x35f00000: 526, // nmg + 0x35f00051: 527, // nmg-CM + 0x36100000: 528, // nn + 0x361000d9: 529, // nn-NO + 0x36300000: 530, // nnh + 0x36300051: 531, // nnh-CM + 0x36600000: 532, // no + 0x36c00000: 533, // nqo + 0x36d00000: 534, // nr + 0x37100000: 535, // nso + 0x37700000: 536, // nus + 0x37700116: 537, // nus-SS + 0x37e00000: 538, // ny + 0x38000000: 539, // nyn + 0x38000130: 540, // nyn-UG + 0x38700000: 541, // om + 0x3870006e: 542, // om-ET + 0x387000a3: 543, // om-KE + 0x38c00000: 544, // or + 0x38c00098: 545, // or-IN + 0x38f00000: 546, // os + 0x38f0007c: 547, // os-GE + 0x38f00105: 548, // os-RU + 0x39400000: 549, // pa + 0x39405000: 550, // pa-Arab + 0x394050e7: 551, // pa-Arab-PK + 0x3942f000: 552, // pa-Guru + 0x3942f098: 553, // pa-Guru-IN + 0x39800000: 554, // pap + 0x3aa00000: 555, // pl + 0x3aa000e8: 556, // pl-PL + 0x3b400000: 557, // prg + 0x3b400001: 558, // prg-001 + 0x3b500000: 559, // ps + 0x3b500023: 560, // ps-AF + 0x3b700000: 561, // pt + 0x3b700029: 562, // pt-AO + 0x3b700040: 563, // pt-BR + 0x3b70004d: 564, // pt-CH + 0x3b700059: 565, // pt-CV + 0x3b700085: 566, // pt-GQ + 0x3b70008a: 567, // pt-GW + 0x3b7000b6: 568, // pt-LU + 0x3b7000c5: 569, // pt-MO + 0x3b7000d0: 570, // pt-MZ + 0x3b7000ed: 571, // pt-PT + 0x3b700117: 572, // pt-ST + 0x3b700125: 573, // pt-TL + 0x3bb00000: 574, // qu + 0x3bb0003e: 575, // qu-BO + 0x3bb00068: 576, // qu-EC + 0x3bb000e3: 577, // qu-PE + 0x3cb00000: 578, // rm + 0x3cb0004d: 579, // rm-CH + 0x3d000000: 580, // rn + 0x3d000039: 581, // rn-BI + 0x3d300000: 582, // ro + 0x3d3000bb: 583, // ro-MD + 0x3d300103: 584, // ro-RO + 0x3d500000: 585, // rof + 0x3d50012e: 586, // rof-TZ + 0x3d900000: 587, // ru + 0x3d900046: 588, // ru-BY + 0x3d9000a4: 589, // ru-KG + 0x3d9000ad: 590, // ru-KZ + 0x3d9000bb: 591, // ru-MD + 0x3d900105: 592, // ru-RU + 0x3d90012f: 593, // ru-UA + 0x3dc00000: 594, // rw + 0x3dc00106: 595, // rw-RW + 0x3dd00000: 596, // rwk + 0x3dd0012e: 597, // rwk-TZ + 0x3e200000: 598, // sah + 0x3e200105: 599, // sah-RU + 0x3e300000: 600, // saq + 0x3e3000a3: 601, // saq-KE + 0x3e900000: 602, // sbp + 0x3e90012e: 603, // sbp-TZ + 0x3f200000: 604, // sdh + 0x3f300000: 605, // se + 0x3f300071: 606, // se-FI + 0x3f3000d9: 607, // se-NO + 0x3f30010b: 608, // se-SE + 0x3f500000: 609, // seh + 0x3f5000d0: 610, // seh-MZ + 0x3f700000: 611, // ses + 0x3f7000c2: 612, // ses-ML + 0x3f800000: 613, // sg + 0x3f80004b: 614, // sg-CF + 0x3fe00000: 615, // shi + 0x3fe52000: 616, // shi-Latn + 0x3fe520b9: 617, // shi-Latn-MA + 0x3fed2000: 618, // shi-Tfng + 0x3fed20b9: 619, // shi-Tfng-MA + 0x40200000: 620, // si + 0x402000b2: 621, // si-LK + 0x40800000: 622, // sk + 0x40800110: 623, // sk-SK + 0x40c00000: 624, // sl + 0x40c0010e: 625, // sl-SI + 0x41200000: 626, // sma + 0x41300000: 627, // smi + 0x41400000: 628, // smj + 0x41500000: 629, // smn + 0x41500071: 630, // smn-FI + 0x41800000: 631, // sms + 0x41900000: 632, // sn + 0x41900163: 633, // sn-ZW + 0x41f00000: 634, // so + 0x41f00061: 635, // so-DJ + 0x41f0006e: 636, // so-ET + 0x41f000a3: 637, // so-KE + 0x41f00114: 638, // so-SO + 0x42700000: 639, // sq + 0x42700026: 640, // sq-AL + 0x427000c1: 641, // sq-MK + 0x4270014c: 642, // sq-XK + 0x42800000: 643, // sr + 0x4281e000: 644, // sr-Cyrl + 0x4281e032: 645, // sr-Cyrl-BA + 0x4281e0bc: 646, // sr-Cyrl-ME + 0x4281e104: 647, // sr-Cyrl-RS + 0x4281e14c: 648, // sr-Cyrl-XK + 0x42852000: 649, // sr-Latn + 0x42852032: 650, // sr-Latn-BA + 0x428520bc: 651, // sr-Latn-ME + 0x42852104: 652, // sr-Latn-RS + 0x4285214c: 653, // sr-Latn-XK + 0x42d00000: 654, // ss + 0x43000000: 655, // ssy + 0x43100000: 656, // st + 0x43a00000: 657, // sv + 0x43a00030: 658, // sv-AX + 0x43a00071: 659, // sv-FI + 0x43a0010b: 660, // sv-SE + 0x43b00000: 661, // sw + 0x43b0004a: 662, // sw-CD + 0x43b000a3: 663, // sw-KE + 0x43b0012e: 664, // sw-TZ + 0x43b00130: 665, // sw-UG + 0x44400000: 666, // syr + 0x44600000: 667, // ta + 0x44600098: 668, // ta-IN + 0x446000b2: 669, // ta-LK + 0x446000cf: 670, // ta-MY + 0x4460010c: 671, // ta-SG + 0x45700000: 672, // te + 0x45700098: 673, // te-IN + 0x45a00000: 674, // teo + 0x45a000a3: 675, // teo-KE + 0x45a00130: 676, // teo-UG + 0x46100000: 677, // th + 0x46100122: 678, // th-TH + 0x46500000: 679, // ti + 0x4650006c: 680, // ti-ER + 0x4650006e: 681, // ti-ET + 0x46700000: 682, // tig + 0x46c00000: 683, // tk + 0x46c00126: 684, // tk-TM + 0x47600000: 685, // tn + 0x47800000: 686, // to + 0x47800128: 687, // to-TO + 0x48000000: 688, // tr + 0x4800005c: 689, // tr-CY + 0x4800012a: 690, // tr-TR + 0x48400000: 691, // ts + 0x49a00000: 692, // twq + 0x49a000d3: 693, // twq-NE + 0x49f00000: 694, // tzm + 0x49f000b9: 695, // tzm-MA + 0x4a200000: 696, // ug + 0x4a200052: 697, // ug-CN + 0x4a400000: 698, // uk + 0x4a40012f: 699, // uk-UA + 0x4aa00000: 700, // ur + 0x4aa00098: 701, // ur-IN + 0x4aa000e7: 702, // ur-PK + 0x4b200000: 703, // uz + 0x4b205000: 704, // uz-Arab + 0x4b205023: 705, // uz-Arab-AF + 0x4b21e000: 706, // uz-Cyrl + 0x4b21e136: 707, // uz-Cyrl-UZ + 0x4b252000: 708, // uz-Latn + 0x4b252136: 709, // uz-Latn-UZ + 0x4b400000: 710, // vai + 0x4b452000: 711, // vai-Latn + 0x4b4520b3: 712, // vai-Latn-LR + 0x4b4d9000: 713, // vai-Vaii + 0x4b4d90b3: 714, // vai-Vaii-LR + 0x4b600000: 715, // ve + 0x4b900000: 716, // vi + 0x4b90013d: 717, // vi-VN + 0x4bf00000: 718, // vo + 0x4bf00001: 719, // vo-001 + 0x4c200000: 720, // vun + 0x4c20012e: 721, // vun-TZ + 0x4c400000: 722, // wa + 0x4c500000: 723, // wae + 0x4c50004d: 724, // wae-CH + 0x4db00000: 725, // wo + 0x4e800000: 726, // xh + 0x4f100000: 727, // xog + 0x4f100130: 728, // xog-UG + 0x4ff00000: 729, // yav + 0x4ff00051: 730, // yav-CM + 0x50800000: 731, // yi + 0x50800001: 732, // yi-001 + 0x50e00000: 733, // yo + 0x50e0003a: 734, // yo-BJ + 0x50e000d5: 735, // yo-NG + 0x51500000: 736, // yue + 0x5150008c: 737, // yue-HK + 0x51e00000: 738, // zgh + 0x51e000b9: 739, // zgh-MA + 0x51f00000: 740, // zh + 0x51f34000: 741, // zh-Hans + 0x51f34052: 742, // zh-Hans-CN + 0x51f3408c: 743, // zh-Hans-HK + 0x51f340c5: 744, // zh-Hans-MO + 0x51f3410c: 745, // zh-Hans-SG + 0x51f35000: 746, // zh-Hant + 0x51f3508c: 747, // zh-Hant-HK + 0x51f350c5: 748, // zh-Hant-MO + 0x51f3512d: 749, // zh-Hant-TW + 0x52400000: 750, // zu + 0x52400160: 751, // zu-ZA +} + +// Total table size 4580 bytes (4KiB); checksum: A7F72A2A diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go new file mode 100644 index 000000000..5eecceb61 --- /dev/null +++ b/vendor/golang.org/x/text/language/language.go @@ -0,0 +1,975 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run maketables.go gen_common.go -output tables.go +//go:generate go run gen_index.go + +// Package language implements BCP 47 language tags and related functionality. +// +// The Tag type, which is used to represent languages, is agnostic to the +// meaning of its subtags. Tags are not fully canonicalized to preserve +// information that may be valuable in certain contexts. As a consequence, two +// different tags may represent identical languages. +// +// Initializing language- or locale-specific components usually consists of +// two steps. The first step is to select a display language based on the +// preferred languages of the user and the languages supported by an application. +// The second step is to create the language-specific services based on +// this selection. Each is discussed in more details below. +// +// Matching preferred against supported languages +// +// An application may support various languages. This list is typically limited +// by the languages for which there exists translations of the user interface. +// Similarly, a user may provide a list of preferred languages which is limited +// by the languages understood by this user. +// An application should use a Matcher to find the best supported language based +// on the user's preferred list. +// Matchers are aware of the intricacies of equivalence between languages. +// The default Matcher implementation takes into account things such as +// deprecated subtags, legacy tags, and mutual intelligibility between scripts +// and languages. +// +// A Matcher for English, Australian English, Danish, and standard Mandarin can +// be defined as follows: +// +// var matcher = language.NewMatcher([]language.Tag{ +// language.English, // The first language is used as fallback. +// language.MustParse("en-AU"), +// language.Danish, +// language.Chinese, +// }) +// +// The following code selects the best match for someone speaking Spanish and +// Norwegian: +// +// preferred := []language.Tag{ language.Spanish, language.Norwegian } +// tag, _, _ := matcher.Match(preferred...) +// +// In this case, the best match is Danish, as Danish is sufficiently a match to +// Norwegian to not have to fall back to the default. +// See ParseAcceptLanguage on how to handle the Accept-Language HTTP header. +// +// Selecting language-specific services +// +// One should always use the Tag returned by the Matcher to create an instance +// of any of the language-specific services provided by the text repository. +// This prevents the mixing of languages, such as having a different language for +// messages and display names, as well as improper casing or sorting order for +// the selected language. +// Using the returned Tag also allows user-defined settings, such as collation +// order or numbering system to be transparently passed as options. +// +// If you have language-specific data in your application, however, it will in +// most cases suffice to use the index returned by the matcher to identify +// the user language. +// The following loop provides an alternative in case this is not sufficient: +// +// supported := map[language.Tag]data{ +// language.English: enData, +// language.MustParse("en-AU"): enAUData, +// language.Danish: daData, +// language.Chinese: zhData, +// } +// tag, _, _ := matcher.Match(preferred...) +// for ; tag != language.Und; tag = tag.Parent() { +// if v, ok := supported[tag]; ok { +// return v +// } +// } +// return enData // should not reach here +// +// Repeatedly taking the Parent of the tag returned by Match will eventually +// match one of the tags used to initialize the Matcher. +// +// Canonicalization +// +// By default, only legacy and deprecated tags are converted into their +// canonical equivalent. All other information is preserved. This approach makes +// the confidence scores more accurate and allows matchers to distinguish +// between variants that are otherwise lost. +// +// As a consequence, two tags that should be treated as identical according to +// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The +// Matchers will handle such distinctions, though, and are aware of the +// equivalence relations. The CanonType type can be used to alter the +// canonicalization form. +// +// References +// +// BCP 47 - Tags for Identifying Languages +// http://tools.ietf.org/html/bcp47 +package language // import "golang.org/x/text/language" + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "errors" + "fmt" + "strings" +) + +const ( + // maxCoreSize is the maximum size of a BCP 47 tag without variants and + // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. + maxCoreSize = 12 + + // max99thPercentileSize is a somewhat arbitrary buffer size that presumably + // is large enough to hold at least 99% of the BCP 47 tags. + max99thPercentileSize = 32 + + // maxSimpleUExtensionSize is the maximum size of a -u extension with one + // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). + maxSimpleUExtensionSize = 14 +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag struct { + lang langID + region regionID + script scriptID + pVariant byte // offset in str, includes preceding '-' + pExt uint16 // offset of first extension, includes preceding '-' + + // str is the string representation of the Tag. It will only be used if the + // tag has variants or extensions. + str string +} + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + return Default.Make(s) +} + +// Make is a convenience wrapper for c.Parse that omits the error. +// In case of an error, a sensible default is returned. +func (c CanonType) Make(s string) Tag { + t, _ := c.Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +func (t Tag) Raw() (b Base, s Script, r Region) { + return Base{t.lang}, Script{t.script}, Region{t.region} +} + +// equalTags compares language, script and region subtags only. +func (t Tag) equalTags(a Tag) bool { + return t.lang == a.lang && t.script == a.script && t.region == a.region +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if int(t.pVariant) < len(t.str) { + return false + } + return t.equalTags(und) +} + +// private reports whether the Tag consists solely of a private use tag. +func (t Tag) private() bool { + return t.str != "" && t.pVariant == 0 +} + +// CanonType can be used to enable or disable various types of canonicalization. +type CanonType int + +const ( + // Replace deprecated base languages with their preferred replacements. + DeprecatedBase CanonType = 1 << iota + // Replace deprecated scripts with their preferred replacements. + DeprecatedScript + // Replace deprecated regions with their preferred replacements. + DeprecatedRegion + // Remove redundant scripts. + SuppressScript + // Normalize legacy encodings. This includes legacy languages defined in + // CLDR as well as bibliographic codes defined in ISO-639. + Legacy + // Map the dominant language of a macro language group to the macro language + // subtag. For example cmn -> zh. + Macro + // The CLDR flag should be used if full compatibility with CLDR is required. + // There are a few cases where language.Tag may differ from CLDR. To follow all + // of CLDR's suggestions, use All|CLDR. + CLDR + + // Raw can be used to Compose or Parse without Canonicalization. + Raw CanonType = 0 + + // Replace all deprecated tags with their preferred replacements. + Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion + + // All canonicalizations recommended by BCP 47. + BCP47 = Deprecated | SuppressScript + + // All canonicalizations. + All = BCP47 | Legacy | Macro + + // Default is the canonicalization used by Parse, Make and Compose. To + // preserve as much information as possible, canonicalizations that remove + // potentially valuable information are not included. The Matcher is + // designed to recognize similar tags that would be the same if + // they were canonicalized using All. + Default = Deprecated | Legacy + + canonLang = DeprecatedBase | Legacy | Macro + + // TODO: LikelyScript, LikelyRegion: suppress similar to ICU. +) + +// canonicalize returns the canonicalized equivalent of the tag and +// whether there was any change. +func (t Tag) canonicalize(c CanonType) (Tag, bool) { + if c == Raw { + return t, false + } + changed := false + if c&SuppressScript != 0 { + if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] { + t.script = 0 + changed = true + } + } + if c&canonLang != 0 { + for { + if l, aliasType := normLang(t.lang); l != t.lang { + switch aliasType { + case langLegacy: + if c&Legacy != 0 { + if t.lang == _sh && t.script == 0 { + t.script = _Latn + } + t.lang = l + changed = true + } + case langMacro: + if c&Macro != 0 { + // We deviate here from CLDR. The mapping "nb" -> "no" + // qualifies as a typical Macro language mapping. However, + // for legacy reasons, CLDR maps "no", the macro language + // code for Norwegian, to the dominant variant "nb". This + // change is currently under consideration for CLDR as well. + // See http://unicode.org/cldr/trac/ticket/2698 and also + // http://unicode.org/cldr/trac/ticket/1790 for some of the + // practical implications. TODO: this check could be removed + // if CLDR adopts this change. + if c&CLDR == 0 || t.lang != _nb { + changed = true + t.lang = l + } + } + case langDeprecated: + if c&DeprecatedBase != 0 { + if t.lang == _mo && t.region == 0 { + t.region = _MD + } + t.lang = l + changed = true + // Other canonicalization types may still apply. + continue + } + } + } else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 { + t.lang = _nb + changed = true + } + break + } + } + if c&DeprecatedScript != 0 { + if t.script == _Qaai { + changed = true + t.script = _Zinh + } + } + if c&DeprecatedRegion != 0 { + if r := normRegion(t.region); r != 0 { + changed = true + t.region = r + } + } + return t, changed +} + +// Canonicalize returns the canonicalized equivalent of the tag. +func (c CanonType) Canonicalize(t Tag) (Tag, error) { + t, changed := t.canonicalize(c) + if changed { + t.remakeString() + } + return t, nil +} + +// Confidence indicates the level of certainty for a given return value. +// For example, Serbian may be written in Cyrillic or Latin script. +// The confidence level indicates whether a value was explicitly specified, +// whether it is typically the only possible value, or whether there is +// an ambiguity. +type Confidence int + +const ( + No Confidence = iota // full confidence that there was no match + Low // most likely value picked out of a set of alternatives + High // value is generally assumed to be the correct match + Exact // exact match or explicitly specified value +) + +var confName = []string{"No", "Low", "High", "Exact"} + +func (c Confidence) String() string { + return confName[c] +} + +// remakeString is used to update t.str in case lang, script or region changed. +// It is assumed that pExt and pVariant still point to the start of the +// respective parts. +func (t *Tag) remakeString() { + if t.str == "" { + return + } + extra := t.str[t.pVariant:] + if t.pVariant > 0 { + extra = extra[1:] + } + if t.equalTags(und) && strings.HasPrefix(extra, "x-") { + t.str = extra + t.pVariant = 0 + t.pExt = 0 + return + } + var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. + b := buf[:t.genCoreBytes(buf[:])] + if extra != "" { + diff := len(b) - int(t.pVariant) + b = append(b, '-') + b = append(b, extra...) + t.pVariant = uint8(int(t.pVariant) + diff) + t.pExt = uint16(int(t.pExt) + diff) + } else { + t.pVariant = uint8(len(b)) + t.pExt = uint16(len(b)) + } + t.str = string(b) +} + +// genCoreBytes writes a string for the base languages, script and region tags +// to the given buffer and returns the number of bytes written. It will never +// write more than maxCoreSize bytes. +func (t *Tag) genCoreBytes(buf []byte) int { + n := t.lang.stringToBuf(buf[:]) + if t.script != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.script.String()) + } + if t.region != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.region.String()) + } + return n +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + if t.str != "" { + return t.str + } + if t.script == 0 && t.region == 0 { + return t.lang.String() + } + buf := [maxCoreSize]byte{} + return string(buf[:t.genCoreBytes(buf[:])]) +} + +// Base returns the base language of the language tag. If the base language is +// unspecified, an attempt will be made to infer it from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Base() (Base, Confidence) { + if t.lang != 0 { + return Base{t.lang}, Exact + } + c := High + if t.script == 0 && !(Region{t.region}).IsCountry() { + c = Low + } + if tag, err := addTags(t); err == nil && tag.lang != 0 { + return Base{tag.lang}, c + } + return Base{0}, No +} + +// Script infers the script for the language tag. If it was not explicitly given, it will infer +// a most likely candidate. +// If more than one script is commonly used for a language, the most likely one +// is returned with a low confidence indication. For example, it returns (Cyrl, Low) +// for Serbian. +// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) +// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks +// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. +// See http://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for +// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. +// Note that an inferred script is never guaranteed to be the correct one. Latin is +// almost exclusively used for Afrikaans, but Arabic has been used for some texts +// in the past. Also, the script that is commonly used may change over time. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Script() (Script, Confidence) { + if t.script != 0 { + return Script{t.script}, Exact + } + sc, c := scriptID(_Zzzz), No + if t.lang < langNoIndexOffset { + if scr := scriptID(suppressScript[t.lang]); scr != 0 { + // Note: it is not always the case that a language with a suppress + // script value is only written in one script (e.g. kk, ms, pa). + if t.region == 0 { + return Script{scriptID(scr)}, High + } + sc, c = scr, High + } + } + if tag, err := addTags(t); err == nil { + if tag.script != sc { + sc, c = tag.script, Low + } + } else { + t, _ = (Deprecated | Macro).Canonicalize(t) + if tag, err := addTags(t); err == nil && tag.script != sc { + sc, c = tag.script, Low + } + } + return Script{sc}, c +} + +// Region returns the region for the language tag. If it was not explicitly given, it will +// infer a most likely candidate from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Region() (Region, Confidence) { + if t.region != 0 { + return Region{t.region}, Exact + } + if t, err := addTags(t); err == nil { + return Region{t.region}, Low // TODO: differentiate between high and low. + } + t, _ = (Deprecated | Macro).Canonicalize(t) + if tag, err := addTags(t); err == nil { + return Region{tag.region}, Low + } + return Region{_ZZ}, No // TODO: return world instead of undetermined? +} + +// Variant returns the variants specified explicitly for this language tag. +// or nil if no variant was specified. +func (t Tag) Variants() []Variant { + v := []Variant{} + if int(t.pVariant) < int(t.pExt) { + for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; { + x, str = nextToken(str) + v = append(v, Variant{x}) + } + } + return v +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.str != "" { + // Strip the variants and extensions. + t, _ = Raw.Compose(t.Raw()) + if t.region == 0 && t.script != 0 && t.lang != 0 { + base, _ := addTags(Tag{lang: t.lang}) + if base.script == t.script { + return Tag{lang: t.lang} + } + } + return t + } + if t.lang != 0 { + if t.region != 0 { + maxScript := t.script + if maxScript == 0 { + max, _ := addTags(t) + maxScript = max.script + } + + for i := range parents { + if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript { + for _, r := range parents[i].fromRegion { + if regionID(r) == t.region { + return Tag{ + lang: t.lang, + script: scriptID(parents[i].script), + region: regionID(parents[i].toRegion), + } + } + } + } + } + + // Strip the script if it is the default one. + base, _ := addTags(Tag{lang: t.lang}) + if base.script != maxScript { + return Tag{lang: t.lang, script: maxScript} + } + return Tag{lang: t.lang} + } else if t.script != 0 { + // The parent for an base-script pair with a non-default script is + // "und" instead of the base language. + base, _ := addTags(Tag{lang: t.lang}) + if base.script != t.script { + return und + } + return Tag{lang: t.lang} + } + } + return und +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// Extension is a single BCP 47 extension. +type Extension struct { + s string +} + +// String returns the string representation of the extension, including the +// type tag. +func (e Extension) String() string { + return e.s +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (e Extension, err error) { + scan := makeScannerString(s) + var end int + if n := len(scan.token); n != 1 { + return Extension{}, errSyntax + } + scan.toLower(0, len(scan.b)) + end = parseExtension(&scan) + if end != len(s) { + return Extension{}, errSyntax + } + return Extension{string(scan.b)}, nil +} + +// Type returns the one-byte extension type of e. It returns 0 for the zero +// exception. +func (e Extension) Type() byte { + if e.s == "" { + return 0 + } + return e.s[0] +} + +// Tokens returns the list of tokens of e. +func (e Extension) Tokens() []string { + return strings.Split(e.s, "-") +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext Extension, ok bool) { + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + if ext[0] == x { + return Extension{ext}, true + } + } + return Extension{}, false +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []Extension { + e := []Extension{} + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + e = append(e, Extension{ext}) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +func (t Tag) TypeForKey(key string) string { + if start, end, _ := t.findTypeForKey(key); end != start { + return t.str[start:end] + } + return "" +} + +var ( + errPrivateUse = errors.New("cannot set a key on a private use tag") + errInvalidArguments = errors.New("invalid key or type") +) + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + if t.private() { + return t, errPrivateUse + } + if len(key) != 2 { + return t, errInvalidArguments + } + + // Remove the setting if value is "". + if value == "" { + start, end, _ := t.findTypeForKey(key) + if start != end { + // Remove key tag and leading '-'. + start -= 4 + + // Remove a possible empty extension. + if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' { + start -= 2 + } + if start == int(t.pVariant) && end == len(t.str) { + t.str = "" + t.pVariant, t.pExt = 0, 0 + } else { + t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) + } + } + return t, nil + } + + if len(value) < 3 || len(value) > 8 { + return t, errInvalidArguments + } + + var ( + buf [maxCoreSize + maxSimpleUExtensionSize]byte + uStart int // start of the -u extension. + ) + + // Generate the tag string if needed. + if t.str == "" { + uStart = t.genCoreBytes(buf[:]) + buf[uStart] = '-' + uStart++ + } + + // Create new key-type pair and parse it to verify. + b := buf[uStart:] + copy(b, "u-") + copy(b[2:], key) + b[4] = '-' + b = b[:5+copy(b[5:], value)] + scan := makeScanner(b) + if parseExtensions(&scan); scan.err != nil { + return t, scan.err + } + + // Assemble the replacement string. + if t.str == "" { + t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) + t.str = string(buf[:uStart+len(b)]) + } else { + s := t.str + start, end, hasExt := t.findTypeForKey(key) + if start == end { + if hasExt { + b = b[2:] + } + t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:]) + } else { + t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:]) + } + } + return t, nil +} + +// findKeyAndType returns the start and end position for the type corresponding +// to key or the point at which to insert the key-value pair if the type +// wasn't found. The hasExt return value reports whether an -u extension was present. +// Note: the extensions are typically very small and are likely to contain +// only one key-type pair. +func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) { + p := int(t.pExt) + if len(key) != 2 || p == len(t.str) || p == 0 { + return p, p, false + } + s := t.str + + // Find the correct extension. + for p++; s[p] != 'u'; p++ { + if s[p] > 'u' { + p-- + return p, p, false + } + if p = nextExtension(s, p); p == len(s) { + return len(s), len(s), false + } + } + // Proceed to the hyphen following the extension name. + p++ + + // curKey is the key currently being processed. + curKey := "" + + // Iterate over keys until we get the end of a section. + for { + // p points to the hyphen preceding the current token. + if p3 := p + 3; s[p3] == '-' { + // Found a key. + // Check whether we just processed the key that was requested. + if curKey == key { + return start, p, true + } + // Set to the next key and continue scanning type tokens. + curKey = s[p+1 : p3] + if curKey > key { + return p, p, true + } + // Start of the type token sequence. + start = p + 4 + // A type is at least 3 characters long. + p += 7 // 4 + 3 + } else { + // Attribute or type, which is at least 3 characters long. + p += 4 + } + // p points past the third character of a type or attribute. + max := p + 5 // maximum length of token plus hyphen. + if len(s) < max { + max = len(s) + } + for ; p < max && s[p] != '-'; p++ { + } + // Bail if we have exhausted all tokens or if the next token starts + // a new extension. + if p == len(s) || s[p+2] == '-' { + if curKey == key { + return start, p, true + } + return p, p, true + } + } +} + +// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository. The index will change over time +// and should not be stored in persistent storage. Extensions, except for the +// 'va' type of the 'u' extension, are ignored. It will return 0, false if no +// compact tag exists, where 0 is the index for the root language (Und). +func CompactIndex(t Tag) (index int, ok bool) { + // TODO: perhaps give more frequent tags a lower index. + // TODO: we could make the indexes stable. This will excluded some + // possibilities for optimization, so don't do this quite yet. + b, s, r := t.Raw() + if len(t.str) > 0 { + if strings.HasPrefix(t.str, "x-") { + // We have no entries for user-defined tags. + return 0, false + } + if uint16(t.pVariant) != t.pExt { + // There are no tags with variants and an u-va type. + if t.TypeForKey("va") != "" { + return 0, false + } + t, _ = Raw.Compose(b, s, r, t.Variants()) + } else if _, ok := t.Extension('u'); ok { + // Strip all but the 'va' entry. + variant := t.TypeForKey("va") + t, _ = Raw.Compose(b, s, r) + t, _ = t.SetTypeForKey("va", variant) + } + if len(t.str) > 0 { + // We have some variants. + for i, s := range specialTags { + if s == t { + return i + 1, true + } + } + return 0, false + } + } + // No variants specified: just compare core components. + // The key has the form lllssrrr, where l, s, and r are nibbles for + // respectively the langID, scriptID, and regionID. + key := uint32(b.langID) << (8 + 12) + key |= uint32(s.scriptID) << 12 + key |= uint32(r.regionID) + x, ok := coreTags[key] + return int(x), ok +} + +// Base is an ISO 639 language code, used for encoding the base language +// of a language tag. +type Base struct { + langID +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Base, error) { + if n := len(s); n < 2 || 3 < n { + return Base{}, errSyntax + } + var buf [3]byte + l, err := getLangID(buf[:copy(buf[:], s)]) + return Base{l}, err +} + +// Script is a 4-letter ISO 15924 code for representing scripts. +// It is idiomatically represented in title case. +type Script struct { + scriptID +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + if len(s) != 4 { + return Script{}, errSyntax + } + var buf [4]byte + sc, err := getScriptID(script, buf[:copy(buf[:], s)]) + return Script{sc}, err +} + +// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. +type Region struct { + regionID +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + rid, err := getRegionM49(r) + return Region{rid}, err +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + if n := len(s); n < 2 || 3 < n { + return Region{}, errSyntax + } + var buf [3]byte + r, err := getRegionID(buf[:copy(buf[:], s)]) + return Region{r}, err +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK { + return false + } + return true +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + if r.regionID == 0 { + return false + } + return int(regionInclusion[r.regionID]) < len(regionContainment) +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + return r.regionID.contains(c.regionID) +} + +func (r regionID) contains(c regionID) bool { + if r == c { + return true + } + g := regionInclusion[r] + if g >= nRegionGroups { + return false + } + m := regionContainment[g] + + d := regionInclusion[c] + b := regionInclusionBits[d] + + // A contained country may belong to multiple disjoint groups. Matching any + // of these indicates containment. If the contained region is a group, it + // must strictly be a subset. + if d >= nRegionGroups { + return b&m != 0 + } + return b&^m == 0 +} + +var errNoTLD = errors.New("language: region is not a valid ccTLD") + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the + // difference between ISO 3166-1 and IANA ccTLD. + if r.regionID == _GB { + r = Region{_UK} + } + if (r.typ() & ccTLD) == 0 { + return Region{}, errNoTLD + } + return r, nil +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + if cr := normRegion(r.regionID); cr != 0 { + return Region{cr} + } + return r +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + variant string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + s = strings.ToLower(s) + if _, ok := variantIndex[s]; ok { + return Variant{s}, nil + } + return Variant{}, mkErrInvalid([]byte(s)) +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.variant +} diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/language/lookup.go new file mode 100644 index 000000000..1d80ac370 --- /dev/null +++ b/vendor/golang.org/x/text/language/lookup.go @@ -0,0 +1,396 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "fmt" + "sort" + "strconv" + + "golang.org/x/text/internal/tag" +) + +// findIndex tries to find the given tag in idx and returns a standardized error +// if it could not be found. +func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { + if !tag.FixCase(form, key) { + return 0, errSyntax + } + i := idx.Index(key) + if i == -1 { + return 0, mkErrInvalid(key) + } + return i, nil +} + +func searchUint(imap []uint16, key uint16) int { + return sort.Search(len(imap), func(i int) bool { + return imap[i] >= key + }) +} + +type langID uint16 + +// getLangID returns the langID of s if s is a canonical subtag +// or langUnknown if s is not a canonical subtag. +func getLangID(s []byte) (langID, error) { + if len(s) == 2 { + return getLangISO2(s) + } + return getLangISO3(s) +} + +// mapLang returns the mapped langID of id according to mapping m. +func normLang(id langID) (langID, langAliasType) { + k := sort.Search(len(langAliasMap), func(i int) bool { + return langAliasMap[i].from >= uint16(id) + }) + if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) { + return langID(langAliasMap[k].to), langAliasTypes[k] + } + return id, langAliasTypeUnknown +} + +// getLangISO2 returns the langID for the given 2-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO2(s []byte) (langID, error) { + if !tag.FixCase("zz", s) { + return 0, errSyntax + } + if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { + return langID(i), nil + } + return 0, mkErrInvalid(s) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s []byte) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +// getLangISO3 returns the langID for the given 3-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO3(s []byte) (langID, error) { + if tag.FixCase("und", s) { + // first try to match canonical 3-letter entries + for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { + if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { + // We treat "und" as special and always translate it to "unspecified". + // Note that ZZ and Zzzz are private use and are not treated as + // unspecified by default. + id := langID(i) + if id == nonCanonicalUnd { + return 0, nil + } + return id, nil + } + } + if i := altLangISO3.Index(s); i != -1 { + return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil + } + n := strToInt(s) + if langNoIndex[n/8]&(1<<(n%8)) != 0 { + return langID(n) + langNoIndexOffset, nil + } + // Check for non-canonical uses of ISO3. + for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { + if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { + return langID(i), nil + } + } + return 0, mkErrInvalid(s) + } + return 0, errSyntax +} + +// stringToBuf writes the string to b and returns the number of bytes +// written. cap(b) must be >= 3. +func (id langID) stringToBuf(b []byte) int { + if id >= langNoIndexOffset { + intToStr(uint(id)-langNoIndexOffset, b[:3]) + return 3 + } else if id == 0 { + return copy(b, "und") + } + l := lang[id<<2:] + if l[3] == 0 { + return copy(b, l[:3]) + } + return copy(b, l[:2]) +} + +// String returns the BCP 47 representation of the langID. +// Use b as variable name, instead of id, to ensure the variable +// used is consistent with that of Base in which this type is embedded. +func (b langID) String() string { + if b == 0 { + return "und" + } else if b >= langNoIndexOffset { + b -= langNoIndexOffset + buf := [3]byte{} + intToStr(uint(b), buf[:]) + return string(buf[:]) + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } + return l[:2] +} + +// ISO3 returns the ISO 639-3 language code. +func (b langID) ISO3() string { + if b == 0 || b >= langNoIndexOffset { + return b.String() + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } else if l[2] == 0 { + return altLangISO3.Elem(int(l[3]))[:3] + } + // This allocation will only happen for 3-letter ISO codes + // that are non-canonical BCP 47 language identifiers. + return l[0:1] + l[2:4] +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b langID) IsPrivateUse() bool { + return langPrivateStart <= b && b <= langPrivateEnd +} + +type regionID uint16 + +// getRegionID returns the region id for s if s is a valid 2-letter region code +// or unknownRegion. +func getRegionID(s []byte) (regionID, error) { + if len(s) == 3 { + if isAlpha(s[0]) { + return getRegionISO3(s) + } + if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { + return getRegionM49(int(i)) + } + } + return getRegionISO2(s) +} + +// getRegionISO2 returns the regionID for the given 2-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO2(s []byte) (regionID, error) { + i, err := findIndex(regionISO, s, "ZZ") + if err != nil { + return 0, err + } + return regionID(i) + isoRegionOffset, nil +} + +// getRegionISO3 returns the regionID for the given 3-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO3(s []byte) (regionID, error) { + if tag.FixCase("ZZZ", s) { + for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { + if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { + return regionID(i) + isoRegionOffset, nil + } + } + for i := 0; i < len(altRegionISO3); i += 3 { + if tag.Compare(altRegionISO3[i:i+3], s) == 0 { + return regionID(altRegionIDs[i/3]), nil + } + } + return 0, mkErrInvalid(s) + } + return 0, errSyntax +} + +func getRegionM49(n int) (regionID, error) { + if 0 < n && n <= 999 { + const ( + searchBits = 7 + regionBits = 9 + regionMask = 1<<regionBits - 1 + ) + idx := n >> searchBits + buf := fromM49[m49Index[idx]:m49Index[idx+1]] + val := uint16(n) << regionBits // we rely on bits shifting out + i := sort.Search(len(buf), func(i int) bool { + return buf[i] >= val + }) + if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { + return regionID(r & regionMask), nil + } + } + var e ValueError + fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) + return 0, e +} + +// normRegion returns a region if r is deprecated or 0 otherwise. +// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). +// TODO: consider mapping split up regions to new most populous one (like CLDR). +func normRegion(r regionID) regionID { + m := regionOldMap + k := sort.Search(len(m), func(i int) bool { + return m[i].from >= uint16(r) + }) + if k < len(m) && m[k].from == uint16(r) { + return regionID(m[k].to) + } + return 0 +} + +const ( + iso3166UserAssigned = 1 << iota + ccTLD + bcp47Region +) + +func (r regionID) typ() byte { + return regionTypes[r] +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r regionID) String() string { + if r < isoRegionOffset { + if r == 0 { + return "ZZ" + } + return fmt.Sprintf("%03d", r.M49()) + } + r -= isoRegionOffset + return regionISO.Elem(int(r))[:2] +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r regionID) ISO3() string { + if r < isoRegionOffset { + return "ZZZ" + } + r -= isoRegionOffset + reg := regionISO.Elem(int(r)) + switch reg[2] { + case 0: + return altRegionISO3[reg[3]:][:3] + case ' ': + return "ZZZ" + } + return reg[0:1] + reg[2:4] +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r regionID) M49() int { + return int(m49[r]) +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r regionID) IsPrivateUse() bool { + return r.typ()&iso3166UserAssigned != 0 +} + +type scriptID uint8 + +// getScriptID returns the script id for string s. It assumes that s +// is of the format [A-Z][a-z]{3}. +func getScriptID(idx tag.Index, s []byte) (scriptID, error) { + i, err := findIndex(idx, s, "Zzzz") + return scriptID(i), err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s scriptID) String() string { + if s == 0 { + return "Zzzz" + } + return script.Elem(int(s)) +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s scriptID) IsPrivateUse() bool { + return _Qaaa <= s && s <= _Qabx +} + +const ( + maxAltTaglen = len("en-US-POSIX") + maxLen = maxAltTaglen +) + +var ( + // grandfatheredMap holds a mapping from legacy and grandfathered tags to + // their base language or index to more elaborate tag. + grandfatheredMap = map[[maxLen]byte]int16{ + [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban + [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami + [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn + [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak + [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon + [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux + [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo + [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn + [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao + [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay + [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu + [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok + [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL + [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE + [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu + [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan + [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang + + // Grandfathered tags with no modern replacement will be converted as + // follows: + [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish + [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed + [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default + [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian + [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min + + // CLDR-specific tag. + [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root + [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" + } + + altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} + + altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" +) + +func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { + if v, ok := grandfatheredMap[s]; ok { + if v < 0 { + return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true + } + t.lang = langID(v) + return t, true + } + return t, false +} diff --git a/vendor/golang.org/x/text/language/maketables.go b/vendor/golang.org/x/text/language/maketables.go new file mode 100644 index 000000000..107f99254 --- /dev/null +++ b/vendor/golang.org/x/text/language/maketables.go @@ -0,0 +1,1648 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +// Language tag table generator. +// Data read from the web. + +package main + +import ( + "bufio" + "flag" + "fmt" + "io" + "io/ioutil" + "log" + "math" + "reflect" + "regexp" + "sort" + "strconv" + "strings" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/internal/tag" + "golang.org/x/text/unicode/cldr" +) + +var ( + test = flag.Bool("test", + false, + "test existing tables; can be used to compare web data with package data.") + outputFile = flag.String("output", + "tables.go", + "output file for generated tables") +) + +var comment = []string{ + ` +lang holds an alphabetically sorted list of ISO-639 language identifiers. +All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +For 2-byte language identifiers, the two successive bytes have the following meaning: + - if the first letter of the 2- and 3-letter ISO codes are the same: + the second and third letter of the 3-letter ISO code. + - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +For 3-byte language identifiers the 4th byte is 0.`, + ` +langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +in lookup tables. The language ids for these language codes are derived directly +from the letters and are not consecutive.`, + ` +altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +to 2-letter language codes that cannot be derived using the method described above. +Each 3-letter code is followed by its 1-byte langID.`, + ` +altLangIndex is used to convert indexes in altLangISO3 to langIDs.`, + ` +langAliasMap maps langIDs to their suggested replacements.`, + ` +script is an alphabetically sorted list of ISO 15924 codes. The index +of the script in the string, divided by 4, is the internal scriptID.`, + ` +isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +the UN.M49 codes used for groups.)`, + ` +regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +Each 2-letter codes is followed by two bytes with the following meaning: + - [A-Z}{2}: the first letter of the 2-letter code plus these two + letters form the 3-letter ISO code. + - 0, n: index into altRegionISO3.`, + ` +regionTypes defines the status of a region for various standards.`, + ` +m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +codes indicating collections of regions.`, + ` +m49Index gives indexes into fromM49 based on the three most significant bits +of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in + fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +The region code is stored in the 9 lsb of the indexed value.`, + ` +fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`, + ` +altRegionISO3 holds a list of 3-letter region codes that cannot be +mapped to 2-letter codes using the default algorithm. This is a short list.`, + ` +altRegionIDs holds a list of regionIDs the positions of which match those +of the 3-letter ISO codes in altRegionISO3.`, + ` +variantNumSpecialized is the number of specialized variants in variants.`, + ` +suppressScript is an index from langID to the dominant script for that language, +if it exists. If a script is given, it should be suppressed from the language tag.`, + ` +likelyLang is a lookup table, indexed by langID, for the most likely +scripts and regions given incomplete information. If more entries exist for a +given language, region and script are the index and size respectively +of the list in likelyLangList.`, + ` +likelyLangList holds lists info associated with likelyLang.`, + ` +likelyRegion is a lookup table, indexed by regionID, for the most likely +languages and scripts given incomplete information. If more entries exist +for a given regionID, lang and script are the index and size respectively +of the list in likelyRegionList. +TODO: exclude containers and user-definable regions from the list.`, + ` +likelyRegionList holds lists info associated with likelyRegion.`, + ` +likelyScript is a lookup table, indexed by scriptID, for the most likely +languages and regions given a script.`, + ` +matchLang holds pairs of langIDs of base languages that are typically +mutually intelligible. Each pair is associated with a confidence and +whether the intelligibility goes one or both ways.`, + ` +matchScript holds pairs of scriptIDs where readers of one script +can typically also read the other. Each is associated with a confidence.`, + ` +nRegionGroups is the number of region groups.`, + ` +regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +where each set holds all groupings that are directly connected in a region +containment graph.`, + ` +regionInclusionBits is an array of bit vectors where every vector represents +a set of region groupings. These sets are used to compute the distance +between two regions for the purpose of language matching.`, + ` +regionInclusionNext marks, for each entry in regionInclusionBits, the set of +all groups that are reachable from the groups set in the respective entry.`, +} + +// TODO: consider changing some of these structures to tries. This can reduce +// memory, but may increase the need for memory allocations. This could be +// mitigated if we can piggyback on language tags for common cases. + +func failOnError(e error) { + if e != nil { + log.Panic(e) + } +} + +type setType int + +const ( + Indexed setType = 1 + iota // all elements must be of same size + Linear +) + +type stringSet struct { + s []string + sorted, frozen bool + + // We often need to update values after the creation of an index is completed. + // We include a convenience map for keeping track of this. + update map[string]string + typ setType // used for checking. +} + +func (ss *stringSet) clone() stringSet { + c := *ss + c.s = append([]string(nil), c.s...) + return c +} + +func (ss *stringSet) setType(t setType) { + if ss.typ != t && ss.typ != 0 { + log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ) + } +} + +// parse parses a whitespace-separated string and initializes ss with its +// components. +func (ss *stringSet) parse(s string) { + scan := bufio.NewScanner(strings.NewReader(s)) + scan.Split(bufio.ScanWords) + for scan.Scan() { + ss.add(scan.Text()) + } +} + +func (ss *stringSet) assertChangeable() { + if ss.frozen { + log.Panic("attempt to modify a frozen stringSet") + } +} + +func (ss *stringSet) add(s string) { + ss.assertChangeable() + ss.s = append(ss.s, s) + ss.sorted = ss.frozen +} + +func (ss *stringSet) freeze() { + ss.compact() + ss.frozen = true +} + +func (ss *stringSet) compact() { + if ss.sorted { + return + } + a := ss.s + sort.Strings(a) + k := 0 + for i := 1; i < len(a); i++ { + if a[k] != a[i] { + a[k+1] = a[i] + k++ + } + } + ss.s = a[:k+1] + ss.sorted = ss.frozen +} + +type funcSorter struct { + fn func(a, b string) bool + sort.StringSlice +} + +func (s funcSorter) Less(i, j int) bool { + return s.fn(s.StringSlice[i], s.StringSlice[j]) +} + +func (ss *stringSet) sortFunc(f func(a, b string) bool) { + ss.compact() + sort.Sort(funcSorter{f, sort.StringSlice(ss.s)}) +} + +func (ss *stringSet) remove(s string) { + ss.assertChangeable() + if i, ok := ss.find(s); ok { + copy(ss.s[i:], ss.s[i+1:]) + ss.s = ss.s[:len(ss.s)-1] + } +} + +func (ss *stringSet) replace(ol, nu string) { + ss.s[ss.index(ol)] = nu + ss.sorted = ss.frozen +} + +func (ss *stringSet) index(s string) int { + ss.setType(Indexed) + i, ok := ss.find(s) + if !ok { + if i < len(ss.s) { + log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i]) + } + log.Panicf("find: item %q is not in list", s) + + } + return i +} + +func (ss *stringSet) find(s string) (int, bool) { + ss.compact() + i := sort.SearchStrings(ss.s, s) + return i, i != len(ss.s) && ss.s[i] == s +} + +func (ss *stringSet) slice() []string { + ss.compact() + return ss.s +} + +func (ss *stringSet) updateLater(v, key string) { + if ss.update == nil { + ss.update = map[string]string{} + } + ss.update[v] = key +} + +// join joins the string and ensures that all entries are of the same length. +func (ss *stringSet) join() string { + ss.setType(Indexed) + n := len(ss.s[0]) + for _, s := range ss.s { + if len(s) != n { + log.Panicf("join: not all entries are of the same length: %q", s) + } + } + ss.s = append(ss.s, strings.Repeat("\xff", n)) + return strings.Join(ss.s, "") +} + +// ianaEntry holds information for an entry in the IANA Language Subtag Repository. +// All types use the same entry. +// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various +// fields. +type ianaEntry struct { + typ string + description []string + scope string + added string + preferred string + deprecated string + suppressScript string + macro string + prefix []string +} + +type builder struct { + w *gen.CodeWriter + hw io.Writer // MultiWriter for w and w.Hash + data *cldr.CLDR + supp *cldr.SupplementalData + + // indices + locale stringSet // common locales + lang stringSet // canonical language ids (2 or 3 letter ISO codes) with data + langNoIndex stringSet // 3-letter ISO codes with no associated data + script stringSet // 4-letter ISO codes + region stringSet // 2-letter ISO or 3-digit UN M49 codes + variant stringSet // 4-8-alphanumeric variant code. + + // Region codes that are groups with their corresponding group IDs. + groups map[int]index + + // langInfo + registry map[string]*ianaEntry +} + +type index uint + +func newBuilder(w *gen.CodeWriter) *builder { + r := gen.OpenCLDRCoreZip() + defer r.Close() + d := &cldr.Decoder{} + data, err := d.DecodeZip(r) + failOnError(err) + b := builder{ + w: w, + hw: io.MultiWriter(w, w.Hash), + data: data, + supp: data.Supplemental(), + } + b.parseRegistry() + return &b +} + +func (b *builder) parseRegistry() { + r := gen.OpenIANAFile("assignments/language-subtag-registry") + defer r.Close() + b.registry = make(map[string]*ianaEntry) + + scan := bufio.NewScanner(r) + scan.Split(bufio.ScanWords) + var record *ianaEntry + for more := scan.Scan(); more; { + key := scan.Text() + more = scan.Scan() + value := scan.Text() + switch key { + case "Type:": + record = &ianaEntry{typ: value} + case "Subtag:", "Tag:": + if s := strings.SplitN(value, "..", 2); len(s) > 1 { + for a := s[0]; a <= s[1]; a = inc(a) { + b.addToRegistry(a, record) + } + } else { + b.addToRegistry(value, record) + } + case "Suppress-Script:": + record.suppressScript = value + case "Added:": + record.added = value + case "Deprecated:": + record.deprecated = value + case "Macrolanguage:": + record.macro = value + case "Preferred-Value:": + record.preferred = value + case "Prefix:": + record.prefix = append(record.prefix, value) + case "Scope:": + record.scope = value + case "Description:": + buf := []byte(value) + for more = scan.Scan(); more; more = scan.Scan() { + b := scan.Bytes() + if b[0] == '%' || b[len(b)-1] == ':' { + break + } + buf = append(buf, ' ') + buf = append(buf, b...) + } + record.description = append(record.description, string(buf)) + continue + default: + continue + } + more = scan.Scan() + } + if scan.Err() != nil { + log.Panic(scan.Err()) + } +} + +func (b *builder) addToRegistry(key string, entry *ianaEntry) { + if info, ok := b.registry[key]; ok { + if info.typ != "language" || entry.typ != "extlang" { + log.Fatalf("parseRegistry: tag %q already exists", key) + } + } else { + b.registry[key] = entry + } +} + +var commentIndex = make(map[string]string) + +func init() { + for _, s := range comment { + key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0]) + commentIndex[key] = s + } +} + +func (b *builder) comment(name string) { + if s := commentIndex[name]; len(s) > 0 { + b.w.WriteComment(s) + } else { + fmt.Fprintln(b.w) + } +} + +func (b *builder) pf(f string, x ...interface{}) { + fmt.Fprintf(b.hw, f, x...) + fmt.Fprint(b.hw, "\n") +} + +func (b *builder) p(x ...interface{}) { + fmt.Fprintln(b.hw, x...) +} + +func (b *builder) addSize(s int) { + b.w.Size += s + b.pf("// Size: %d bytes", s) +} + +func (b *builder) writeConst(name string, x interface{}) { + b.comment(name) + b.w.WriteConst(name, x) +} + +// writeConsts computes f(v) for all v in values and writes the results +// as constants named _v to a single constant block. +func (b *builder) writeConsts(f func(string) int, values ...string) { + b.pf("const (") + for _, v := range values { + b.pf("\t_%s = %v", v, f(v)) + } + b.pf(")") +} + +// writeType writes the type of the given value, which must be a struct. +func (b *builder) writeType(value interface{}) { + b.comment(reflect.TypeOf(value).Name()) + b.w.WriteType(value) +} + +func (b *builder) writeSlice(name string, ss interface{}) { + b.writeSliceAddSize(name, 0, ss) +} + +func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) { + b.comment(name) + b.w.Size += extraSize + v := reflect.ValueOf(ss) + t := v.Type().Elem() + b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len()) + + fmt.Fprintf(b.w, "var %s = ", name) + b.w.WriteArray(ss) + b.p() +} + +type fromTo struct { + from, to uint16 +} + +func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) { + ss.sortFunc(func(a, b string) bool { + return index(a) < index(b) + }) + m := []fromTo{} + for _, s := range ss.s { + m = append(m, fromTo{index(s), index(ss.update[s])}) + } + b.writeSlice(name, m) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s string) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +func (b *builder) writeBitVector(name string, ss []string) { + vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8))) + for _, s := range ss { + v := strToInt(s) + vec[v/8] |= 1 << (v % 8) + } + b.writeSlice(name, vec) +} + +// TODO: convert this type into a list or two-stage trie. +func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) { + b.comment(name) + v := reflect.ValueOf(m) + sz := v.Len() * (2 + int(v.Type().Key().Size())) + for _, k := range m { + sz += len(k) + } + b.addSize(sz) + keys := []string{} + b.pf(`var %s = map[string]uint16{`, name) + for k := range m { + keys = append(keys, k) + } + sort.Strings(keys) + for _, k := range keys { + b.pf("\t%q: %v,", k, f(m[k])) + } + b.p("}") +} + +func (b *builder) writeMap(name string, m interface{}) { + b.comment(name) + v := reflect.ValueOf(m) + sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size())) + b.addSize(sz) + f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool { + return strings.IndexRune("{}, ", r) != -1 + }) + sort.Strings(f[1:]) + b.pf(`var %s = %s{`, name, f[0]) + for _, kv := range f[1:] { + b.pf("\t%s,", kv) + } + b.p("}") +} + +func (b *builder) langIndex(s string) uint16 { + if s == "und" { + return 0 + } + if i, ok := b.lang.find(s); ok { + return uint16(i) + } + return uint16(strToInt(s)) + uint16(len(b.lang.s)) +} + +// inc advances the string to its lexicographical successor. +func inc(s string) string { + const maxTagLength = 4 + var buf [maxTagLength]byte + intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)]) + for i := 0; i < len(s); i++ { + if s[i] <= 'Z' { + buf[i] -= 'a' - 'A' + } + } + return string(buf[:len(s)]) +} + +func (b *builder) parseIndices() { + meta := b.supp.Metadata + + for k, v := range b.registry { + var ss *stringSet + switch v.typ { + case "language": + if len(k) == 2 || v.suppressScript != "" || v.scope == "special" { + b.lang.add(k) + continue + } else { + ss = &b.langNoIndex + } + case "region": + ss = &b.region + case "script": + ss = &b.script + case "variant": + ss = &b.variant + default: + continue + } + ss.add(k) + } + // Include any language for which there is data. + for _, lang := range b.data.Locales() { + if x := b.data.RawLDML(lang); false || + x.LocaleDisplayNames != nil || + x.Characters != nil || + x.Delimiters != nil || + x.Measurement != nil || + x.Dates != nil || + x.Numbers != nil || + x.Units != nil || + x.ListPatterns != nil || + x.Collations != nil || + x.Segmentations != nil || + x.Rbnf != nil || + x.Annotations != nil || + x.Metadata != nil { + + from := strings.Split(lang, "_") + if lang := from[0]; lang != "root" { + b.lang.add(lang) + } + } + } + // Include locales for plural rules, which uses a different structure. + for _, plurals := range b.data.Supplemental().Plurals { + for _, rules := range plurals.PluralRules { + for _, lang := range strings.Split(rules.Locales, " ") { + if lang = strings.Split(lang, "_")[0]; lang != "root" { + b.lang.add(lang) + } + } + } + } + // Include languages in likely subtags. + for _, m := range b.supp.LikelySubtags.LikelySubtag { + from := strings.Split(m.From, "_") + b.lang.add(from[0]) + } + // Include ISO-639 alpha-3 bibliographic entries. + for _, a := range meta.Alias.LanguageAlias { + if a.Reason == "bibliographic" { + b.langNoIndex.add(a.Type) + } + } + // Include regions in territoryAlias (not all are in the IANA registry!) + for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { + if len(reg.Type) == 2 { + b.region.add(reg.Type) + } + } + + for _, s := range b.lang.s { + if len(s) == 3 { + b.langNoIndex.remove(s) + } + } + b.writeConst("numLanguages", len(b.lang.slice())+len(b.langNoIndex.slice())) + b.writeConst("numScripts", len(b.script.slice())) + b.writeConst("numRegions", len(b.region.slice())) + + // Add dummy codes at the start of each list to represent "unspecified". + b.lang.add("---") + b.script.add("----") + b.region.add("---") + + // common locales + b.locale.parse(meta.DefaultContent.Locales) +} + +// TODO: region inclusion data will probably not be use used in future matchers. + +func (b *builder) computeRegionGroups() { + b.groups = make(map[int]index) + + // Create group indices. + for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID. + b.groups[i] = index(len(b.groups)) + } + for _, g := range b.supp.TerritoryContainment.Group { + // Skip UN and EURO zone as they are flattening the containment + // relationship. + if g.Type == "EZ" || g.Type == "UN" { + continue + } + group := b.region.index(g.Type) + if _, ok := b.groups[group]; !ok { + b.groups[group] = index(len(b.groups)) + } + } + if len(b.groups) > 32 { + log.Fatalf("only 32 groups supported, found %d", len(b.groups)) + } + b.writeConst("nRegionGroups", len(b.groups)) +} + +var langConsts = []string{ + "af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es", + "et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is", + "it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml", + "mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt", + "ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th", + "tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu", + + // constants for grandfathered tags (if not already defined) + "jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu", + "nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn", +} + +// writeLanguage generates all tables needed for language canonicalization. +func (b *builder) writeLanguage() { + meta := b.supp.Metadata + + b.writeConst("nonCanonicalUnd", b.lang.index("und")) + b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...) + b.writeConst("langPrivateStart", b.langIndex("qaa")) + b.writeConst("langPrivateEnd", b.langIndex("qtz")) + + // Get language codes that need to be mapped (overlong 3-letter codes, + // deprecated 2-letter codes, legacy and grandfathered tags.) + langAliasMap := stringSet{} + aliasTypeMap := map[string]langAliasType{} + + // altLangISO3 get the alternative ISO3 names that need to be mapped. + altLangISO3 := stringSet{} + // Add dummy start to avoid the use of index 0. + altLangISO3.add("---") + altLangISO3.updateLater("---", "aa") + + lang := b.lang.clone() + for _, a := range meta.Alias.LanguageAlias { + if a.Replacement == "" { + a.Replacement = "und" + } + // TODO: support mapping to tags + repl := strings.SplitN(a.Replacement, "_", 2)[0] + if a.Reason == "overlong" { + if len(a.Replacement) == 2 && len(a.Type) == 3 { + lang.updateLater(a.Replacement, a.Type) + } + } else if len(a.Type) <= 3 { + switch a.Reason { + case "macrolanguage": + aliasTypeMap[a.Type] = langMacro + case "deprecated": + // handled elsewhere + continue + case "bibliographic", "legacy": + if a.Type == "no" { + continue + } + aliasTypeMap[a.Type] = langLegacy + default: + log.Fatalf("new %s alias: %s", a.Reason, a.Type) + } + langAliasMap.add(a.Type) + langAliasMap.updateLater(a.Type, repl) + } + } + // Manually add the mapping of "nb" (Norwegian) to its macro language. + // This can be removed if CLDR adopts this change. + langAliasMap.add("nb") + langAliasMap.updateLater("nb", "no") + aliasTypeMap["nb"] = langMacro + + for k, v := range b.registry { + // Also add deprecated values for 3-letter ISO codes, which CLDR omits. + if v.typ == "language" && v.deprecated != "" && v.preferred != "" { + langAliasMap.add(k) + langAliasMap.updateLater(k, v.preferred) + aliasTypeMap[k] = langDeprecated + } + } + // Fix CLDR mappings. + lang.updateLater("tl", "tgl") + lang.updateLater("sh", "hbs") + lang.updateLater("mo", "mol") + lang.updateLater("no", "nor") + lang.updateLater("tw", "twi") + lang.updateLater("nb", "nob") + lang.updateLater("ak", "aka") + lang.updateLater("bh", "bih") + + // Ensure that each 2-letter code is matched with a 3-letter code. + for _, v := range lang.s[1:] { + s, ok := lang.update[v] + if !ok { + if s, ok = lang.update[langAliasMap.update[v]]; !ok { + continue + } + lang.update[v] = s + } + if v[0] != s[0] { + altLangISO3.add(s) + altLangISO3.updateLater(s, v) + } + } + + // Complete canonialized language tags. + lang.freeze() + for i, v := range lang.s { + // We can avoid these manual entries by using the IANI registry directly. + // Seems easier to update the list manually, as changes are rare. + // The panic in this loop will trigger if we miss an entry. + add := "" + if s, ok := lang.update[v]; ok { + if s[0] == v[0] { + add = s[1:] + } else { + add = string([]byte{0, byte(altLangISO3.index(s))}) + } + } else if len(v) == 3 { + add = "\x00" + } else { + log.Panicf("no data for long form of %q", v) + } + lang.s[i] += add + } + b.writeConst("lang", tag.Index(lang.join())) + + b.writeConst("langNoIndexOffset", len(b.lang.s)) + + // space of all valid 3-letter language identifiers. + b.writeBitVector("langNoIndex", b.langNoIndex.slice()) + + altLangIndex := []uint16{} + for i, s := range altLangISO3.slice() { + altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))}) + if i > 0 { + idx := b.lang.index(altLangISO3.update[s]) + altLangIndex = append(altLangIndex, uint16(idx)) + } + } + b.writeConst("altLangISO3", tag.Index(altLangISO3.join())) + b.writeSlice("altLangIndex", altLangIndex) + + b.writeSortedMap("langAliasMap", &langAliasMap, b.langIndex) + types := make([]langAliasType, len(langAliasMap.s)) + for i, s := range langAliasMap.s { + types[i] = aliasTypeMap[s] + } + b.writeSlice("langAliasTypes", types) +} + +var scriptConsts = []string{ + "Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy", + "Zzzz", +} + +func (b *builder) writeScript() { + b.writeConsts(b.script.index, scriptConsts...) + b.writeConst("script", tag.Index(b.script.join())) + + supp := make([]uint8, len(b.lang.slice())) + for i, v := range b.lang.slice()[1:] { + if sc := b.registry[v].suppressScript; sc != "" { + supp[i+1] = uint8(b.script.index(sc)) + } + } + b.writeSlice("suppressScript", supp) + + // There is only one deprecated script in CLDR. This value is hard-coded. + // We check here if the code must be updated. + for _, a := range b.supp.Metadata.Alias.ScriptAlias { + if a.Type != "Qaai" { + log.Panicf("unexpected deprecated stript %q", a.Type) + } + } +} + +func parseM49(s string) int16 { + if len(s) == 0 { + return 0 + } + v, err := strconv.ParseUint(s, 10, 10) + failOnError(err) + return int16(v) +} + +var regionConsts = []string{ + "001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US", + "ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo. +} + +func (b *builder) writeRegion() { + b.writeConsts(b.region.index, regionConsts...) + + isoOffset := b.region.index("AA") + m49map := make([]int16, len(b.region.slice())) + fromM49map := make(map[int16]int) + altRegionISO3 := "" + altRegionIDs := []uint16{} + + b.writeConst("isoRegionOffset", isoOffset) + + // 2-letter region lookup and mapping to numeric codes. + regionISO := b.region.clone() + regionISO.s = regionISO.s[isoOffset:] + regionISO.sorted = false + + regionTypes := make([]byte, len(b.region.s)) + + // Is the region valid BCP 47? + for s, e := range b.registry { + if len(s) == 2 && s == strings.ToUpper(s) { + i := b.region.index(s) + for _, d := range e.description { + if strings.Contains(d, "Private use") { + regionTypes[i] = iso3166UserAssgined + } + } + regionTypes[i] |= bcp47Region + } + } + + // Is the region a valid ccTLD? + r := gen.OpenIANAFile("domains/root/db") + defer r.Close() + + buf, err := ioutil.ReadAll(r) + failOnError(err) + re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`) + for _, m := range re.FindAllSubmatch(buf, -1) { + i := b.region.index(strings.ToUpper(string(m[1]))) + regionTypes[i] |= ccTLD + } + + b.writeSlice("regionTypes", regionTypes) + + iso3Set := make(map[string]int) + update := func(iso2, iso3 string) { + i := regionISO.index(iso2) + if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] { + regionISO.s[i] += iso3[1:] + iso3Set[iso3] = -1 + } else { + if ok && j >= 0 { + regionISO.s[i] += string([]byte{0, byte(j)}) + } else { + iso3Set[iso3] = len(altRegionISO3) + regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))}) + altRegionISO3 += iso3 + altRegionIDs = append(altRegionIDs, uint16(isoOffset+i)) + } + } + } + for _, tc := range b.supp.CodeMappings.TerritoryCodes { + i := regionISO.index(tc.Type) + isoOffset + if d := m49map[i]; d != 0 { + log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d) + } + m49 := parseM49(tc.Numeric) + m49map[i] = m49 + if r := fromM49map[m49]; r == 0 { + fromM49map[m49] = i + } else if r != i { + dep := b.registry[regionISO.s[r-isoOffset]].deprecated + if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) { + fromM49map[m49] = i + } + } + } + for _, ta := range b.supp.Metadata.Alias.TerritoryAlias { + if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 { + from := parseM49(ta.Type) + if r := fromM49map[from]; r == 0 { + fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset + } + } + } + for _, tc := range b.supp.CodeMappings.TerritoryCodes { + if len(tc.Alpha3) == 3 { + update(tc.Type, tc.Alpha3) + } + } + // This entries are not included in territoryCodes. Mostly 3-letter variants + // of deleted codes and an entry for QU. + for _, m := range []struct{ iso2, iso3 string }{ + {"CT", "CTE"}, + {"DY", "DHY"}, + {"HV", "HVO"}, + {"JT", "JTN"}, + {"MI", "MID"}, + {"NH", "NHB"}, + {"NQ", "ATN"}, + {"PC", "PCI"}, + {"PU", "PUS"}, + {"PZ", "PCZ"}, + {"RH", "RHO"}, + {"VD", "VDR"}, + {"WK", "WAK"}, + // These three-letter codes are used for others as well. + {"FQ", "ATF"}, + } { + update(m.iso2, m.iso3) + } + for i, s := range regionISO.s { + if len(s) != 4 { + regionISO.s[i] = s + " " + } + } + b.writeConst("regionISO", tag.Index(regionISO.join())) + b.writeConst("altRegionISO3", altRegionISO3) + b.writeSlice("altRegionIDs", altRegionIDs) + + // Create list of deprecated regions. + // TODO: consider inserting SF -> FI. Not included by CLDR, but is the only + // Transitionally-reserved mapping not included. + regionOldMap := stringSet{} + // Include regions in territoryAlias (not all are in the IANA registry!) + for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { + if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 { + regionOldMap.add(reg.Type) + regionOldMap.updateLater(reg.Type, reg.Replacement) + i, _ := regionISO.find(reg.Type) + j, _ := regionISO.find(reg.Replacement) + if k := m49map[i+isoOffset]; k == 0 { + m49map[i+isoOffset] = m49map[j+isoOffset] + } + } + } + b.writeSortedMap("regionOldMap", ®ionOldMap, func(s string) uint16 { + return uint16(b.region.index(s)) + }) + // 3-digit region lookup, groupings. + for i := 1; i < isoOffset; i++ { + m := parseM49(b.region.s[i]) + m49map[i] = m + fromM49map[m] = i + } + b.writeSlice("m49", m49map) + + const ( + searchBits = 7 + regionBits = 9 + ) + if len(m49map) >= 1<<regionBits { + log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits) + } + m49Index := [9]int16{} + fromM49 := []uint16{} + m49 := []int{} + for k, _ := range fromM49map { + m49 = append(m49, int(k)) + } + sort.Ints(m49) + for _, k := range m49[1:] { + val := (k & (1<<searchBits - 1)) << regionBits + fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)])) + m49Index[1:][k>>searchBits] = int16(len(fromM49)) + } + b.writeSlice("m49Index", m49Index) + b.writeSlice("fromM49", fromM49) +} + +const ( + // TODO: put these lists in regionTypes as user data? Could be used for + // various optimizations and refinements and could be exposed in the API. + iso3166Except = "AC CP DG EA EU FX IC SU TA UK" + iso3166Trans = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions. + // DY and RH are actually not deleted, but indeterminately reserved. + iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD" +) + +const ( + iso3166UserAssgined = 1 << iota + ccTLD + bcp47Region +) + +func find(list []string, s string) int { + for i, t := range list { + if t == s { + return i + } + } + return -1 +} + +// writeVariants generates per-variant information and creates a map from variant +// name to index value. We assign index values such that sorting multiple +// variants by index value will result in the correct order. +// There are two types of variants: specialized and general. Specialized variants +// are only applicable to certain language or language-script pairs. Generalized +// variants apply to any language. Generalized variants always sort after +// specialized variants. We will therefore always assign a higher index value +// to a generalized variant than any other variant. Generalized variants are +// sorted alphabetically among themselves. +// Specialized variants may also sort after other specialized variants. Such +// variants will be ordered after any of the variants they may follow. +// We assume that if a variant x is followed by a variant y, then for any prefix +// p of x, p-x is a prefix of y. This allows us to order tags based on the +// maximum of the length of any of its prefixes. +// TODO: it is possible to define a set of Prefix values on variants such that +// a total order cannot be defined to the point that this algorithm breaks. +// In other words, we cannot guarantee the same order of variants for the +// future using the same algorithm or for non-compliant combinations of +// variants. For this reason, consider using simple alphabetic sorting +// of variants and ignore Prefix restrictions altogether. +func (b *builder) writeVariant() { + generalized := stringSet{} + specialized := stringSet{} + specializedExtend := stringSet{} + // Collate the variants by type and check assumptions. + for _, v := range b.variant.slice() { + e := b.registry[v] + if len(e.prefix) == 0 { + generalized.add(v) + continue + } + c := strings.Split(e.prefix[0], "-") + hasScriptOrRegion := false + if len(c) > 1 { + _, hasScriptOrRegion = b.script.find(c[1]) + if !hasScriptOrRegion { + _, hasScriptOrRegion = b.region.find(c[1]) + + } + } + if len(c) == 1 || len(c) == 2 && hasScriptOrRegion { + // Variant is preceded by a language. + specialized.add(v) + continue + } + // Variant is preceded by another variant. + specializedExtend.add(v) + prefix := c[0] + "-" + if hasScriptOrRegion { + prefix += c[1] + } + for _, p := range e.prefix { + // Verify that the prefix minus the last element is a prefix of the + // predecessor element. + i := strings.LastIndex(p, "-") + pred := b.registry[p[i+1:]] + if find(pred.prefix, p[:i]) < 0 { + log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v) + } + // The sorting used below does not work in the general case. It works + // if we assume that variants that may be followed by others only have + // prefixes of the same length. Verify this. + count := strings.Count(p[:i], "-") + for _, q := range pred.prefix { + if c := strings.Count(q, "-"); c != count { + log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count) + } + } + if !strings.HasPrefix(p, prefix) { + log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix) + } + } + } + + // Sort extended variants. + a := specializedExtend.s + less := func(v, w string) bool { + // Sort by the maximum number of elements. + maxCount := func(s string) (max int) { + for _, p := range b.registry[s].prefix { + if c := strings.Count(p, "-"); c > max { + max = c + } + } + return + } + if cv, cw := maxCount(v), maxCount(w); cv != cw { + return cv < cw + } + // Sort by name as tie breaker. + return v < w + } + sort.Sort(funcSorter{less, sort.StringSlice(a)}) + specializedExtend.frozen = true + + // Create index from variant name to index. + variantIndex := make(map[string]uint8) + add := func(s []string) { + for _, v := range s { + variantIndex[v] = uint8(len(variantIndex)) + } + } + add(specialized.slice()) + add(specializedExtend.s) + numSpecialized := len(variantIndex) + add(generalized.slice()) + if n := len(variantIndex); n > 255 { + log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n) + } + b.writeMap("variantIndex", variantIndex) + b.writeConst("variantNumSpecialized", numSpecialized) +} + +func (b *builder) writeLanguageInfo() { +} + +// writeLikelyData writes tables that are used both for finding parent relations and for +// language matching. Each entry contains additional bits to indicate the status of the +// data to know when it cannot be used for parent relations. +func (b *builder) writeLikelyData() { + const ( + isList = 1 << iota + scriptInFrom + regionInFrom + ) + type ( // generated types + likelyScriptRegion struct { + region uint16 + script uint8 + flags uint8 + } + likelyLangScript struct { + lang uint16 + script uint8 + flags uint8 + } + likelyLangRegion struct { + lang uint16 + region uint16 + } + // likelyTag is used for getting likely tags for group regions, where + // the likely region might be a region contained in the group. + likelyTag struct { + lang uint16 + region uint16 + script uint8 + } + ) + var ( // generated variables + likelyRegionGroup = make([]likelyTag, len(b.groups)) + likelyLang = make([]likelyScriptRegion, len(b.lang.s)) + likelyRegion = make([]likelyLangScript, len(b.region.s)) + likelyScript = make([]likelyLangRegion, len(b.script.s)) + likelyLangList = []likelyScriptRegion{} + likelyRegionList = []likelyLangScript{} + ) + type fromTo struct { + from, to []string + } + langToOther := map[int][]fromTo{} + regionToOther := map[int][]fromTo{} + for _, m := range b.supp.LikelySubtags.LikelySubtag { + from := strings.Split(m.From, "_") + to := strings.Split(m.To, "_") + if len(to) != 3 { + log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to)) + } + if len(from) > 3 { + log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from)) + } + if from[0] != to[0] && from[0] != "und" { + log.Fatalf("unexpected language change in expansion: %s -> %s", from, to) + } + if len(from) == 3 { + if from[2] != to[2] { + log.Fatalf("unexpected region change in expansion: %s -> %s", from, to) + } + if from[0] != "und" { + log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to) + } + } + if len(from) == 1 || from[0] != "und" { + id := 0 + if from[0] != "und" { + id = b.lang.index(from[0]) + } + langToOther[id] = append(langToOther[id], fromTo{from, to}) + } else if len(from) == 2 && len(from[1]) == 4 { + sid := b.script.index(from[1]) + likelyScript[sid].lang = uint16(b.langIndex(to[0])) + likelyScript[sid].region = uint16(b.region.index(to[2])) + } else { + r := b.region.index(from[len(from)-1]) + if id, ok := b.groups[r]; ok { + if from[0] != "und" { + log.Fatalf("region changed unexpectedly: %s -> %s", from, to) + } + likelyRegionGroup[id].lang = uint16(b.langIndex(to[0])) + likelyRegionGroup[id].script = uint8(b.script.index(to[1])) + likelyRegionGroup[id].region = uint16(b.region.index(to[2])) + } else { + regionToOther[r] = append(regionToOther[r], fromTo{from, to}) + } + } + } + b.writeType(likelyLangRegion{}) + b.writeSlice("likelyScript", likelyScript) + + for id := range b.lang.s { + list := langToOther[id] + if len(list) == 1 { + likelyLang[id].region = uint16(b.region.index(list[0].to[2])) + likelyLang[id].script = uint8(b.script.index(list[0].to[1])) + } else if len(list) > 1 { + likelyLang[id].flags = isList + likelyLang[id].region = uint16(len(likelyLangList)) + likelyLang[id].script = uint8(len(list)) + for _, x := range list { + flags := uint8(0) + if len(x.from) > 1 { + if x.from[1] == x.to[2] { + flags = regionInFrom + } else { + flags = scriptInFrom + } + } + likelyLangList = append(likelyLangList, likelyScriptRegion{ + region: uint16(b.region.index(x.to[2])), + script: uint8(b.script.index(x.to[1])), + flags: flags, + }) + } + } + } + // TODO: merge suppressScript data with this table. + b.writeType(likelyScriptRegion{}) + b.writeSlice("likelyLang", likelyLang) + b.writeSlice("likelyLangList", likelyLangList) + + for id := range b.region.s { + list := regionToOther[id] + if len(list) == 1 { + likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0])) + likelyRegion[id].script = uint8(b.script.index(list[0].to[1])) + if len(list[0].from) > 2 { + likelyRegion[id].flags = scriptInFrom + } + } else if len(list) > 1 { + likelyRegion[id].flags = isList + likelyRegion[id].lang = uint16(len(likelyRegionList)) + likelyRegion[id].script = uint8(len(list)) + for i, x := range list { + if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 { + log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i) + } + x := likelyLangScript{ + lang: uint16(b.langIndex(x.to[0])), + script: uint8(b.script.index(x.to[1])), + } + if len(list[0].from) > 2 { + x.flags = scriptInFrom + } + likelyRegionList = append(likelyRegionList, x) + } + } + } + b.writeType(likelyLangScript{}) + b.writeSlice("likelyRegion", likelyRegion) + b.writeSlice("likelyRegionList", likelyRegionList) + + b.writeType(likelyTag{}) + b.writeSlice("likelyRegionGroup", likelyRegionGroup) +} + +type mutualIntelligibility struct { + want, have uint16 + conf uint8 + oneway bool +} + +type scriptIntelligibility struct { + lang uint16 // langID or 0 if * + want, have uint8 + conf uint8 +} + +type sortByConf []mutualIntelligibility + +func (l sortByConf) Less(a, b int) bool { + return l[a].conf > l[b].conf +} + +func (l sortByConf) Swap(a, b int) { + l[a], l[b] = l[b], l[a] +} + +func (l sortByConf) Len() int { + return len(l) +} + +// toConf converts a percentage value [0, 100] to a confidence class. +func toConf(pct uint8) uint8 { + switch { + case pct == 100: + return 3 // Exact + case pct >= 90: + return 2 // High + case pct > 50: + return 1 // Low + default: + return 0 // No + } +} + +// writeMatchData writes tables with languages and scripts for which there is +// mutual intelligibility. The data is based on CLDR's languageMatching data. +// Note that we use a different algorithm than the one defined by CLDR and that +// we slightly modify the data. For example, we convert scores to confidence levels. +// We also drop all region-related data as we use a different algorithm to +// determine region equivalence. +func (b *builder) writeMatchData() { + b.writeType(mutualIntelligibility{}) + b.writeType(scriptIntelligibility{}) + lm := b.supp.LanguageMatching.LanguageMatches + cldr.MakeSlice(&lm).SelectAnyOf("type", "written") + + matchLang := []mutualIntelligibility{} + matchScript := []scriptIntelligibility{} + // Convert the languageMatch entries in lists keyed by desired language. + for _, m := range lm[0].LanguageMatch { + // Different versions of CLDR use different separators. + desired := strings.Replace(m.Desired, "-", "_", -1) + supported := strings.Replace(m.Supported, "-", "_", -1) + d := strings.Split(desired, "_") + s := strings.Split(supported, "_") + if len(d) != len(s) || len(d) > 2 { + // Skip all entries with regions and work around CLDR bug. + continue + } + pct, _ := strconv.ParseInt(m.Percent, 10, 8) + if len(d) == 2 && d[0] == s[0] && len(d[1]) == 4 { + // language-script pair. + lang := uint16(0) + if d[0] != "*" { + lang = uint16(b.langIndex(d[0])) + } + matchScript = append(matchScript, scriptIntelligibility{ + lang: lang, + want: uint8(b.script.index(d[1])), + have: uint8(b.script.index(s[1])), + conf: toConf(uint8(pct)), + }) + if m.Oneway != "true" { + matchScript = append(matchScript, scriptIntelligibility{ + lang: lang, + want: uint8(b.script.index(s[1])), + have: uint8(b.script.index(d[1])), + conf: toConf(uint8(pct)), + }) + } + } else if len(d) == 1 && d[0] != "*" { + if pct == 100 { + // nb == no is already handled by macro mapping. Check there + // really is only this case. + if d[0] != "no" || s[0] != "nb" { + log.Fatalf("unhandled equivalence %s == %s", s[0], d[0]) + } + continue + } + matchLang = append(matchLang, mutualIntelligibility{ + want: uint16(b.langIndex(d[0])), + have: uint16(b.langIndex(s[0])), + conf: uint8(pct), + oneway: m.Oneway == "true", + }) + } else { + // TODO: Handle other mappings. + a := []string{"*;*", "*_*;*_*", "es_MX;es_419"} + s := strings.Join([]string{desired, supported}, ";") + if i := sort.SearchStrings(a, s); i == len(a) || a[i] != s { + log.Printf("%q not handled", s) + } + } + } + sort.Stable(sortByConf(matchLang)) + // collapse percentage into confidence classes + for i, m := range matchLang { + matchLang[i].conf = toConf(m.conf) + } + b.writeSlice("matchLang", matchLang) + b.writeSlice("matchScript", matchScript) +} + +func (b *builder) writeRegionInclusionData() { + var ( + // mm holds for each group the set of groups with a distance of 1. + mm = make(map[int][]index) + + // containment holds for each group the transitive closure of + // containment of other groups. + containment = make(map[index][]index) + ) + for _, g := range b.supp.TerritoryContainment.Group { + // Skip UN and EURO zone as they are flattening the containment + // relationship. + if g.Type == "EZ" || g.Type == "UN" { + continue + } + group := b.region.index(g.Type) + groupIdx := b.groups[group] + for _, mem := range strings.Split(g.Contains, " ") { + r := b.region.index(mem) + mm[r] = append(mm[r], groupIdx) + if g, ok := b.groups[r]; ok { + mm[group] = append(mm[group], g) + containment[groupIdx] = append(containment[groupIdx], g) + } + } + } + + regionContainment := make([]uint32, len(b.groups)) + for _, g := range b.groups { + l := containment[g] + + // Compute the transitive closure of containment. + for i := 0; i < len(l); i++ { + l = append(l, containment[l[i]]...) + } + + // Compute the bitmask. + regionContainment[g] = 1 << g + for _, v := range l { + regionContainment[g] |= 1 << v + } + // log.Printf("%d: %X", g, regionContainment[g]) + } + b.writeSlice("regionContainment", regionContainment) + + regionInclusion := make([]uint8, len(b.region.s)) + bvs := make(map[uint32]index) + // Make the first bitvector positions correspond with the groups. + for r, i := range b.groups { + bv := uint32(1 << i) + for _, g := range mm[r] { + bv |= 1 << g + } + bvs[bv] = i + regionInclusion[r] = uint8(bvs[bv]) + } + for r := 1; r < len(b.region.s); r++ { + if _, ok := b.groups[r]; !ok { + bv := uint32(0) + for _, g := range mm[r] { + bv |= 1 << g + } + if bv == 0 { + // Pick the world for unspecified regions. + bv = 1 << b.groups[b.region.index("001")] + } + if _, ok := bvs[bv]; !ok { + bvs[bv] = index(len(bvs)) + } + regionInclusion[r] = uint8(bvs[bv]) + } + } + b.writeSlice("regionInclusion", regionInclusion) + regionInclusionBits := make([]uint32, len(bvs)) + for k, v := range bvs { + regionInclusionBits[v] = uint32(k) + } + // Add bit vectors for increasingly large distances until a fixed point is reached. + regionInclusionNext := []uint8{} + for i := 0; i < len(regionInclusionBits); i++ { + bits := regionInclusionBits[i] + next := bits + for i := uint(0); i < uint(len(b.groups)); i++ { + if bits&(1<<i) != 0 { + next |= regionInclusionBits[i] + } + } + if _, ok := bvs[next]; !ok { + bvs[next] = index(len(bvs)) + regionInclusionBits = append(regionInclusionBits, next) + } + regionInclusionNext = append(regionInclusionNext, uint8(bvs[next])) + } + b.writeSlice("regionInclusionBits", regionInclusionBits) + b.writeSlice("regionInclusionNext", regionInclusionNext) +} + +type parentRel struct { + lang uint16 + script uint8 + maxScript uint8 + toRegion uint16 + fromRegion []uint16 +} + +func (b *builder) writeParents() { + b.writeType(parentRel{}) + + parents := []parentRel{} + + // Construct parent overrides. + n := 0 + for _, p := range b.data.Supplemental().ParentLocales.ParentLocale { + // Skipping non-standard scripts to root is implemented using addTags. + if p.Parent == "root" { + continue + } + + sub := strings.Split(p.Parent, "_") + parent := parentRel{lang: b.langIndex(sub[0])} + if len(sub) == 2 { + // TODO: check that all undefined scripts are indeed Latn in these + // cases. + parent.maxScript = uint8(b.script.index("Latn")) + parent.toRegion = uint16(b.region.index(sub[1])) + } else { + parent.script = uint8(b.script.index(sub[1])) + parent.maxScript = parent.script + parent.toRegion = uint16(b.region.index(sub[2])) + } + for _, c := range strings.Split(p.Locales, " ") { + region := b.region.index(c[strings.LastIndex(c, "_")+1:]) + parent.fromRegion = append(parent.fromRegion, uint16(region)) + } + parents = append(parents, parent) + n += len(parent.fromRegion) + } + b.writeSliceAddSize("parents", n*2, parents) +} + +func main() { + gen.Init() + + gen.Repackage("gen_common.go", "common.go", "language") + + w := gen.NewCodeWriter() + defer w.WriteGoFile("tables.go", "language") + + fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`) + + b := newBuilder(w) + gen.WriteCLDRVersion(w) + + b.parseIndices() + b.writeType(fromTo{}) + b.writeLanguage() + b.writeScript() + b.writeRegion() + b.writeVariant() + // TODO: b.writeLocale() + b.computeRegionGroups() + b.writeLikelyData() + b.writeMatchData() + b.writeRegionInclusionData() + b.writeParents() +} diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go new file mode 100644 index 000000000..8ad950533 --- /dev/null +++ b/vendor/golang.org/x/text/language/match.go @@ -0,0 +1,841 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "errors" + +// Matcher is the interface that wraps the Match method. +// +// Match returns the best match for any of the given tags, along with +// a unique index associated with the returned tag and a confidence +// score. +type Matcher interface { + Match(t ...Tag) (tag Tag, index int, c Confidence) +} + +// Comprehends reports the confidence score for a speaker of a given language +// to being able to comprehend the written form of an alternative language. +func Comprehends(speaker, alternative Tag) Confidence { + _, _, c := NewMatcher([]Tag{alternative}).Match(speaker) + return c +} + +// NewMatcher returns a Matcher that matches an ordered list of preferred tags +// against a list of supported tags based on written intelligibility, closeness +// of dialect, equivalence of subtags and various other rules. It is initialized +// with the list of supported tags. The first element is used as the default +// value in case no match is found. +// +// Its Match method matches the first of the given Tags to reach a certain +// confidence threshold. The tags passed to Match should therefore be specified +// in order of preference. Extensions are ignored for matching. +// +// The index returned by the Match method corresponds to the index of the +// matched tag in t, but is augmented with the Unicode extension ('u')of the +// corresponding preferred tag. This allows user locale options to be passed +// transparently. +func NewMatcher(t []Tag) Matcher { + return newMatcher(t) +} + +func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { + match, w, c := m.getBest(want...) + if match == nil { + t = m.default_.tag + } else { + t, index = match.tag, match.index + } + // Copy options from the user-provided tag into the result tag. This is hard + // to do after the fact, so we do it here. + // TODO: consider also adding in variants that are compatible with the + // matched language. + // TODO: Add back region if it is non-ambiguous? Or create another tag to + // preserve the region? + if u, ok := w.Extension('u'); ok { + t, _ = Raw.Compose(t, u) + } + return t, index, c +} + +type scriptRegionFlags uint8 + +const ( + isList = 1 << iota + scriptInFrom + regionInFrom +) + +func (t *Tag) setUndefinedLang(id langID) { + if t.lang == 0 { + t.lang = id + } +} + +func (t *Tag) setUndefinedScript(id scriptID) { + if t.script == 0 { + t.script = id + } +} + +func (t *Tag) setUndefinedRegion(id regionID) { + if t.region == 0 || t.region.contains(id) { + t.region = id + } +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// addLikelySubtags sets subtags to their most likely value, given the locale. +// In most cases this means setting fields for unknown values, but in some +// cases it may alter a value. It returns a ErrMissingLikelyTagsData error +// if the given locale cannot be expanded. +func (t Tag) addLikelySubtags() (Tag, error) { + id, err := addTags(t) + if err != nil { + return t, err + } else if id.equalTags(t) { + return t, nil + } + id.remakeString() + return id, nil +} + +// specializeRegion attempts to specialize a group region. +func specializeRegion(t *Tag) bool { + if i := regionInclusion[t.region]; i < nRegionGroups { + x := likelyRegionGroup[i] + if langID(x.lang) == t.lang && scriptID(x.script) == t.script { + t.region = regionID(x.region) + } + return true + } + return false +} + +func addTags(t Tag) (Tag, error) { + // We leave private use identifiers alone. + if t.private() { + return t, nil + } + if t.script != 0 && t.region != 0 { + if t.lang != 0 { + // already fully specified + specializeRegion(&t) + return t, nil + } + // Search matches for und-script-region. Note that for these cases + // region will never be a group so there is no need to check for this. + list := likelyRegion[t.region : t.region+1] + if x := list[0]; x.flags&isList != 0 { + list = likelyRegionList[x.lang : x.lang+uint16(x.script)] + } + for _, x := range list { + // Deviating from the spec. See match_test.go for details. + if scriptID(x.script) == t.script { + t.setUndefinedLang(langID(x.lang)) + return t, nil + } + } + } + if t.lang != 0 { + // Search matches for lang-script and lang-region, where lang != und. + if t.lang < langNoIndexOffset { + x := likelyLang[t.lang] + if x.flags&isList != 0 { + list := likelyLangList[x.region : x.region+uint16(x.script)] + if t.script != 0 { + for _, x := range list { + if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 { + t.setUndefinedRegion(regionID(x.region)) + return t, nil + } + } + } else if t.region != 0 { + count := 0 + goodScript := true + tt := t + for _, x := range list { + // We visit all entries for which the script was not + // defined, including the ones where the region was not + // defined. This allows for proper disambiguation within + // regions. + if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) { + tt.region = regionID(x.region) + tt.setUndefinedScript(scriptID(x.script)) + goodScript = goodScript && tt.script == scriptID(x.script) + count++ + } + } + if count == 1 { + return tt, nil + } + // Even if we fail to find a unique Region, we might have + // an unambiguous script. + if goodScript { + t.script = tt.script + } + } + } + } + } else { + // Search matches for und-script. + if t.script != 0 { + x := likelyScript[t.script] + if x.region != 0 { + t.setUndefinedRegion(regionID(x.region)) + t.setUndefinedLang(langID(x.lang)) + return t, nil + } + } + // Search matches for und-region. If und-script-region exists, it would + // have been found earlier. + if t.region != 0 { + if i := regionInclusion[t.region]; i < nRegionGroups { + x := likelyRegionGroup[i] + if x.region != 0 { + t.setUndefinedLang(langID(x.lang)) + t.setUndefinedScript(scriptID(x.script)) + t.region = regionID(x.region) + } + } else { + x := likelyRegion[t.region] + if x.flags&isList != 0 { + x = likelyRegionList[x.lang] + } + if x.script != 0 && x.flags != scriptInFrom { + t.setUndefinedLang(langID(x.lang)) + t.setUndefinedScript(scriptID(x.script)) + return t, nil + } + } + } + } + + // Search matches for lang. + if t.lang < langNoIndexOffset { + x := likelyLang[t.lang] + if x.flags&isList != 0 { + x = likelyLangList[x.region] + } + if x.region != 0 { + t.setUndefinedScript(scriptID(x.script)) + t.setUndefinedRegion(regionID(x.region)) + } + specializeRegion(&t) + if t.lang == 0 { + t.lang = _en // default language + } + return t, nil + } + return t, ErrMissingLikelyTagsData +} + +func (t *Tag) setTagsFrom(id Tag) { + t.lang = id.lang + t.script = id.script + t.region = id.region +} + +// minimize removes the region or script subtags from t such that +// t.addLikelySubtags() == t.minimize().addLikelySubtags(). +func (t Tag) minimize() (Tag, error) { + t, err := minimizeTags(t) + if err != nil { + return t, err + } + t.remakeString() + return t, nil +} + +// minimizeTags mimics the behavior of the ICU 51 C implementation. +func minimizeTags(t Tag) (Tag, error) { + if t.equalTags(und) { + return t, nil + } + max, err := addTags(t) + if err != nil { + return t, err + } + for _, id := range [...]Tag{ + {lang: t.lang}, + {lang: t.lang, region: t.region}, + {lang: t.lang, script: t.script}, + } { + if x, err := addTags(id); err == nil && max.equalTags(x) { + t.setTagsFrom(id) + break + } + } + return t, nil +} + +// Tag Matching +// CLDR defines an algorithm for finding the best match between two sets of language +// tags. The basic algorithm defines how to score a possible match and then find +// the match with the best score +// (see http://www.unicode.org/reports/tr35/#LanguageMatching). +// Using scoring has several disadvantages. The scoring obfuscates the importance of +// the various factors considered, making the algorithm harder to understand. Using +// scoring also requires the full score to be computed for each pair of tags. +// +// We will use a different algorithm which aims to have the following properties: +// - clarity on the precedence of the various selection factors, and +// - improved performance by allowing early termination of a comparison. +// +// Matching algorithm (overview) +// Input: +// - supported: a set of supported tags +// - default: the default tag to return in case there is no match +// - desired: list of desired tags, ordered by preference, starting with +// the most-preferred. +// +// Algorithm: +// 1) Set the best match to the lowest confidence level +// 2) For each tag in "desired": +// a) For each tag in "supported": +// 1) compute the match between the two tags. +// 2) if the match is better than the previous best match, replace it +// with the new match. (see next section) +// b) if the current best match is above a certain threshold, return this +// match without proceeding to the next tag in "desired". [See Note 1] +// 3) If the best match so far is below a certain threshold, return "default". +// +// Ranking: +// We use two phases to determine whether one pair of tags are a better match +// than another pair of tags. First, we determine a rough confidence level. If the +// levels are different, the one with the highest confidence wins. +// Second, if the rough confidence levels are identical, we use a set of tie-breaker +// rules. +// +// The confidence level of matching a pair of tags is determined by finding the +// lowest confidence level of any matches of the corresponding subtags (the +// result is deemed as good as its weakest link). +// We define the following levels: +// Exact - An exact match of a subtag, before adding likely subtags. +// MaxExact - An exact match of a subtag, after adding likely subtags. +// [See Note 2]. +// High - High level of mutual intelligibility between different subtag +// variants. +// Low - Low level of mutual intelligibility between different subtag +// variants. +// No - No mutual intelligibility. +// +// The following levels can occur for each type of subtag: +// Base: Exact, MaxExact, High, Low, No +// Script: Exact, MaxExact [see Note 3], Low, No +// Region: Exact, MaxExact, High +// Variant: Exact, High +// Private: Exact, No +// +// Any result with a confidence level of Low or higher is deemed a possible match. +// Once a desired tag matches any of the supported tags with a level of MaxExact +// or higher, the next desired tag is not considered (see Step 2.b). +// Note that CLDR provides languageMatching data that defines close equivalence +// classes for base languages, scripts and regions. +// +// Tie-breaking +// If we get the same confidence level for two matches, we apply a sequence of +// tie-breaking rules. The first that succeeds defines the result. The rules are +// applied in the following order. +// 1) Original language was defined and was identical. +// 2) Original region was defined and was identical. +// 3) Distance between two maximized regions was the smallest. +// 4) Original script was defined and was identical. +// 5) Distance from want tag to have tag using the parent relation [see Note 5.] +// If there is still no winner after these rules are applied, the first match +// found wins. +// +// Notes: +// [1] Note that even if we may not have a perfect match, if a match is above a +// certain threshold, it is considered a better match than any other match +// to a tag later in the list of preferred language tags. +// [2] In practice, as matching of Exact is done in a separate phase from +// matching the other levels, we reuse the Exact level to mean MaxExact in +// the second phase. As a consequence, we only need the levels defined by +// the Confidence type. The MaxExact confidence level is mapped to High in +// the public API. +// [3] We do not differentiate between maximized script values that were derived +// from suppressScript versus most likely tag data. We determined that in +// ranking the two, one ranks just after the other. Moreover, the two cannot +// occur concurrently. As a consequence, they are identical for practical +// purposes. +// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign +// the MaxExact level to allow iw vs he to still be a closer match than +// en-AU vs en-US, for example. +// [5] In CLDR a locale inherits fields that are unspecified for this locale +// from its parent. Therefore, if a locale is a parent of another locale, +// it is a strong measure for closeness, especially when no other tie +// breaker rule applies. One could also argue it is inconsistent, for +// example, when pt-AO matches pt (which CLDR equates with pt-BR), even +// though its parent is pt-PT according to the inheritance rules. +// +// Implementation Details: +// There are several performance considerations worth pointing out. Most notably, +// we preprocess as much as possible (within reason) at the time of creation of a +// matcher. This includes: +// - creating a per-language map, which includes data for the raw base language +// and its canonicalized variant (if applicable), +// - expanding entries for the equivalence classes defined in CLDR's +// languageMatch data. +// The per-language map ensures that typically only a very small number of tags +// need to be considered. The pre-expansion of canonicalized subtags and +// equivalence classes reduces the amount of map lookups that need to be done at +// runtime. + +// matcher keeps a set of supported language tags, indexed by language. +type matcher struct { + default_ *haveTag + index map[langID]*matchHeader + passSettings bool +} + +// matchHeader has the lists of tags for exact matches and matches based on +// maximized and canonicalized tags for a given language. +type matchHeader struct { + exact []*haveTag + max []*haveTag +} + +// haveTag holds a supported Tag and its maximized script and region. The maximized +// or canonicalized language is not stored as it is not needed during matching. +type haveTag struct { + tag Tag + + // index of this tag in the original list of supported tags. + index int + + // conf is the maximum confidence that can result from matching this haveTag. + // When conf < Exact this means it was inserted after applying a CLDR equivalence rule. + conf Confidence + + // Maximized region and script. + maxRegion regionID + maxScript scriptID + + // altScript may be checked as an alternative match to maxScript. If altScript + // matches, the confidence level for this match is Low. Theoretically there + // could be multiple alternative scripts. This does not occur in practice. + altScript scriptID + + // nextMax is the index of the next haveTag with the same maximized tags. + nextMax uint16 +} + +func makeHaveTag(tag Tag, index int) (haveTag, langID) { + max := tag + if tag.lang != 0 { + max, _ = max.canonicalize(All) + max, _ = addTags(max) + max.remakeString() + } + return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang +} + +// altScript returns an alternative script that may match the given script with +// a low confidence. At the moment, the langMatch data allows for at most one +// script to map to another and we rely on this to keep the code simple. +func altScript(l langID, s scriptID) scriptID { + for _, alt := range matchScript { + if (alt.lang == 0 || langID(alt.lang) == l) && scriptID(alt.have) == s { + return scriptID(alt.want) + } + } + return 0 +} + +// addIfNew adds a haveTag to the list of tags only if it is a unique tag. +// Tags that have the same maximized values are linked by index. +func (h *matchHeader) addIfNew(n haveTag, exact bool) { + // Don't add new exact matches. + for _, v := range h.exact { + if v.tag.equalsRest(n.tag) { + return + } + } + if exact { + h.exact = append(h.exact, &n) + } + // Allow duplicate maximized tags, but create a linked list to allow quickly + // comparing the equivalents and bail out. + for i, v := range h.max { + if v.maxScript == n.maxScript && + v.maxRegion == n.maxRegion && + v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() { + for h.max[i].nextMax != 0 { + i = int(h.max[i].nextMax) + } + h.max[i].nextMax = uint16(len(h.max)) + break + } + } + h.max = append(h.max, &n) +} + +// header returns the matchHeader for the given language. It creates one if +// it doesn't already exist. +func (m *matcher) header(l langID) *matchHeader { + if h := m.index[l]; h != nil { + return h + } + h := &matchHeader{} + m.index[l] = h + return h +} + +// newMatcher builds an index for the given supported tags and returns it as +// a matcher. It also expands the index by considering various equivalence classes +// for a given tag. +func newMatcher(supported []Tag) *matcher { + m := &matcher{ + index: make(map[langID]*matchHeader), + } + if len(supported) == 0 { + m.default_ = &haveTag{} + return m + } + // Add supported languages to the index. Add exact matches first to give + // them precedence. + for i, tag := range supported { + pair, _ := makeHaveTag(tag, i) + m.header(tag.lang).addIfNew(pair, true) + } + m.default_ = m.header(supported[0].lang).exact[0] + for i, tag := range supported { + pair, max := makeHaveTag(tag, i) + if max != tag.lang { + m.header(max).addIfNew(pair, false) + } + } + + // update is used to add indexes in the map for equivalent languages. + // If force is true, the update will also apply to derived entries. To + // avoid applying a "transitive closure", use false. + update := func(want, have uint16, conf Confidence, force bool) { + if hh := m.index[langID(have)]; hh != nil { + if !force && len(hh.exact) == 0 { + return + } + hw := m.header(langID(want)) + for _, ht := range hh.max { + v := *ht + if conf < v.conf { + v.conf = conf + } + v.nextMax = 0 // this value needs to be recomputed + if v.altScript != 0 { + v.altScript = altScript(langID(want), v.maxScript) + } + hw.addIfNew(v, conf == Exact && len(hh.exact) > 0) + } + } + } + + // Add entries for languages with mutual intelligibility as defined by CLDR's + // languageMatch data. + for _, ml := range matchLang { + update(ml.want, ml.have, Confidence(ml.conf), false) + if !ml.oneway { + update(ml.have, ml.want, Confidence(ml.conf), false) + } + } + + // Add entries for possible canonicalizations. This is an optimization to + // ensure that only one map lookup needs to be done at runtime per desired tag. + // First we match deprecated equivalents. If they are perfect equivalents + // (their canonicalization simply substitutes a different language code, but + // nothing else), the match confidence is Exact, otherwise it is High. + for i, lm := range langAliasMap { + if lm.from == _sh { + continue + } + + // If deprecated codes match and there is no fiddling with the script or + // or region, we consider it an exact match. + conf := Exact + if langAliasTypes[i] != langMacro { + if !isExactEquivalent(langID(lm.from)) { + conf = High + } + update(lm.to, lm.from, conf, true) + } + update(lm.from, lm.to, conf, true) + } + return m +} + +// getBest gets the best matching tag in m for any of the given tags, taking into +// account the order of preference of the given tags. +func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { + best := bestMatch{} + for _, w := range want { + var max Tag + // Check for exact match first. + h := m.index[w.lang] + if w.lang != 0 { + // Base language is defined. + if h == nil { + continue + } + for i := range h.exact { + have := h.exact[i] + if have.tag.equalsRest(w) { + return have, w, Exact + } + } + max, _ = w.canonicalize(Legacy | Deprecated) + max, _ = addTags(max) + } else { + // Base language is not defined. + if h != nil { + for i := range h.exact { + have := h.exact[i] + if have.tag.equalsRest(w) { + return have, w, Exact + } + } + } + if w.script == 0 && w.region == 0 { + // We skip all tags matching und for approximate matching, including + // private tags. + continue + } + max, _ = addTags(w) + if h = m.index[max.lang]; h == nil { + continue + } + } + // Check for match based on maximized tag. + for i := range h.max { + have := h.max[i] + best.update(have, w, max.script, max.region) + if best.conf == Exact { + for have.nextMax != 0 { + have = h.max[have.nextMax] + best.update(have, w, max.script, max.region) + } + return best.have, best.want, High + } + } + } + if best.conf <= No { + if len(want) != 0 { + return nil, want[0], No + } + return nil, Tag{}, No + } + return best.have, best.want, best.conf +} + +// bestMatch accumulates the best match so far. +type bestMatch struct { + have *haveTag + want Tag + conf Confidence + // Cached results from applying tie-breaking rules. + origLang bool + origReg bool + regDist uint8 + origScript bool + parentDist uint8 // 255 if have is not an ancestor of want tag. +} + +// update updates the existing best match if the new pair is considered to be a +// better match. +// To determine if the given pair is a better match, it first computes the rough +// confidence level. If this surpasses the current match, it will replace it and +// update the tie-breaker rule cache. If there is a tie, it proceeds with applying +// a series of tie-breaker rules. If there is no conclusive winner after applying +// the tie-breaker rules, it leaves the current match as the preferred match. +func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID) { + // Bail if the maximum attainable confidence is below that of the current best match. + c := have.conf + if c < m.conf { + return + } + if have.maxScript != maxScript { + // There is usually very little comprehension between different scripts. + // In a few cases there may still be Low comprehension. This possibility is + // pre-computed and stored in have.altScript. + if Low < m.conf || have.altScript != maxScript { + return + } + c = Low + } else if have.maxRegion != maxRegion { + // There is usually a small difference between languages across regions. + // We use the region distance (below) to disambiguate between equal matches. + if High < c { + c = High + } + } + + // We store the results of the computations of the tie-breaker rules along + // with the best match. There is no need to do the checks once we determine + // we have a winner, but we do still need to do the tie-breaker computations. + // We use "beaten" to keep track if we still need to do the checks. + beaten := false // true if the new pair defeats the current one. + if c != m.conf { + if c < m.conf { + return + } + beaten = true + } + + // Tie-breaker rules: + // We prefer if the pre-maximized language was specified and identical. + origLang := have.tag.lang == tag.lang && tag.lang != 0 + if !beaten && m.origLang != origLang { + if m.origLang { + return + } + beaten = true + } + + // We prefer if the pre-maximized region was specified and identical. + origReg := have.tag.region == tag.region && tag.region != 0 + if !beaten && m.origReg != origReg { + if m.origReg { + return + } + beaten = true + } + + // Next we prefer smaller distances between regions, as defined by regionDist. + regDist := regionDist(have.maxRegion, maxRegion, tag.lang) + if !beaten && m.regDist != regDist { + if regDist > m.regDist { + return + } + beaten = true + } + + // Next we prefer if the pre-maximized script was specified and identical. + origScript := have.tag.script == tag.script && tag.script != 0 + if !beaten && m.origScript != origScript { + if m.origScript { + return + } + beaten = true + } + + // Finally we prefer tags which have a closer parent relationship. + parentDist := parentDistance(have.tag.region, tag) + if !beaten && m.parentDist != parentDist { + if parentDist > m.parentDist { + return + } + beaten = true + } + + // Update m to the newly found best match. + if beaten { + m.have = have + m.want = tag + m.conf = c + m.origLang = origLang + m.origReg = origReg + m.origScript = origScript + m.regDist = regDist + m.parentDist = parentDist + } +} + +// parentDistance returns the number of times Parent must be called before the +// regions match. It is assumed that it has already been checked that lang and +// script are identical. If haveRegion does not occur in the ancestor chain of +// tag, it returns 255. +func parentDistance(haveRegion regionID, tag Tag) uint8 { + p := tag.Parent() + d := uint8(1) + for haveRegion != p.region { + if p.region == 0 { + return 255 + } + p = p.Parent() + d++ + } + return d +} + +// regionDist wraps regionDistance with some exceptions to the algorithmic distance. +func regionDist(a, b regionID, lang langID) uint8 { + if lang == _en { + // Two variants of non-US English are close to each other, regardless of distance. + if a != _US && b != _US { + return 2 + } + } + return uint8(regionDistance(a, b)) +} + +// regionDistance computes the distance between two regions based on the +// distance in the graph of region containments as defined in CLDR. It iterates +// over increasingly inclusive sets of groups, represented as bit vectors, until +// the source bit vector has bits in common with the destination vector. +func regionDistance(a, b regionID) int { + if a == b { + return 0 + } + p, q := regionInclusion[a], regionInclusion[b] + if p < nRegionGroups { + p, q = q, p + } + set := regionInclusionBits + if q < nRegionGroups && set[p]&(1<<q) != 0 { + return 1 + } + d := 2 + for goal := set[q]; set[p]&goal == 0; p = regionInclusionNext[p] { + d++ + } + return d +} + +func (t Tag) variants() string { + if t.pVariant == 0 { + return "" + } + return t.str[t.pVariant:t.pExt] +} + +// variantOrPrivateTagStr returns variants or private use tags. +func (t Tag) variantOrPrivateTagStr() string { + if t.pExt > 0 { + return t.str[t.pVariant:t.pExt] + } + return t.str[t.pVariant:] +} + +// equalsRest compares everything except the language. +func (a Tag) equalsRest(b Tag) bool { + // TODO: don't include extensions in this comparison. To do this efficiently, + // though, we should handle private tags separately. + return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr() +} + +// isExactEquivalent returns true if canonicalizing the language will not alter +// the script or region of a tag. +func isExactEquivalent(l langID) bool { + for _, o := range notEquivalent { + if o == l { + return false + } + } + return true +} + +var notEquivalent []langID + +func init() { + // Create a list of all languages for which canonicalization may alter the + // script or region. + for _, lm := range langAliasMap { + tag := Tag{lang: langID(lm.from)} + if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 { + notEquivalent = append(notEquivalent, langID(lm.from)) + } + } +} diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go new file mode 100644 index 000000000..cfa28f56e --- /dev/null +++ b/vendor/golang.org/x/text/language/parse.go @@ -0,0 +1,859 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "errors" + "fmt" + "sort" + "strconv" + "strings" + + "golang.org/x/text/internal/tag" +) + +// isAlpha returns true if the byte is not a digit. +// b must be an ASCII letter or digit. +func isAlpha(b byte) bool { + return b > '9' +} + +// isAlphaNum returns true if the string contains only ASCII letters or digits. +func isAlphaNum(s []byte) bool { + for _, c := range s { + if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { + return false + } + } + return true +} + +// errSyntax is returned by any of the parsing functions when the +// input is not well-formed, according to BCP 47. +// TODO: return the position at which the syntax error occurred? +var errSyntax = errors.New("language: tag is not well-formed") + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError struct { + v [8]byte +} + +func mkErrInvalid(s []byte) error { + var e ValueError + copy(e.v[:], s) + return e +} + +func (e ValueError) tag() []byte { + n := bytes.IndexByte(e.v[:], 0) + if n == -1 { + n = 8 + } + return e.v[:n] +} + +// Error implements the error interface. +func (e ValueError) Error() string { + return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) +} + +// Subtag returns the subtag for which the error occurred. +func (e ValueError) Subtag() string { + return string(e.tag()) +} + +// scanner is used to scan BCP 47 tokens, which are separated by _ or -. +type scanner struct { + b []byte + bytes [max99thPercentileSize]byte + token []byte + start int // start position of the current token + end int // end position of the current token + next int // next point for scan + err error + done bool +} + +func makeScannerString(s string) scanner { + scan := scanner{} + if len(s) <= len(scan.bytes) { + scan.b = scan.bytes[:copy(scan.bytes[:], s)] + } else { + scan.b = []byte(s) + } + scan.init() + return scan +} + +// makeScanner returns a scanner using b as the input buffer. +// b is not copied and may be modified by the scanner routines. +func makeScanner(b []byte) scanner { + scan := scanner{b: b} + scan.init() + return scan +} + +func (s *scanner) init() { + for i, c := range s.b { + if c == '_' { + s.b[i] = '-' + } + } + s.scan() +} + +// restToLower converts the string between start and end to lower case. +func (s *scanner) toLower(start, end int) { + for i := start; i < end; i++ { + c := s.b[i] + if 'A' <= c && c <= 'Z' { + s.b[i] += 'a' - 'A' + } + } +} + +func (s *scanner) setError(e error) { + if s.err == nil || (e == errSyntax && s.err != errSyntax) { + s.err = e + } +} + +// resizeRange shrinks or grows the array at position oldStart such that +// a new string of size newSize can fit between oldStart and oldEnd. +// Sets the scan point to after the resized range. +func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { + s.start = oldStart + if end := oldStart + newSize; end != oldEnd { + diff := end - oldEnd + if end < cap(s.b) { + b := make([]byte, len(s.b)+diff) + copy(b, s.b[:oldStart]) + copy(b[end:], s.b[oldEnd:]) + s.b = b + } else { + s.b = append(s.b[end:], s.b[oldEnd:]...) + } + s.next = end + (s.next - s.end) + s.end = end + } +} + +// replace replaces the current token with repl. +func (s *scanner) replace(repl string) { + s.resizeRange(s.start, s.end, len(repl)) + copy(s.b[s.start:], repl) +} + +// gobble removes the current token from the input. +// Caller must call scan after calling gobble. +func (s *scanner) gobble(e error) { + s.setError(e) + if s.start == 0 { + s.b = s.b[:+copy(s.b, s.b[s.next:])] + s.end = 0 + } else { + s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] + s.end = s.start - 1 + } + s.next = s.start +} + +// deleteRange removes the given range from s.b before the current token. +func (s *scanner) deleteRange(start, end int) { + s.setError(errSyntax) + s.b = s.b[:start+copy(s.b[start:], s.b[end:])] + diff := end - start + s.next -= diff + s.start -= diff + s.end -= diff +} + +// scan parses the next token of a BCP 47 string. Tokens that are larger +// than 8 characters or include non-alphanumeric characters result in an error +// and are gobbled and removed from the output. +// It returns the end position of the last token consumed. +func (s *scanner) scan() (end int) { + end = s.end + s.token = nil + for s.start = s.next; s.next < len(s.b); { + i := bytes.IndexByte(s.b[s.next:], '-') + if i == -1 { + s.end = len(s.b) + s.next = len(s.b) + i = s.end - s.start + } else { + s.end = s.next + i + s.next = s.end + 1 + } + token := s.b[s.start:s.end] + if i < 1 || i > 8 || !isAlphaNum(token) { + s.gobble(errSyntax) + continue + } + s.token = token + return end + } + if n := len(s.b); n > 0 && s.b[n-1] == '-' { + s.setError(errSyntax) + s.b = s.b[:len(s.b)-1] + } + s.done = true + return end +} + +// acceptMinSize parses multiple tokens of the given size or greater. +// It returns the end position of the last token consumed. +func (s *scanner) acceptMinSize(min int) (end int) { + end = s.end + s.scan() + for ; len(s.token) >= min; s.scan() { + end = s.end + } + return end +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the default canonicalization type. +func Parse(s string) (t Tag, err error) { + return Default.Parse(s) +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the the canonicalization type c. +func (c CanonType) Parse(s string) (t Tag, err error) { + // TODO: consider supporting old-style locale key-value pairs. + if s == "" { + return und, errSyntax + } + if len(s) <= maxAltTaglen { + b := [maxAltTaglen]byte{} + for i, c := range s { + // Generating invalid UTF-8 is okay as it won't match. + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } else if c == '_' { + c = '-' + } + b[i] = byte(c) + } + if t, ok := grandfathered(b); ok { + return t, nil + } + } + scan := makeScannerString(s) + t, err = parse(&scan, s) + t, changed := t.canonicalize(c) + if changed { + t.remakeString() + } + return t, err +} + +func parse(scan *scanner, s string) (t Tag, err error) { + t = und + var end int + if n := len(scan.token); n <= 1 { + scan.toLower(0, len(scan.b)) + if n == 0 || scan.token[0] != 'x' { + return t, errSyntax + } + end = parseExtensions(scan) + } else if n >= 4 { + return und, errSyntax + } else { // the usual case + t, end = parseTag(scan) + if n := len(scan.token); n == 1 { + t.pExt = uint16(end) + end = parseExtensions(scan) + } else if end < len(scan.b) { + scan.setError(errSyntax) + scan.b = scan.b[:end] + } + } + if int(t.pVariant) < len(scan.b) { + if end < len(s) { + s = s[:end] + } + if len(s) > 0 && tag.Compare(s, scan.b) == 0 { + t.str = s + } else { + t.str = string(scan.b) + } + } else { + t.pVariant, t.pExt = 0, 0 + } + return t, scan.err +} + +// parseTag parses language, script, region and variants. +// It returns a Tag and the end position in the input that was parsed. +func parseTag(scan *scanner) (t Tag, end int) { + var e error + // TODO: set an error if an unknown lang, script or region is encountered. + t.lang, e = getLangID(scan.token) + scan.setError(e) + scan.replace(t.lang.String()) + langStart := scan.start + end = scan.scan() + for len(scan.token) == 3 && isAlpha(scan.token[0]) { + // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent + // to a tag of the form <extlang>. + lang, e := getLangID(scan.token) + if lang != 0 { + t.lang = lang + copy(scan.b[langStart:], lang.String()) + scan.b[langStart+3] = '-' + scan.start = langStart + 4 + } + scan.gobble(e) + end = scan.scan() + } + if len(scan.token) == 4 && isAlpha(scan.token[0]) { + t.script, e = getScriptID(script, scan.token) + if t.script == 0 { + scan.gobble(e) + } + end = scan.scan() + } + if n := len(scan.token); n >= 2 && n <= 3 { + t.region, e = getRegionID(scan.token) + if t.region == 0 { + scan.gobble(e) + } else { + scan.replace(t.region.String()) + } + end = scan.scan() + } + scan.toLower(scan.start, len(scan.b)) + t.pVariant = byte(end) + end = parseVariants(scan, end, t) + t.pExt = uint16(end) + return t, end +} + +var separator = []byte{'-'} + +// parseVariants scans tokens as long as each token is a valid variant string. +// Duplicate variants are removed. +func parseVariants(scan *scanner, end int, t Tag) int { + start := scan.start + varIDBuf := [4]uint8{} + variantBuf := [4][]byte{} + varID := varIDBuf[:0] + variant := variantBuf[:0] + last := -1 + needSort := false + for ; len(scan.token) >= 4; scan.scan() { + // TODO: measure the impact of needing this conversion and redesign + // the data structure if there is an issue. + v, ok := variantIndex[string(scan.token)] + if !ok { + // unknown variant + // TODO: allow user-defined variants? + scan.gobble(mkErrInvalid(scan.token)) + continue + } + varID = append(varID, v) + variant = append(variant, scan.token) + if !needSort { + if last < int(v) { + last = int(v) + } else { + needSort = true + // There is no legal combinations of more than 7 variants + // (and this is by no means a useful sequence). + const maxVariants = 8 + if len(varID) > maxVariants { + break + } + } + } + end = scan.end + } + if needSort { + sort.Sort(variantsSort{varID, variant}) + k, l := 0, -1 + for i, v := range varID { + w := int(v) + if l == w { + // Remove duplicates. + continue + } + varID[k] = varID[i] + variant[k] = variant[i] + k++ + l = w + } + if str := bytes.Join(variant[:k], separator); len(str) == 0 { + end = start - 1 + } else { + scan.resizeRange(start, end, len(str)) + copy(scan.b[scan.start:], str) + end = scan.end + } + } + return end +} + +type variantsSort struct { + i []uint8 + v [][]byte +} + +func (s variantsSort) Len() int { + return len(s.i) +} + +func (s variantsSort) Swap(i, j int) { + s.i[i], s.i[j] = s.i[j], s.i[i] + s.v[i], s.v[j] = s.v[j], s.v[i] +} + +func (s variantsSort) Less(i, j int) bool { + return s.i[i] < s.i[j] +} + +type bytesSort [][]byte + +func (b bytesSort) Len() int { + return len(b) +} + +func (b bytesSort) Swap(i, j int) { + b[i], b[j] = b[j], b[i] +} + +func (b bytesSort) Less(i, j int) bool { + return bytes.Compare(b[i], b[j]) == -1 +} + +// parseExtensions parses and normalizes the extensions in the buffer. +// It returns the last position of scan.b that is part of any extension. +// It also trims scan.b to remove excess parts accordingly. +func parseExtensions(scan *scanner) int { + start := scan.start + exts := [][]byte{} + private := []byte{} + end := scan.end + for len(scan.token) == 1 { + extStart := scan.start + ext := scan.token[0] + end = parseExtension(scan) + extension := scan.b[extStart:end] + if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { + scan.setError(errSyntax) + end = extStart + continue + } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { + scan.b = scan.b[:end] + return end + } else if ext == 'x' { + private = extension + break + } + exts = append(exts, extension) + } + sort.Sort(bytesSort(exts)) + if len(private) > 0 { + exts = append(exts, private) + } + scan.b = scan.b[:start] + if len(exts) > 0 { + scan.b = append(scan.b, bytes.Join(exts, separator)...) + } else if start > 0 { + // Strip trailing '-'. + scan.b = scan.b[:start-1] + } + return end +} + +// parseExtension parses a single extension and returns the position of +// the extension end. +func parseExtension(scan *scanner) int { + start, end := scan.start, scan.end + switch scan.token[0] { + case 'u': + attrStart := end + scan.scan() + for last := []byte{}; len(scan.token) > 2; scan.scan() { + if bytes.Compare(scan.token, last) != -1 { + // Attributes are unsorted. Start over from scratch. + p := attrStart + 1 + scan.next = p + attrs := [][]byte{} + for scan.scan(); len(scan.token) > 2; scan.scan() { + attrs = append(attrs, scan.token) + end = scan.end + } + sort.Sort(bytesSort(attrs)) + copy(scan.b[p:], bytes.Join(attrs, separator)) + break + } + last = scan.token + end = scan.end + } + var last, key []byte + for attrEnd := end; len(scan.token) == 2; last = key { + key = scan.token + keyEnd := scan.end + end = scan.acceptMinSize(3) + // TODO: check key value validity + if keyEnd == end || bytes.Compare(key, last) != 1 { + // We have an invalid key or the keys are not sorted. + // Start scanning keys from scratch and reorder. + p := attrEnd + 1 + scan.next = p + keys := [][]byte{} + for scan.scan(); len(scan.token) == 2; { + keyStart, keyEnd := scan.start, scan.end + end = scan.acceptMinSize(3) + if keyEnd != end { + keys = append(keys, scan.b[keyStart:end]) + } else { + scan.setError(errSyntax) + end = keyStart + } + } + sort.Sort(bytesSort(keys)) + reordered := bytes.Join(keys, separator) + if e := p + len(reordered); e < end { + scan.deleteRange(e, end) + end = e + } + copy(scan.b[p:], bytes.Join(keys, separator)) + break + } + } + case 't': + scan.scan() + if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { + _, end = parseTag(scan) + scan.toLower(start, end) + } + for len(scan.token) == 2 && !isAlpha(scan.token[1]) { + end = scan.acceptMinSize(3) + } + case 'x': + end = scan.acceptMinSize(1) + default: + end = scan.acceptMinSize(2) + } + return end +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. A Tag overwrites all former values and typically +// only makes sense as the first argument. The resulting tag is returned after +// canonicalizing using the Default CanonType. If one or more errors are +// encountered, one of the errors is returned. +func Compose(part ...interface{}) (t Tag, err error) { + return Default.Compose(part...) +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. A Tag overwrites all former values and typically +// only makes sense as the first argument. The resulting tag is returned after +// canonicalizing using CanonType c. If one or more errors are encountered, +// one of the errors is returned. +func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { + var b builder + if err = b.update(part...); err != nil { + return und, err + } + t, _ = b.tag.canonicalize(c) + + if len(b.ext) > 0 || len(b.variant) > 0 { + sort.Sort(sortVariant(b.variant)) + sort.Strings(b.ext) + if b.private != "" { + b.ext = append(b.ext, b.private) + } + n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...) + buf := make([]byte, n) + p := t.genCoreBytes(buf) + t.pVariant = byte(p) + p += appendTokens(buf[p:], b.variant...) + t.pExt = uint16(p) + p += appendTokens(buf[p:], b.ext...) + t.str = string(buf[:p]) + } else if b.private != "" { + t.str = b.private + t.remakeString() + } + return +} + +type builder struct { + tag Tag + + private string // the x extension + ext []string + variant []string + + err error +} + +func (b *builder) addExt(e string) { + if e == "" { + } else if e[0] == 'x' { + b.private = e + } else { + b.ext = append(b.ext, e) + } +} + +var errInvalidArgument = errors.New("invalid Extension or Variant") + +func (b *builder) update(part ...interface{}) (err error) { + replace := func(l *[]string, s string, eq func(a, b string) bool) bool { + if s == "" { + b.err = errInvalidArgument + return true + } + for i, v := range *l { + if eq(v, s) { + (*l)[i] = s + return true + } + } + return false + } + for _, x := range part { + switch v := x.(type) { + case Tag: + b.tag.lang = v.lang + b.tag.region = v.region + b.tag.script = v.script + if v.str != "" { + b.variant = nil + for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; { + x, s = nextToken(s) + b.variant = append(b.variant, x) + } + b.ext, b.private = nil, "" + for i, e := int(v.pExt), ""; i < len(v.str); { + i, e = getExtension(v.str, i) + b.addExt(e) + } + } + case Base: + b.tag.lang = v.langID + case Script: + b.tag.script = v.scriptID + case Region: + b.tag.region = v.regionID + case Variant: + if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) { + b.variant = append(b.variant, v.variant) + } + case Extension: + if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) { + b.addExt(v.s) + } + case []Variant: + b.variant = nil + for _, x := range v { + b.update(x) + } + case []Extension: + b.ext, b.private = nil, "" + for _, e := range v { + b.update(e) + } + // TODO: support parsing of raw strings based on morphology or just extensions? + case error: + err = v + } + } + return +} + +func tokenLen(token ...string) (n int) { + for _, t := range token { + n += len(t) + 1 + } + return +} + +func appendTokens(b []byte, token ...string) int { + p := 0 + for _, t := range token { + b[p] = '-' + copy(b[p+1:], t) + p += 1 + len(t) + } + return p +} + +type sortVariant []string + +func (s sortVariant) Len() int { + return len(s) +} + +func (s sortVariant) Swap(i, j int) { + s[j], s[i] = s[i], s[j] +} + +func (s sortVariant) Less(i, j int) bool { + return variantIndex[s[i]] < variantIndex[s[j]] +} + +func findExt(list []string, x byte) int { + for i, e := range list { + if e[0] == x { + return i + } + } + return -1 +} + +// getExtension returns the name, body and end position of the extension. +func getExtension(s string, p int) (end int, ext string) { + if s[p] == '-' { + p++ + } + if s[p] == 'x' { + return len(s), s[p:] + } + end = nextExtension(s, p) + return end, s[p:end] +} + +// nextExtension finds the next extension within the string, searching +// for the -<char>- pattern from position p. +// In the fast majority of cases, language tags will have at most +// one extension and extensions tend to be small. +func nextExtension(s string, p int) int { + for n := len(s) - 3; p < n; { + if s[p] == '-' { + if s[p+2] == '-' { + return p + } + p += 3 + } else { + p++ + } + } + return len(s) +} + +var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") + +// ParseAcceptLanguage parses the contents of a Accept-Language header as +// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and +// a list of corresponding quality weights. It is more permissive than RFC 2616 +// and may return non-nil slices even if the input is not valid. +// The Tags will be sorted by highest weight first and then by first occurrence. +// Tags with a weight of zero will be dropped. An error will be returned if the +// input could not be parsed. +func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { + var entry string + for s != "" { + if entry, s = split(s, ','); entry == "" { + continue + } + + entry, weight := split(entry, ';') + + // Scan the language. + t, err := Parse(entry) + if err != nil { + id, ok := acceptFallback[entry] + if !ok { + return nil, nil, err + } + t = Tag{lang: id} + } + + // Scan the optional weight. + w := 1.0 + if weight != "" { + weight = consume(weight, 'q') + weight = consume(weight, '=') + // consume returns the empty string when a token could not be + // consumed, resulting in an error for ParseFloat. + if w, err = strconv.ParseFloat(weight, 32); err != nil { + return nil, nil, errInvalidWeight + } + // Drop tags with a quality weight of 0. + if w <= 0 { + continue + } + } + + tag = append(tag, t) + q = append(q, float32(w)) + } + sortStable(&tagSort{tag, q}) + return tag, q, nil +} + +// consume removes a leading token c from s and returns the result or the empty +// string if there is no such token. +func consume(s string, c byte) string { + if s == "" || s[0] != c { + return "" + } + return strings.TrimSpace(s[1:]) +} + +func split(s string, c byte) (head, tail string) { + if i := strings.IndexByte(s, c); i >= 0 { + return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:]) + } + return strings.TrimSpace(s), "" +} + +// Add hack mapping to deal with a small number of cases that that occur +// in Accept-Language (with reasonable frequency). +var acceptFallback = map[string]langID{ + "english": _en, + "deutsch": _de, + "italian": _it, + "french": _fr, + "*": _mul, // defined in the spec to match all languages. +} + +type tagSort struct { + tag []Tag + q []float32 +} + +func (s *tagSort) Len() int { + return len(s.q) +} + +func (s *tagSort) Less(i, j int) bool { + return s.q[i] > s.q[j] +} + +func (s *tagSort) Swap(i, j int) { + s.tag[i], s.tag[j] = s.tag[j], s.tag[i] + s.q[i], s.q[j] = s.q[j], s.q[i] +} diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go new file mode 100644 index 000000000..ccdc1ff0f --- /dev/null +++ b/vendor/golang.org/x/text/language/tables.go @@ -0,0 +1,3547 @@ +// This file was generated by go generate; DO NOT EDIT + +package language + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "30" + +const numLanguages = 8654 + +const numScripts = 230 + +const numRegions = 356 + +type fromTo struct { + from uint16 + to uint16 +} + +const nonCanonicalUnd = 1191 +const ( + _af = 21 + _am = 38 + _ar = 57 + _az = 87 + _bg = 125 + _bn = 163 + _ca = 213 + _cs = 246 + _da = 253 + _de = 265 + _el = 305 + _en = 308 + _es = 313 + _et = 315 + _fa = 323 + _fi = 332 + _fil = 334 + _fr = 345 + _gu = 413 + _he = 437 + _hi = 439 + _hr = 458 + _hu = 462 + _hy = 464 + _id = 474 + _is = 496 + _it = 497 + _ja = 504 + _ka = 520 + _kk = 570 + _km = 578 + _kn = 585 + _ko = 587 + _ky = 641 + _lo = 687 + _lt = 695 + _lv = 702 + _mk = 758 + _ml = 763 + _mn = 770 + _mo = 775 + _mr = 786 + _ms = 790 + _mul = 797 + _my = 808 + _nb = 830 + _ne = 840 + _nl = 862 + _no = 870 + _pa = 916 + _pl = 938 + _pt = 951 + _ro = 979 + _ru = 985 + _sh = 1021 + _si = 1026 + _sk = 1032 + _sl = 1036 + _sq = 1063 + _sr = 1064 + _sv = 1082 + _sw = 1083 + _ta = 1094 + _te = 1111 + _th = 1121 + _tl = 1136 + _tn = 1142 + _tr = 1152 + _uk = 1188 + _ur = 1194 + _uz = 1202 + _vi = 1209 + _zh = 1311 + _zu = 1316 + _jbo = 507 + _ami = 1639 + _bnn = 2346 + _hak = 431 + _tlh = 14456 + _lb = 652 + _nv = 890 + _pwn = 12044 + _tao = 14177 + _tay = 14187 + _tsu = 14651 + _nn = 865 + _sfb = 13618 + _vgt = 15690 + _sgg = 13649 + _cmn = 2996 + _nan = 826 + _hsn = 460 +) + +const langPrivateStart = 0x2f67 + +const langPrivateEnd = 0x316e + +// lang holds an alphabetically sorted list of ISO-639 language identifiers. +// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +// For 2-byte language identifiers, the two successive bytes have the following meaning: +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// For 3-byte language identifiers the 4th byte is 0. +const lang tag.Index = "" + // Size: 5280 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abr\x00abt\x00aby\x00acd\x00a" + + "ce\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey\x00affrag" + + "c\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00ajg\x00akka" + + "akk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00amp\x00anrga" + + "nc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00ape\x00apr" + + "\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars\x00ary\x00a" + + "rz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00atj\x00auy" + + "\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx\x00ayymayb" + + "\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00bba\x00bbb" + + "\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bcm\x00bcn" + + "\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00bet\x00b" + + "ew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn\x00bgx" + + "\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib\x00big" + + "\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn\x00bjo" + + "\x00bjr\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt\x00bmambmh\x00b" + + "mk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00bom\x00bon\x00bp" + + "y\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx\x00brz\x00bsosbsj" + + "\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00buc\x00bud\x00bug" + + "\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr\x00bxh\x00bye" + + "\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf\x00bzh\x00bzw" + + "\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg\x00chhachk\x00" + + "chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00ckl\x00cko\x00ck" + + "y\x00cla\x00cme\x00cooscop\x00cps\x00crrecrj\x00crk\x00crl\x00crm\x00crs" + + "\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymdaandad\x00daf\x00dag\x00dah" + + "\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00ddn\x00deeuded\x00den\x00d" + + "ga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia\x00dje\x00dnj\x00dob\x00doi" + + "\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm\x00dtp\x00dts\x00dty\x00dua" + + "\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00dyo\x00dyu\x00dzzodzg\x00ebu" + + "\x00eeweefi\x00egl\x00egy\x00eky\x00elllema\x00emi\x00enngenn\x00enq\x00" + + "eopoeri\x00es\x00\x05esu\x00etstetr\x00ett\x00etu\x00etx\x00euusewo\x00e" + + "xt\x00faasfaa\x00fab\x00fag\x00fai\x00fan\x00ffulffi\x00ffm\x00fiinfia" + + "\x00fil\x00fit\x00fjijflr\x00fmp\x00foaofod\x00fon\x00for\x00fpe\x00fqs" + + "\x00frrafrc\x00frp\x00frr\x00frs\x00fub\x00fud\x00fue\x00fuf\x00fuh\x00f" + + "uq\x00fur\x00fuv\x00fuy\x00fvr\x00fyrygalegaa\x00gaf\x00gag\x00gah\x00ga" + + "j\x00gam\x00gan\x00gaw\x00gay\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdla" + + "gde\x00gdn\x00gdr\x00geb\x00gej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gi" + + "l\x00gim\x00gjk\x00gjn\x00gju\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00" + + "gnrngnd\x00gng\x00god\x00gof\x00goi\x00gom\x00gon\x00gor\x00gos\x00got" + + "\x00grc\x00grt\x00grw\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00g" + + "ux\x00guz\x00gvlvgvf\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauha" + + "g\x00hak\x00ham\x00haw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif" + + "\x00hig\x00hih\x00hil\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj" + + "\x00hnn\x00hno\x00homohoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui" + + "\x00hyyehzerianaian\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd" + + "\x00idi\x00idu\x00ieleigboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw" + + "\x00ikx\x00ilo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00" + + "\x03iwm\x00iws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00j" + + "gk\x00jgo\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatka" + + "a\x00kab\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp" + + "\x00kbq\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl" + + "\x00kdt\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00k" + + "gp\x00kha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij" + + "\x00kiu\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klal" + + "kln\x00klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw" + + "\x00knanknp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + + "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + + "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + + "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + + "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + + "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + + "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + + "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + + "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + + "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + + "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + + "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + + "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + + "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + + "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + + "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + + "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + + "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + + "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + + "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + + "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + + "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + + "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + + "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + + "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + + "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + + "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + + "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + + "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + + "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + + "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + + "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + + "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + + "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + + "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + + "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + + "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + + "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + + "\x00sah\x00saq\x00sas\x00sat\x00saz\x00sba\x00sbe\x00sbp\x00scrdsck\x00s" + + "cl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00sei\x00se" + + "s\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn\x00shu" + + "\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks\x00sllv" + + "sld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp\x00smq" + + "\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq\x00sou" + + "\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx\x00sssw" + + "ssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00sur\x00s" + + "us\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00syl\x00sy" + + "r\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf\x00tbg\x00" + + "tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelted\x00tem" + + "\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00thq\x00thr" + + "\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr\x00tkt" + + "\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00tog\x00" + + "toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssotsd\x00t" + + "sf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts\x00ttt" + + "\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00twq\x00t" + + "xg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli\x00umb" + + "\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00uvh\x00u" + + "vl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv\x00vls" + + "\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj\x00wal" + + "\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg\x00wib" + + "\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu\x00woolw" + + "ob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00xbi\x00xcr" + + "\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna\x00xnr\x00x" + + "og\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe\x00yam\x00yao" + + "\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb\x00yby\x00yer" + + "\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00yooryon\x00yrb" + + "\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw\x00zahazag\x00z" + + "bl\x00zdj\x00zea\x00zgh\x00zhhozia\x00zlm\x00zmi\x00zne\x00zuulzxx\x00zz" + + "a\x00\xff\xff\xff\xff" + +const langNoIndexOffset = 1319 + +// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +// in lookup tables. The language ids for these language codes are derived directly +// from the letters and are not consecutive. +// Size: 2197 bytes, 2197 elements +var langNoIndex = [2197]uint8{ + // Entry 0 - 3F + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd7, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, + // Entry 40 - 7F + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7f, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, + // Entry 80 - BF + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, + 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, + 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + // Entry C0 - FF + 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, + 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56, + 0x45, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, + 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, + 0xbc, 0x87, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, + 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, + // Entry 100 - 13F + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, + 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f, + 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + // Entry 140 - 17F + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16, + 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09, + 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x50, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, + // Entry 180 - 1BF + 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, + 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7e, 0xbf, + // Entry 200 - 23F + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xcf, 0xe0, 0xdf, + 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d, + 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x6c, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, + // Entry 240 - 27F + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66, + // Entry 280 - 2BF + 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, + 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe5, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0xcc, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + // Entry 2C0 - 2FF + 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, + 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, + // Entry 300 - 33F + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, + 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, + 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, + // Entry 340 - 37F + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0xff, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, + // Entry 380 - 3BF + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, + // Entry 3C0 - 3FF + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, + 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11, + 0x84, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01, + 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10, + 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, + // Entry 400 - 43F + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, + // Entry 440 - 47F + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8e, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x04, 0x44, + // Entry 480 - 4BF + 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, + 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, + // Entry 4C0 - 4FF + 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, + 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, + 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, + // Entry 500 - 53F + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, + 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, + // Entry 540 - 57F + 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + // Entry 580 - 5BF + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, + 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, + 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, + // Entry 5C0 - 5FF + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, + 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, + 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, + 0x00, 0x1f, 0xdf, 0xf2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x18, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, + // Entry 600 - 63F + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, + // Entry 640 - 67F + 0x75, 0xc4, 0x7d, 0x81, 0x82, 0xf1, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, + // Entry 680 - 6BF + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, + 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, + 0x04, 0x00, 0x10, 0x8c, 0x58, 0xd5, 0x0d, 0x0f, + // Entry 6C0 - 6FF + 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, + 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41, + 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, + 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, + // Entry 700 - 73F + 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, + 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 740 - 77F + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xa0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, + 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, + // Entry 780 - 7BF + 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x00, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, + // Entry 7C0 - 7FF + 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42, + 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, + 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, + // Entry 800 - 83F + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, + 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, + // Entry 840 - 87F + 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, + 0x84, 0x00, 0x23, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, + 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, + 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, + // Entry 880 - 8BF + 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, + 0x0a, 0x00, 0x80, 0x00, 0x00, +} + +// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +// to 2-letter language codes that cannot be derived using the method described above. +// Each 3-letter code is followed by its 1-byte langID. +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" + +// altLangIndex is used to convert indexes in altLangISO3 to langIDs. +// Size: 12 bytes, 6 elements +var altLangIndex = [6]uint16{ + 0x0278, 0x03fd, 0x01f3, 0x03dc, 0x0139, 0x0200, +} + +// langAliasMap maps langIDs to their suggested replacements. +// Size: 644 bytes, 161 elements +var langAliasMap = [161]fromTo{ + 0: {from: 0x81, to: 0x87}, + 1: {from: 0x181, to: 0x1a7}, + 2: {from: 0x1eb, to: 0x1da}, + 3: {from: 0x1f3, to: 0x1b5}, + 4: {from: 0x200, to: 0x508}, + 5: {from: 0x207, to: 0x206}, + 6: {from: 0x307, to: 0x3d3}, + 7: {from: 0x33e, to: 0x366}, + 8: {from: 0x3fd, to: 0x428}, + 9: {from: 0x470, to: 0x14e}, + 10: {from: 0x486, to: 0x447}, + 11: {from: 0x498, to: 0x20}, + 12: {from: 0x533, to: 0x539}, + 13: {from: 0x584, to: 0x129}, + 14: {from: 0x625, to: 0x1ea6}, + 15: {from: 0x646, to: 0x427}, + 16: {from: 0x657, to: 0x427}, + 17: {from: 0x6e2, to: 0x39}, + 18: {from: 0x6ed, to: 0x1d0}, + 19: {from: 0x733, to: 0x2196}, + 20: {from: 0x7a8, to: 0x55}, + 21: {from: 0x7ae, to: 0x2990}, + 22: {from: 0x7ba, to: 0x57}, + 23: {from: 0x7db, to: 0x140}, + 24: {from: 0x801, to: 0x59}, + 25: {from: 0x80a, to: 0x8c}, + 26: {from: 0x873, to: 0x805}, + 27: {from: 0x8b8, to: 0xed8}, + 28: {from: 0x9e4, to: 0x328}, + 29: {from: 0xa2b, to: 0x2bc}, + 30: {from: 0xa32, to: 0xbd}, + 31: {from: 0xab3, to: 0x3317}, + 32: {from: 0xb2d, to: 0x51f}, + 33: {from: 0xb6a, to: 0x264f}, + 34: {from: 0xb73, to: 0xbb8}, + 35: {from: 0xb90, to: 0x444}, + 36: {from: 0xbb1, to: 0x421e}, + 37: {from: 0xbb4, to: 0x51f}, + 38: {from: 0xbf3, to: 0x2d9c}, + 39: {from: 0xc23, to: 0x3176}, + 40: {from: 0xcae, to: 0xf0}, + 41: {from: 0xcfd, to: 0xf6}, + 42: {from: 0xdbd, to: 0x116}, + 43: {from: 0xdcc, to: 0x324}, + 44: {from: 0xded, to: 0xdf0}, + 45: {from: 0xdf3, to: 0x526}, + 46: {from: 0xed4, to: 0x204f}, + 47: {from: 0xee3, to: 0x2e8f}, + 48: {from: 0xf2e, to: 0x35e}, + 49: {from: 0x10c5, to: 0x13b}, + 50: {from: 0x10f9, to: 0x2c7}, + 51: {from: 0x1195, to: 0x1e4}, + 52: {from: 0x126e, to: 0x20}, + 53: {from: 0x1419, to: 0x159}, + 54: {from: 0x1465, to: 0x149}, + 55: {from: 0x1514, to: 0xd90}, + 56: {from: 0x1518, to: 0x387}, + 57: {from: 0x1527, to: 0x16ba}, + 58: {from: 0x1575, to: 0x208}, + 59: {from: 0x1578, to: 0x109}, + 60: {from: 0x1598, to: 0x3ca4}, + 61: {from: 0x165f, to: 0x195}, + 62: {from: 0x16bd, to: 0x131}, + 63: {from: 0x16f5, to: 0x29ed}, + 64: {from: 0x170d, to: 0x18e}, + 65: {from: 0x171c, to: 0xf34}, + 66: {from: 0x176f, to: 0x1519}, + 67: {from: 0x17fe, to: 0x17ab}, + 68: {from: 0x180b, to: 0x18e8}, + 69: {from: 0x187f, to: 0x42c}, + 70: {from: 0x196e, to: 0x1cf6}, + 71: {from: 0x1a69, to: 0x2ba5}, + 72: {from: 0x1a7f, to: 0x1f0}, + 73: {from: 0x1b4f, to: 0x1f2}, + 74: {from: 0x1b7b, to: 0x150a}, + 75: {from: 0x202d, to: 0x37a6}, + 76: {from: 0x2032, to: 0x20d2}, + 77: {from: 0x204f, to: 0x302}, + 78: {from: 0x20d8, to: 0x26b}, + 79: {from: 0x20e3, to: 0x25a}, + 80: {from: 0x20e7, to: 0x225}, + 81: {from: 0x20ee, to: 0x24d}, + 82: {from: 0x2104, to: 0x21e0}, + 83: {from: 0x212a, to: 0x274}, + 84: {from: 0x218e, to: 0x11d}, + 85: {from: 0x21c3, to: 0x1556}, + 86: {from: 0x21db, to: 0x4fa}, + 87: {from: 0x21e9, to: 0x495}, + 88: {from: 0x2222, to: 0x11d}, + 89: {from: 0x222c, to: 0x11d}, + 90: {from: 0x2257, to: 0x91f}, + 91: {from: 0x230b, to: 0x321b}, + 92: {from: 0x2377, to: 0x335a}, + 93: {from: 0x2467, to: 0x2be}, + 94: {from: 0x24d9, to: 0x2f6}, + 95: {from: 0x24e5, to: 0x2f1}, + 96: {from: 0x24ef, to: 0x316}, + 97: {from: 0x2545, to: 0xb50}, + 98: {from: 0x259e, to: 0xe0}, + 99: {from: 0x2633, to: 0x2c7}, + 100: {from: 0x26be, to: 0x26a9}, + 101: {from: 0x26ee, to: 0x3bf}, + 102: {from: 0x271c, to: 0x3ca4}, + 103: {from: 0x275a, to: 0x26a9}, + 104: {from: 0x277e, to: 0x434d}, + 105: {from: 0x28e4, to: 0x282c}, + 106: {from: 0x2909, to: 0x348}, + 107: {from: 0x297b, to: 0x2d9c}, + 108: {from: 0x2b0f, to: 0x384}, + 109: {from: 0x2bf1, to: 0x38c}, + 110: {from: 0x2c34, to: 0x3ca4}, + 111: {from: 0x2cf1, to: 0x3b5}, + 112: {from: 0x2d08, to: 0x58c}, + 113: {from: 0x2d3c, to: 0x143}, + 114: {from: 0x2d3d, to: 0x143}, + 115: {from: 0x2df4, to: 0x2e8}, + 116: {from: 0x2dfd, to: 0x19c1}, + 117: {from: 0x2e0f, to: 0x2d8a}, + 118: {from: 0x2e16, to: 0x289}, + 119: {from: 0x2e49, to: 0x7c}, + 120: {from: 0x2e5a, to: 0x2277}, + 121: {from: 0x2e95, to: 0x2e90}, + 122: {from: 0x2ee4, to: 0x2ecc}, + 123: {from: 0x3188, to: 0x3bb}, + 124: {from: 0x335b, to: 0x3383}, + 125: {from: 0x341f, to: 0x3d3}, + 126: {from: 0x34e3, to: 0x18c5}, + 127: {from: 0x35db, to: 0x408}, + 128: {from: 0x364d, to: 0x23e}, + 129: {from: 0x366b, to: 0x3ea}, + 130: {from: 0x36f2, to: 0x43b}, + 131: {from: 0x37b5, to: 0x11d}, + 132: {from: 0x380b, to: 0x38e7}, + 133: {from: 0x3820, to: 0x2c90}, + 134: {from: 0x3824, to: 0xa7}, + 135: {from: 0x3827, to: 0x321d}, + 136: {from: 0x3861, to: 0x399b}, + 137: {from: 0x3887, to: 0x3fb5}, + 138: {from: 0x389a, to: 0x39cc}, + 139: {from: 0x38a9, to: 0x1f99}, + 140: {from: 0x38aa, to: 0x2e8f}, + 141: {from: 0x3951, to: 0x474}, + 142: {from: 0x3b43, to: 0xd86}, + 143: {from: 0x3b6d, to: 0x132}, + 144: {from: 0x3c8e, to: 0x4b2}, + 145: {from: 0x3fb2, to: 0xfc}, + 146: {from: 0x41fd, to: 0xa86}, + 147: {from: 0x42b3, to: 0x568}, + 148: {from: 0x42ee, to: 0x3f55}, + 149: {from: 0x436d, to: 0x251}, + 150: {from: 0x43c0, to: 0x36c0}, + 151: {from: 0x43c2, to: 0x10b}, + 152: {from: 0x44a4, to: 0x3317}, + 153: {from: 0x44d8, to: 0x508}, + 154: {from: 0x45bf, to: 0x23fe}, + 155: {from: 0x45d2, to: 0x26d1}, + 156: {from: 0x4605, to: 0x48a3}, + 157: {from: 0x46a3, to: 0x4695}, + 158: {from: 0x4733, to: 0x473a}, + 159: {from: 0x490b, to: 0x316}, + 160: {from: 0x499c, to: 0x519}, +} + +// Size: 161 bytes, 161 elements +var langAliasTypes = [161]langAliasType{ + // Entry 0 - 3F + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, + 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, + 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, + 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, + // Entry 40 - 7F + 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 1, 1, 1, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 2, 2, + 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, 0, 1, + 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 2, + // Entry 80 - BF + 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, 0, + 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, 1, + 1, +} + +const ( + _Latn = 82 + _Hani = 50 + _Hans = 52 + _Hant = 53 + _Qaaa = 131 + _Qaai = 139 + _Qabx = 180 + _Zinh = 224 + _Zyyy = 229 + _Zzzz = 230 +) + +// script is an alphabetically sorted list of ISO 15924 codes. The index +// of the script in the string, divided by 4, is the internal scriptID. +const script tag.Index = "" + // Size: 928 bytes + "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + + "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCprtCyrlCyrsDevaDsrtDuplEgyd" + + "EgyhEgypElbaEthiGeokGeorGlagGothGranGrekGujrGuruHanbHangHaniHanoHansHant" + + "HatrHebrHiraHluwHmngHrktHungIndsItalJamoJavaJpanJurcKaliKanaKharKhmrKhoj" + + "KitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepcLimbLinaLinbLisuLoma" + + "LyciLydiMahjMandManiMarcMayaMendMercMeroMlymModiMongMoonMrooMteiMultMymr" + + "NarbNbatNewaNkgbNkooNshuOgamOlckOrkhOryaOsgeOsmaPalmPaucPermPhagPhliPhlp" + + "PhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRjngRoroRunrSamrSaraSarbSaurSgnwShawShrdSiddSindSinhSoraSundSyloSyrc" + + "SyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglgThaaThaiTibtTirh" + + "UgarVaiiVispWaraWoleXpeoXsuxYiiiZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff" + + "\xff" + +// suppressScript is an index from langID to the dominant script for that language, +// if it exists. If a script is given, it should be suppressed from the language tag. +// Size: 1319 bytes, 1319 elements +var suppressScript = [1319]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x27, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x1e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, + // Entry 100 - 13F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, + 0x00, 0xd6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x2d, 0x00, 0x00, 0x52, 0x00, 0x00, 0x52, + 0x00, 0x52, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, + // Entry 140 - 17F + 0x52, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x2e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x37, 0x00, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x52, 0x52, 0x00, 0x52, 0x52, 0x00, + 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x52, 0x00, 0x37, 0x00, 0x00, 0x00, 0x00, + 0x41, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x29, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x4a, 0x00, 0x4b, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x4f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + // Entry 2C0 - 2FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, + 0x00, 0x00, 0x00, 0x64, 0x00, 0x00, 0x00, 0x00, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x52, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x6b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, + 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x70, 0x52, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x75, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x2f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, + // Entry 3C0 - 3FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x00, 0x00, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xcd, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xd0, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xd5, 0x00, 0x00, 0x00, 0x27, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + // Entry 480 - 4BF + 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 4C0 - 4FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x37, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, +} + +const ( + _001 = 1 + _419 = 30 + _BR = 64 + _CA = 72 + _ES = 109 + _GB = 122 + _MD = 187 + _PT = 237 + _UK = 305 + _US = 308 + _ZZ = 356 + _XA = 322 + _XC = 324 + _XK = 332 +) + +// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +// the UN.M49 codes used for groups.) +const isoRegionOffset = 31 + +// regionTypes defines the status of a region for various standards. +// Size: 357 bytes, 357 elements +var regionTypes = [357]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 80 - BF + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + // Entry 100 - 13F + 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 140 - 17F + 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, 0x04, + 0x06, 0x06, 0x04, 0x06, 0x05, +} + +// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +// Each 2-letter codes is followed by two bytes with the following meaning: +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1308 bytes + "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + + "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + + "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + + "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + + "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + + "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + + "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + + "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + + "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + + "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + + "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + + "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + + "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + + "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + + "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + + "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + + "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + + "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + +// altRegionISO3 holds a list of 3-letter region codes that cannot be +// mapped to 2-letter codes using the default algorithm. This is a short list. +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" + +// altRegionIDs holds a list of regionIDs the positions of which match those +// of the 3-letter ISO codes in altRegionISO3. +// Size: 22 bytes, 11 elements +var altRegionIDs = [11]uint16{ + 0x0056, 0x006f, 0x0087, 0x00a7, 0x00a9, 0x00ac, 0x00e9, 0x0104, + 0x0120, 0x015e, 0x00db, +} + +// Size: 80 bytes, 20 elements +var regionOldMap = [20]fromTo{ + 0: {from: 0x43, to: 0xc3}, + 1: {from: 0x57, to: 0xa6}, + 2: {from: 0x5e, to: 0x5f}, + 3: {from: 0x65, to: 0x3a}, + 4: {from: 0x78, to: 0x77}, + 5: {from: 0x92, to: 0x36}, + 6: {from: 0xa2, to: 0x132}, + 7: {from: 0xc0, to: 0x132}, + 8: {from: 0xd6, to: 0x13e}, + 9: {from: 0xdb, to: 0x2a}, + 10: {from: 0xee, to: 0x132}, + 11: {from: 0xf1, to: 0xe1}, + 12: {from: 0xfb, to: 0x6f}, + 13: {from: 0x102, to: 0x163}, + 14: {from: 0x129, to: 0x125}, + 15: {from: 0x131, to: 0x7a}, + 16: {from: 0x139, to: 0x13d}, + 17: {from: 0x140, to: 0x132}, + 18: {from: 0x15c, to: 0x15d}, + 19: {from: 0x162, to: 0x4a}, +} + +// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +// codes indicating collections of regions. +// Size: 714 bytes, 357 elements +var m49 = [357]int16{ + // Entry 0 - 3F + 0, 1, 2, 3, 5, 9, 11, 13, + 14, 15, 17, 18, 19, 21, 29, 30, + 34, 35, 39, 53, 54, 57, 61, 142, + 143, 145, 150, 151, 154, 155, 419, 958, + 0, 20, 784, 4, 28, 660, 8, 51, + 530, 24, 10, 32, 16, 40, 36, 533, + 248, 31, 70, 52, 50, 56, 854, 100, + 48, 108, 204, 652, 60, 96, 68, 535, + // Entry 40 - 7F + 76, 44, 64, 104, 74, 72, 112, 84, + 124, 166, 180, 140, 178, 756, 384, 184, + 152, 120, 156, 170, 0, 188, 891, 296, + 192, 132, 531, 162, 196, 203, 278, 276, + 0, 262, 208, 212, 214, 204, 12, 0, + 218, 233, 818, 732, 232, 724, 231, 967, + 0, 246, 242, 238, 583, 234, 0, 250, + 249, 266, 826, 308, 268, 254, 831, 288, + // Entry 80 - BF + 292, 304, 270, 324, 312, 226, 300, 239, + 320, 316, 624, 328, 344, 334, 340, 191, + 332, 348, 854, 0, 360, 372, 376, 833, + 356, 86, 368, 364, 352, 380, 832, 388, + 400, 392, 581, 404, 417, 116, 296, 174, + 659, 408, 410, 414, 136, 398, 418, 422, + 662, 438, 144, 430, 426, 440, 442, 428, + 434, 504, 492, 498, 499, 663, 450, 584, + // Entry C0 - FF + 581, 807, 466, 104, 496, 446, 580, 474, + 478, 500, 470, 480, 462, 454, 484, 458, + 508, 516, 540, 562, 574, 566, 548, 558, + 528, 578, 524, 10, 520, 536, 570, 554, + 512, 591, 0, 604, 258, 598, 608, 586, + 616, 666, 612, 630, 275, 620, 581, 585, + 600, 591, 634, 959, 960, 961, 962, 963, + 964, 965, 966, 967, 968, 969, 970, 971, + // Entry 100 - 13F + 972, 638, 716, 642, 688, 643, 646, 682, + 90, 690, 729, 752, 702, 654, 705, 744, + 703, 694, 674, 686, 706, 740, 728, 678, + 810, 222, 534, 760, 748, 0, 796, 148, + 260, 768, 764, 762, 772, 626, 795, 788, + 776, 626, 792, 780, 798, 158, 834, 804, + 800, 826, 581, 0, 840, 858, 860, 336, + 670, 704, 862, 92, 850, 704, 548, 876, + // Entry 140 - 17F + 581, 882, 973, 974, 975, 976, 977, 978, + 979, 980, 981, 982, 983, 984, 985, 986, + 987, 988, 989, 990, 991, 992, 993, 994, + 995, 996, 997, 998, 720, 887, 175, 891, + 710, 894, 180, 716, 999, +} + +// m49Index gives indexes into fromM49 based on the three most significant bits +// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +// The region code is stored in the 9 lsb of the indexed value. +// Size: 18 bytes, 9 elements +var m49Index = [9]int16{ + 0, 59, 107, 142, 180, 219, 258, 290, + 332, +} + +// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. +// Size: 664 bytes, 332 elements +var fromM49 = [332]uint16{ + // Entry 0 - 3F + 0x0201, 0x0402, 0x0603, 0x0823, 0x0a04, 0x1026, 0x1205, 0x142a, + 0x1606, 0x1866, 0x1a07, 0x1c08, 0x1e09, 0x202c, 0x220a, 0x240b, + 0x260c, 0x2821, 0x2a0d, 0x3029, 0x3824, 0x3a0e, 0x3c0f, 0x3e31, + 0x402b, 0x4410, 0x4611, 0x482e, 0x4e12, 0x502d, 0x5841, 0x6038, + 0x6434, 0x6627, 0x6833, 0x6a13, 0x6c14, 0x7035, 0x7215, 0x783c, + 0x7a16, 0x8042, 0x883e, 0x8c32, 0x9045, 0x9444, 0x9840, 0xa847, + 0xac99, 0xb508, 0xb93b, 0xc03d, 0xc837, 0xd0c3, 0xd839, 0xe046, + 0xe8a5, 0xf051, 0xf848, 0x0859, 0x10ac, 0x184b, 0x1c17, 0x1e18, + // Entry 40 - 7F + 0x20b2, 0x2219, 0x291f, 0x2c1a, 0x2e1b, 0x3050, 0x341c, 0x361d, + 0x3852, 0x3d2d, 0x445b, 0x4c49, 0x5453, 0x5ca7, 0x5f5e, 0x644c, + 0x684a, 0x704f, 0x7855, 0x7e8f, 0x8058, 0x885c, 0x965d, 0x983a, + 0xa062, 0xa863, 0xac64, 0xb468, 0xbd19, 0xc485, 0xcc6e, 0xce6e, + 0xd06c, 0xd269, 0xd475, 0xdc73, 0xde87, 0xe472, 0xec71, 0xf030, + 0xf278, 0xf477, 0xfc7d, 0x04e4, 0x0920, 0x0c61, 0x1479, 0x187c, + 0x1c82, 0x26ec, 0x285f, 0x2c5e, 0x305f, 0x407f, 0x4880, 0x50a6, + 0x5886, 0x6081, 0x687b, 0x7084, 0x7889, 0x8088, 0x8883, 0x908b, + // Entry 80 - BF + 0x9890, 0x9c8d, 0xa137, 0xa88e, 0xb08c, 0xb891, 0xc09c, 0xc898, + 0xd094, 0xd89b, 0xe09a, 0xe895, 0xf096, 0xf89d, 0x004e, 0x089f, + 0x10a1, 0x1cad, 0x20a0, 0x28a3, 0x30a9, 0x34aa, 0x3cab, 0x42a4, + 0x44ae, 0x461e, 0x4caf, 0x54b4, 0x58b7, 0x5cb3, 0x64b8, 0x6cb1, + 0x70b5, 0x74b6, 0x7cc5, 0x84be, 0x8ccd, 0x94cf, 0x9ccc, 0xa4c2, + 0xacca, 0xb4c7, 0xbcc8, 0xc0cb, 0xc8ce, 0xd8ba, 0xe0c4, 0xe4bb, + 0xe6bc, 0xe8c9, 0xf0b9, 0xf8d0, 0x00e0, 0x08d1, 0x10dc, 0x18da, + 0x20d8, 0x2428, 0x265a, 0x2a2f, 0x2d1a, 0x2e3f, 0x30dd, 0x38d2, + // Entry C0 - FF + 0x493e, 0x54df, 0x5cd7, 0x64d3, 0x6cd5, 0x74de, 0x7cd4, 0x84d9, + 0x88c6, 0x8b32, 0x8e74, 0x90bf, 0x92ef, 0x94e7, 0x9ee1, 0xace5, + 0xb0f0, 0xb8e3, 0xc0e6, 0xc8ea, 0xd0e8, 0xd8ed, 0xe08a, 0xe525, + 0xeceb, 0xf4f2, 0xfd01, 0x0503, 0x0705, 0x0d06, 0x183b, 0x1d0d, + 0x26a8, 0x2825, 0x2cb0, 0x2ebd, 0x34e9, 0x3d38, 0x4512, 0x4d17, + 0x5507, 0x5d13, 0x6104, 0x6509, 0x6d11, 0x7d0c, 0x7f10, 0x813d, + 0x830e, 0x8514, 0x8d60, 0x9963, 0xa15c, 0xa86d, 0xb116, 0xb30a, + 0xb86b, 0xc10a, 0xc915, 0xd10f, 0xd91c, 0xe10b, 0xe84d, 0xf11b, + // Entry 100 - 13F + 0xf523, 0xf922, 0x0121, 0x0924, 0x1128, 0x192b, 0x2022, 0x2927, + 0x312a, 0x3726, 0x391e, 0x3d2c, 0x4130, 0x492f, 0x4ec1, 0x5518, + 0x646a, 0x747a, 0x7e7e, 0x809e, 0x8297, 0x852e, 0x9134, 0xa53c, + 0xac36, 0xb535, 0xb936, 0xbd3a, 0xd93f, 0xe541, 0xed5d, 0xef5d, + 0xf656, 0xfd61, 0x7c1f, 0x7ef3, 0x80f4, 0x82f5, 0x84f6, 0x86f7, + 0x88f8, 0x8af9, 0x8cfa, 0x8e6f, 0x90fc, 0x92fd, 0x94fe, 0x96ff, + 0x9900, 0x9b42, 0x9d43, 0x9f44, 0xa145, 0xa346, 0xa547, 0xa748, + 0xa949, 0xab4a, 0xad4b, 0xaf4c, 0xb14d, 0xb34e, 0xb54f, 0xb750, + // Entry 140 - 17F + 0xb951, 0xbb52, 0xbd53, 0xbf54, 0xc155, 0xc356, 0xc557, 0xc758, + 0xc959, 0xcb5a, 0xcd5b, 0xcf64, +} + +// Size: 1463 bytes +var variantIndex = map[string]uint8{ + "1606nict": 0x0, + "1694acad": 0x1, + "1901": 0x2, + "1959acad": 0x3, + "1994": 0x45, + "1996": 0x4, + "abl1943": 0x5, + "alalc97": 0x47, + "aluku": 0x6, + "ao1990": 0x7, + "arevela": 0x8, + "arevmda": 0x9, + "baku1926": 0xa, + "balanka": 0xb, + "barla": 0xc, + "basiceng": 0xd, + "bauddha": 0xe, + "biscayan": 0xf, + "biske": 0x40, + "bohoric": 0x10, + "boont": 0x11, + "colb1945": 0x12, + "cornu": 0x13, + "dajnko": 0x14, + "ekavsk": 0x15, + "emodeng": 0x16, + "fonipa": 0x48, + "fonnapa": 0x49, + "fonupa": 0x4a, + "fonxsamp": 0x4b, + "hepburn": 0x17, + "heploc": 0x46, + "hognorsk": 0x18, + "ijekavsk": 0x19, + "itihasa": 0x1a, + "jauer": 0x1b, + "jyutping": 0x1c, + "kkcor": 0x1d, + "kociewie": 0x1e, + "kscor": 0x1f, + "laukika": 0x20, + "lipaw": 0x41, + "luna1918": 0x21, + "metelko": 0x22, + "monoton": 0x23, + "ndyuka": 0x24, + "nedis": 0x25, + "newfound": 0x26, + "njiva": 0x42, + "nulik": 0x27, + "osojs": 0x43, + "oxendict": 0x28, + "pamaka": 0x29, + "petr1708": 0x2a, + "pinyin": 0x2b, + "polyton": 0x2c, + "puter": 0x2d, + "rigik": 0x2e, + "rozaj": 0x2f, + "rumgr": 0x30, + "scotland": 0x31, + "scouse": 0x32, + "simple": 0x4c, + "solba": 0x44, + "sotav": 0x33, + "surmiran": 0x34, + "sursilv": 0x35, + "sutsilv": 0x36, + "tarask": 0x37, + "uccor": 0x38, + "ucrcor": 0x39, + "ulster": 0x3a, + "unifon": 0x3b, + "vaidika": 0x3c, + "valencia": 0x3d, + "vallader": 0x3e, + "wadegile": 0x3f, +} + +// variantNumSpecialized is the number of specialized variants in variants. +const variantNumSpecialized = 71 + +// nRegionGroups is the number of region groups. +const nRegionGroups = 32 + +type likelyLangRegion struct { + lang uint16 + region uint16 +} + +// likelyScript is a lookup table, indexed by scriptID, for the most likely +// languages and regions given a script. +// Size: 928 bytes, 232 elements +var likelyScript = [232]likelyLangRegion{ + 1: {lang: 0x149, region: 0x83}, + 3: {lang: 0x299, region: 0x105}, + 4: {lang: 0x1e, region: 0x98}, + 5: {lang: 0x39, region: 0x6a}, + 7: {lang: 0x3a, region: 0x9b}, + 8: {lang: 0x1d0, region: 0x27}, + 9: {lang: 0x12, region: 0x9b}, + 10: {lang: 0x5a, region: 0x94}, + 11: {lang: 0x5f, region: 0x51}, + 12: {lang: 0xb7, region: 0xb3}, + 13: {lang: 0x62, region: 0x94}, + 14: {lang: 0xa3, region: 0x34}, + 15: {lang: 0x3e0, region: 0x98}, + 17: {lang: 0x51f, region: 0x12d}, + 18: {lang: 0x3a8, region: 0x98}, + 19: {lang: 0x159, region: 0x77}, + 20: {lang: 0xc0, region: 0x94}, + 21: {lang: 0x9b, region: 0xe6}, + 22: {lang: 0xd9, region: 0x34}, + 23: {lang: 0xf0, region: 0x48}, + 24: {lang: 0x4e6, region: 0x12a}, + 25: {lang: 0xe5, region: 0x13d}, + 26: {lang: 0xe3, region: 0x134}, + 28: {lang: 0xee, region: 0x6a}, + 29: {lang: 0x199, region: 0x5c}, + 30: {lang: 0x3d9, region: 0x105}, + 32: {lang: 0x1b7, region: 0x98}, + 34: {lang: 0x159, region: 0x77}, + 37: {lang: 0x12f, region: 0x6a}, + 38: {lang: 0x427, region: 0x26}, + 39: {lang: 0x26, region: 0x6e}, + 41: {lang: 0x208, region: 0x7c}, + 42: {lang: 0xfa, region: 0x37}, + 43: {lang: 0x198, region: 0x12f}, + 44: {lang: 0x3e0, region: 0x98}, + 45: {lang: 0x131, region: 0x86}, + 46: {lang: 0x19d, region: 0x98}, + 47: {lang: 0x394, region: 0x98}, + 48: {lang: 0x51f, region: 0x12d}, + 49: {lang: 0x24b, region: 0xaa}, + 50: {lang: 0x51f, region: 0x52}, + 51: {lang: 0x1c4, region: 0xe6}, + 52: {lang: 0x51f, region: 0x52}, + 53: {lang: 0x51f, region: 0x12d}, + 54: {lang: 0x2f4, region: 0x9a}, + 55: {lang: 0x1b5, region: 0x96}, + 56: {lang: 0x1f8, region: 0xa1}, + 57: {lang: 0x1be, region: 0x12a}, + 58: {lang: 0x1c3, region: 0xae}, + 60: {lang: 0x1ce, region: 0x91}, + 62: {lang: 0x13d, region: 0x9d}, + 63: {lang: 0x24b, region: 0xaa}, + 64: {lang: 0x206, region: 0x94}, + 65: {lang: 0x1f8, region: 0xa1}, + 67: {lang: 0x130, region: 0xc3}, + 68: {lang: 0x1f8, region: 0xa1}, + 69: {lang: 0x3b2, region: 0xe7}, + 70: {lang: 0x242, region: 0xa5}, + 71: {lang: 0x3f0, region: 0x98}, + 74: {lang: 0x249, region: 0x98}, + 75: {lang: 0x24b, region: 0xaa}, + 77: {lang: 0x87, region: 0x98}, + 78: {lang: 0x367, region: 0x122}, + 79: {lang: 0x2af, region: 0xae}, + 84: {lang: 0x296, region: 0x98}, + 85: {lang: 0x29f, region: 0x98}, + 86: {lang: 0x286, region: 0x86}, + 87: {lang: 0x199, region: 0x86}, + 88: {lang: 0x2a3, region: 0x52}, + 90: {lang: 0x4ea, region: 0x12a}, + 91: {lang: 0x4eb, region: 0x12a}, + 92: {lang: 0x1b7, region: 0x98}, + 93: {lang: 0x32e, region: 0x9b}, + 94: {lang: 0x4ed, region: 0x52}, + 95: {lang: 0xa7, region: 0x52}, + 97: {lang: 0x2df, region: 0x111}, + 98: {lang: 0x4ee, region: 0x10a}, + 99: {lang: 0x4ee, region: 0x10a}, + 100: {lang: 0x2fb, region: 0x98}, + 101: {lang: 0x312, region: 0x98}, + 102: {lang: 0x302, region: 0x52}, + 104: {lang: 0x315, region: 0x34}, + 105: {lang: 0x305, region: 0x98}, + 106: {lang: 0x40a, region: 0xe7}, + 107: {lang: 0x328, region: 0xc3}, + 108: {lang: 0x4ef, region: 0x107}, + 109: {lang: 0x3a, region: 0xa0}, + 110: {lang: 0x34a, region: 0xda}, + 112: {lang: 0x2c7, region: 0x83}, + 114: {lang: 0x3f9, region: 0x95}, + 115: {lang: 0x3e5, region: 0x98}, + 116: {lang: 0x392, region: 0xc4}, + 117: {lang: 0x38c, region: 0x98}, + 118: {lang: 0x390, region: 0x134}, + 119: {lang: 0x41f, region: 0x114}, + 120: {lang: 0x3a, region: 0x11b}, + 121: {lang: 0xf9, region: 0xc3}, + 122: {lang: 0x274, region: 0x105}, + 123: {lang: 0x2c0, region: 0x52}, + 124: {lang: 0x396, region: 0x9b}, + 125: {lang: 0x396, region: 0x52}, + 127: {lang: 0x3a4, region: 0xaf}, + 129: {lang: 0x1bf, region: 0x52}, + 130: {lang: 0x4f3, region: 0x9b}, + 181: {lang: 0x3c2, region: 0x94}, + 183: {lang: 0x369, region: 0x10b}, + 184: {lang: 0x416, region: 0x96}, + 186: {lang: 0x4f5, region: 0x15d}, + 187: {lang: 0x3e6, region: 0x98}, + 188: {lang: 0x44, region: 0x134}, + 189: {lang: 0x134, region: 0x7a}, + 190: {lang: 0x3e0, region: 0x98}, + 191: {lang: 0x3e0, region: 0x98}, + 192: {lang: 0x3f0, region: 0x98}, + 193: {lang: 0x402, region: 0xb2}, + 194: {lang: 0x429, region: 0x98}, + 195: {lang: 0x434, region: 0x94}, + 196: {lang: 0x443, region: 0x34}, + 197: {lang: 0x444, region: 0x9a}, + 201: {lang: 0x450, region: 0xe6}, + 202: {lang: 0x116, region: 0x98}, + 203: {lang: 0x454, region: 0x52}, + 204: {lang: 0x22a, region: 0x52}, + 205: {lang: 0x446, region: 0x98}, + 206: {lang: 0x49b, region: 0x52}, + 207: {lang: 0x9d, region: 0x13d}, + 208: {lang: 0x457, region: 0x98}, + 210: {lang: 0x51e, region: 0xb9}, + 211: {lang: 0x14e, region: 0xe6}, + 212: {lang: 0x124, region: 0xcc}, + 213: {lang: 0x461, region: 0x122}, + 214: {lang: 0xa7, region: 0x52}, + 215: {lang: 0x2c5, region: 0x98}, + 216: {lang: 0x4a3, region: 0x11b}, + 217: {lang: 0x4b4, region: 0xb3}, + 219: {lang: 0x1c7, region: 0x98}, + 221: {lang: 0x3a0, region: 0x9b}, + 222: {lang: 0x21, region: 0x9a}, + 223: {lang: 0x1e2, region: 0x52}, +} + +type likelyScriptRegion struct { + region uint16 + script uint8 + flags uint8 +} + +// likelyLang is a lookup table, indexed by langID, for the most likely +// scripts and regions given incomplete information. If more entries exist for a +// given language, region and script are the index and size respectively +// of the list in likelyLangList. +// Size: 5276 bytes, 1319 elements +var likelyLang = [1319]likelyScriptRegion{ + 0: {region: 0x134, script: 0x52, flags: 0x0}, + 1: {region: 0x6e, script: 0x52, flags: 0x0}, + 2: {region: 0x164, script: 0x52, flags: 0x0}, + 3: {region: 0x164, script: 0x52, flags: 0x0}, + 4: {region: 0x164, script: 0x52, flags: 0x0}, + 5: {region: 0x7c, script: 0x1e, flags: 0x0}, + 6: {region: 0x164, script: 0x52, flags: 0x0}, + 7: {region: 0x7f, script: 0x52, flags: 0x0}, + 8: {region: 0x164, script: 0x52, flags: 0x0}, + 9: {region: 0x164, script: 0x52, flags: 0x0}, + 10: {region: 0x164, script: 0x52, flags: 0x0}, + 11: {region: 0x94, script: 0x52, flags: 0x0}, + 12: {region: 0x130, script: 0x52, flags: 0x0}, + 13: {region: 0x7f, script: 0x52, flags: 0x0}, + 14: {region: 0x164, script: 0x52, flags: 0x0}, + 15: {region: 0x164, script: 0x52, flags: 0x0}, + 16: {region: 0x105, script: 0x1e, flags: 0x0}, + 17: {region: 0x164, script: 0x52, flags: 0x0}, + 18: {region: 0x9b, script: 0x9, flags: 0x0}, + 19: {region: 0x127, script: 0x5, flags: 0x0}, + 20: {region: 0x164, script: 0x52, flags: 0x0}, + 21: {region: 0x160, script: 0x52, flags: 0x0}, + 22: {region: 0x164, script: 0x52, flags: 0x0}, + 23: {region: 0x164, script: 0x52, flags: 0x0}, + 24: {region: 0x164, script: 0x52, flags: 0x0}, + 25: {region: 0x164, script: 0x52, flags: 0x0}, + 26: {region: 0x164, script: 0x52, flags: 0x0}, + 27: {region: 0x51, script: 0x52, flags: 0x0}, + 28: {region: 0x164, script: 0x52, flags: 0x0}, + 29: {region: 0x164, script: 0x52, flags: 0x0}, + 30: {region: 0x98, script: 0x4, flags: 0x0}, + 31: {region: 0x164, script: 0x52, flags: 0x0}, + 32: {region: 0x7f, script: 0x52, flags: 0x0}, + 33: {region: 0x9a, script: 0xde, flags: 0x0}, + 34: {region: 0x164, script: 0x52, flags: 0x0}, + 35: {region: 0x164, script: 0x52, flags: 0x0}, + 36: {region: 0x14c, script: 0x52, flags: 0x0}, + 37: {region: 0x105, script: 0x1e, flags: 0x0}, + 38: {region: 0x6e, script: 0x27, flags: 0x0}, + 39: {region: 0x164, script: 0x52, flags: 0x0}, + 40: {region: 0x164, script: 0x52, flags: 0x0}, + 41: {region: 0xd5, script: 0x52, flags: 0x0}, + 42: {region: 0x164, script: 0x52, flags: 0x0}, + 44: {region: 0x164, script: 0x52, flags: 0x0}, + 45: {region: 0x164, script: 0x52, flags: 0x0}, + 46: {region: 0x164, script: 0x52, flags: 0x0}, + 47: {region: 0x164, script: 0x52, flags: 0x0}, + 48: {region: 0x164, script: 0x52, flags: 0x0}, + 49: {region: 0x164, script: 0x52, flags: 0x0}, + 50: {region: 0x94, script: 0x52, flags: 0x0}, + 51: {region: 0x164, script: 0x5, flags: 0x0}, + 52: {region: 0x121, script: 0x5, flags: 0x0}, + 53: {region: 0x164, script: 0x52, flags: 0x0}, + 54: {region: 0x164, script: 0x52, flags: 0x0}, + 55: {region: 0x164, script: 0x52, flags: 0x0}, + 56: {region: 0x164, script: 0x52, flags: 0x0}, + 57: {region: 0x6a, script: 0x5, flags: 0x0}, + 58: {region: 0x0, script: 0x3, flags: 0x1}, + 59: {region: 0x164, script: 0x52, flags: 0x0}, + 60: {region: 0x50, script: 0x52, flags: 0x0}, + 61: {region: 0x3e, script: 0x52, flags: 0x0}, + 62: {region: 0x66, script: 0x5, flags: 0x0}, + 64: {region: 0xb9, script: 0x5, flags: 0x0}, + 65: {region: 0x6a, script: 0x5, flags: 0x0}, + 66: {region: 0x98, script: 0xe, flags: 0x0}, + 67: {region: 0x12e, script: 0x52, flags: 0x0}, + 68: {region: 0x134, script: 0xbc, flags: 0x0}, + 69: {region: 0x164, script: 0x52, flags: 0x0}, + 70: {region: 0x164, script: 0x52, flags: 0x0}, + 71: {region: 0x6d, script: 0x52, flags: 0x0}, + 72: {region: 0x164, script: 0x52, flags: 0x0}, + 73: {region: 0x164, script: 0x52, flags: 0x0}, + 74: {region: 0x48, script: 0x52, flags: 0x0}, + 75: {region: 0x164, script: 0x52, flags: 0x0}, + 76: {region: 0x105, script: 0x1e, flags: 0x0}, + 77: {region: 0x164, script: 0x5, flags: 0x0}, + 78: {region: 0x164, script: 0x52, flags: 0x0}, + 79: {region: 0x164, script: 0x52, flags: 0x0}, + 80: {region: 0x164, script: 0x52, flags: 0x0}, + 81: {region: 0x98, script: 0x20, flags: 0x0}, + 82: {region: 0x164, script: 0x52, flags: 0x0}, + 83: {region: 0x164, script: 0x52, flags: 0x0}, + 84: {region: 0x164, script: 0x52, flags: 0x0}, + 85: {region: 0x3e, script: 0x52, flags: 0x0}, + 86: {region: 0x164, script: 0x52, flags: 0x0}, + 87: {region: 0x3, script: 0x5, flags: 0x1}, + 88: {region: 0x105, script: 0x1e, flags: 0x0}, + 89: {region: 0xe7, script: 0x5, flags: 0x0}, + 90: {region: 0x94, script: 0x52, flags: 0x0}, + 91: {region: 0xda, script: 0x20, flags: 0x0}, + 92: {region: 0x2d, script: 0x52, flags: 0x0}, + 93: {region: 0x51, script: 0x52, flags: 0x0}, + 94: {region: 0x164, script: 0x52, flags: 0x0}, + 95: {region: 0x51, script: 0xb, flags: 0x0}, + 96: {region: 0x164, script: 0x52, flags: 0x0}, + 97: {region: 0x164, script: 0x52, flags: 0x0}, + 98: {region: 0x94, script: 0x52, flags: 0x0}, + 99: {region: 0x164, script: 0x52, flags: 0x0}, + 100: {region: 0x51, script: 0x52, flags: 0x0}, + 101: {region: 0x164, script: 0x52, flags: 0x0}, + 102: {region: 0x164, script: 0x52, flags: 0x0}, + 103: {region: 0x164, script: 0x52, flags: 0x0}, + 104: {region: 0x164, script: 0x52, flags: 0x0}, + 105: {region: 0x4e, script: 0x52, flags: 0x0}, + 106: {region: 0x164, script: 0x52, flags: 0x0}, + 107: {region: 0x164, script: 0x52, flags: 0x0}, + 108: {region: 0x164, script: 0x52, flags: 0x0}, + 109: {region: 0x164, script: 0x27, flags: 0x0}, + 110: {region: 0x164, script: 0x52, flags: 0x0}, + 111: {region: 0x164, script: 0x52, flags: 0x0}, + 112: {region: 0x46, script: 0x1e, flags: 0x0}, + 113: {region: 0x164, script: 0x52, flags: 0x0}, + 114: {region: 0x164, script: 0x52, flags: 0x0}, + 115: {region: 0x10a, script: 0x5, flags: 0x0}, + 116: {region: 0x161, script: 0x52, flags: 0x0}, + 117: {region: 0x164, script: 0x52, flags: 0x0}, + 118: {region: 0x94, script: 0x52, flags: 0x0}, + 119: {region: 0x164, script: 0x52, flags: 0x0}, + 120: {region: 0x12e, script: 0x52, flags: 0x0}, + 121: {region: 0x51, script: 0x52, flags: 0x0}, + 122: {region: 0x98, script: 0xcd, flags: 0x0}, + 123: {region: 0xe7, script: 0x5, flags: 0x0}, + 124: {region: 0x98, script: 0x20, flags: 0x0}, + 125: {region: 0x37, script: 0x1e, flags: 0x0}, + 126: {region: 0x98, script: 0x20, flags: 0x0}, + 127: {region: 0xe7, script: 0x5, flags: 0x0}, + 128: {region: 0x12a, script: 0x2d, flags: 0x0}, + 130: {region: 0x98, script: 0x20, flags: 0x0}, + 131: {region: 0x164, script: 0x52, flags: 0x0}, + 132: {region: 0x98, script: 0x20, flags: 0x0}, + 133: {region: 0xe6, script: 0x52, flags: 0x0}, + 134: {region: 0x164, script: 0x52, flags: 0x0}, + 135: {region: 0x98, script: 0x20, flags: 0x0}, + 136: {region: 0x164, script: 0x52, flags: 0x0}, + 137: {region: 0x13e, script: 0x52, flags: 0x0}, + 138: {region: 0x164, script: 0x52, flags: 0x0}, + 139: {region: 0x164, script: 0x52, flags: 0x0}, + 140: {region: 0xe6, script: 0x52, flags: 0x0}, + 141: {region: 0x164, script: 0x52, flags: 0x0}, + 142: {region: 0xd5, script: 0x52, flags: 0x0}, + 143: {region: 0x164, script: 0x52, flags: 0x0}, + 144: {region: 0x164, script: 0x52, flags: 0x0}, + 145: {region: 0x164, script: 0x52, flags: 0x0}, + 146: {region: 0x164, script: 0x27, flags: 0x0}, + 147: {region: 0x98, script: 0x20, flags: 0x0}, + 148: {region: 0x94, script: 0x52, flags: 0x0}, + 149: {region: 0x164, script: 0x52, flags: 0x0}, + 150: {region: 0x164, script: 0x52, flags: 0x0}, + 151: {region: 0x164, script: 0x52, flags: 0x0}, + 152: {region: 0x164, script: 0x52, flags: 0x0}, + 153: {region: 0x51, script: 0x52, flags: 0x0}, + 154: {region: 0x164, script: 0x52, flags: 0x0}, + 155: {region: 0xe6, script: 0x52, flags: 0x0}, + 156: {region: 0x164, script: 0x52, flags: 0x0}, + 157: {region: 0x13d, script: 0xcf, flags: 0x0}, + 158: {region: 0xc2, script: 0x52, flags: 0x0}, + 159: {region: 0x164, script: 0x52, flags: 0x0}, + 160: {region: 0x164, script: 0x52, flags: 0x0}, + 161: {region: 0xc2, script: 0x52, flags: 0x0}, + 162: {region: 0x164, script: 0x52, flags: 0x0}, + 163: {region: 0x34, script: 0xe, flags: 0x0}, + 164: {region: 0x164, script: 0x52, flags: 0x0}, + 165: {region: 0x164, script: 0x52, flags: 0x0}, + 166: {region: 0x164, script: 0x52, flags: 0x0}, + 167: {region: 0x52, script: 0xd6, flags: 0x0}, + 168: {region: 0x164, script: 0x52, flags: 0x0}, + 169: {region: 0x164, script: 0x52, flags: 0x0}, + 170: {region: 0x164, script: 0x52, flags: 0x0}, + 171: {region: 0x98, script: 0xe, flags: 0x0}, + 172: {region: 0x164, script: 0x52, flags: 0x0}, + 173: {region: 0x9b, script: 0x5, flags: 0x0}, + 174: {region: 0x164, script: 0x52, flags: 0x0}, + 175: {region: 0x4e, script: 0x52, flags: 0x0}, + 176: {region: 0x77, script: 0x52, flags: 0x0}, + 177: {region: 0x98, script: 0x20, flags: 0x0}, + 178: {region: 0xe7, script: 0x5, flags: 0x0}, + 179: {region: 0x98, script: 0x20, flags: 0x0}, + 180: {region: 0x164, script: 0x52, flags: 0x0}, + 181: {region: 0x32, script: 0x52, flags: 0x0}, + 182: {region: 0x164, script: 0x52, flags: 0x0}, + 183: {region: 0xb3, script: 0xc, flags: 0x0}, + 184: {region: 0x51, script: 0x52, flags: 0x0}, + 185: {region: 0x164, script: 0x27, flags: 0x0}, + 186: {region: 0xe6, script: 0x52, flags: 0x0}, + 187: {region: 0x164, script: 0x52, flags: 0x0}, + 188: {region: 0xe7, script: 0x20, flags: 0x0}, + 189: {region: 0x105, script: 0x1e, flags: 0x0}, + 190: {region: 0x15e, script: 0x52, flags: 0x0}, + 191: {region: 0x164, script: 0x52, flags: 0x0}, + 192: {region: 0x94, script: 0x52, flags: 0x0}, + 193: {region: 0x164, script: 0x52, flags: 0x0}, + 194: {region: 0x51, script: 0x52, flags: 0x0}, + 195: {region: 0x164, script: 0x52, flags: 0x0}, + 196: {region: 0x164, script: 0x52, flags: 0x0}, + 197: {region: 0x164, script: 0x52, flags: 0x0}, + 198: {region: 0x85, script: 0x52, flags: 0x0}, + 199: {region: 0x164, script: 0x52, flags: 0x0}, + 200: {region: 0x164, script: 0x52, flags: 0x0}, + 201: {region: 0x164, script: 0x52, flags: 0x0}, + 202: {region: 0x164, script: 0x52, flags: 0x0}, + 203: {region: 0x6c, script: 0x27, flags: 0x0}, + 204: {region: 0x164, script: 0x52, flags: 0x0}, + 205: {region: 0x164, script: 0x52, flags: 0x0}, + 206: {region: 0x51, script: 0x52, flags: 0x0}, + 207: {region: 0x164, script: 0x52, flags: 0x0}, + 208: {region: 0x164, script: 0x52, flags: 0x0}, + 209: {region: 0xc2, script: 0x52, flags: 0x0}, + 210: {region: 0x164, script: 0x52, flags: 0x0}, + 211: {region: 0x164, script: 0x52, flags: 0x0}, + 212: {region: 0x164, script: 0x52, flags: 0x0}, + 213: {region: 0x6d, script: 0x52, flags: 0x0}, + 214: {region: 0x164, script: 0x52, flags: 0x0}, + 215: {region: 0x164, script: 0x52, flags: 0x0}, + 216: {region: 0xd5, script: 0x52, flags: 0x0}, + 217: {region: 0x8, script: 0x2, flags: 0x1}, + 218: {region: 0x105, script: 0x1e, flags: 0x0}, + 219: {region: 0xe6, script: 0x52, flags: 0x0}, + 220: {region: 0x164, script: 0x52, flags: 0x0}, + 221: {region: 0x130, script: 0x52, flags: 0x0}, + 222: {region: 0x89, script: 0x52, flags: 0x0}, + 223: {region: 0x74, script: 0x52, flags: 0x0}, + 224: {region: 0x105, script: 0x1e, flags: 0x0}, + 225: {region: 0x134, script: 0x52, flags: 0x0}, + 226: {region: 0x48, script: 0x52, flags: 0x0}, + 227: {region: 0x134, script: 0x1a, flags: 0x0}, + 228: {region: 0xa5, script: 0x5, flags: 0x0}, + 229: {region: 0x13d, script: 0x19, flags: 0x0}, + 230: {region: 0x164, script: 0x52, flags: 0x0}, + 231: {region: 0x9a, script: 0x5, flags: 0x0}, + 232: {region: 0x164, script: 0x52, flags: 0x0}, + 233: {region: 0x164, script: 0x52, flags: 0x0}, + 234: {region: 0x164, script: 0x52, flags: 0x0}, + 235: {region: 0x164, script: 0x52, flags: 0x0}, + 236: {region: 0x164, script: 0x52, flags: 0x0}, + 237: {region: 0x77, script: 0x52, flags: 0x0}, + 238: {region: 0x6a, script: 0x1c, flags: 0x0}, + 239: {region: 0xe6, script: 0x52, flags: 0x0}, + 240: {region: 0x48, script: 0x17, flags: 0x0}, + 241: {region: 0x48, script: 0x17, flags: 0x0}, + 242: {region: 0x48, script: 0x17, flags: 0x0}, + 243: {region: 0x48, script: 0x17, flags: 0x0}, + 244: {region: 0x48, script: 0x17, flags: 0x0}, + 245: {region: 0x109, script: 0x52, flags: 0x0}, + 246: {region: 0x5d, script: 0x52, flags: 0x0}, + 247: {region: 0xe8, script: 0x52, flags: 0x0}, + 248: {region: 0x48, script: 0x17, flags: 0x0}, + 249: {region: 0xc3, script: 0x79, flags: 0x0}, + 250: {region: 0xa, script: 0x2, flags: 0x1}, + 251: {region: 0x105, script: 0x1e, flags: 0x0}, + 252: {region: 0x7a, script: 0x52, flags: 0x0}, + 253: {region: 0x62, script: 0x52, flags: 0x0}, + 254: {region: 0x164, script: 0x52, flags: 0x0}, + 255: {region: 0x164, script: 0x52, flags: 0x0}, + 256: {region: 0x164, script: 0x52, flags: 0x0}, + 257: {region: 0x164, script: 0x52, flags: 0x0}, + 258: {region: 0x134, script: 0x52, flags: 0x0}, + 259: {region: 0x105, script: 0x1e, flags: 0x0}, + 260: {region: 0xa3, script: 0x52, flags: 0x0}, + 261: {region: 0x164, script: 0x52, flags: 0x0}, + 262: {region: 0x164, script: 0x52, flags: 0x0}, + 263: {region: 0x98, script: 0x5, flags: 0x0}, + 264: {region: 0x164, script: 0x52, flags: 0x0}, + 265: {region: 0x5f, script: 0x52, flags: 0x0}, + 266: {region: 0x164, script: 0x52, flags: 0x0}, + 267: {region: 0x48, script: 0x52, flags: 0x0}, + 268: {region: 0x164, script: 0x52, flags: 0x0}, + 269: {region: 0x164, script: 0x52, flags: 0x0}, + 270: {region: 0x164, script: 0x52, flags: 0x0}, + 271: {region: 0x164, script: 0x5, flags: 0x0}, + 272: {region: 0x48, script: 0x52, flags: 0x0}, + 273: {region: 0x164, script: 0x52, flags: 0x0}, + 274: {region: 0x164, script: 0x52, flags: 0x0}, + 275: {region: 0xd3, script: 0x52, flags: 0x0}, + 276: {region: 0x4e, script: 0x52, flags: 0x0}, + 277: {region: 0x164, script: 0x52, flags: 0x0}, + 278: {region: 0x98, script: 0x5, flags: 0x0}, + 279: {region: 0x164, script: 0x52, flags: 0x0}, + 280: {region: 0x164, script: 0x52, flags: 0x0}, + 281: {region: 0x164, script: 0x52, flags: 0x0}, + 282: {region: 0x164, script: 0x27, flags: 0x0}, + 283: {region: 0x5f, script: 0x52, flags: 0x0}, + 284: {region: 0xc2, script: 0x52, flags: 0x0}, + 285: {region: 0xcf, script: 0x52, flags: 0x0}, + 286: {region: 0x164, script: 0x52, flags: 0x0}, + 287: {region: 0xda, script: 0x20, flags: 0x0}, + 288: {region: 0x51, script: 0x52, flags: 0x0}, + 289: {region: 0x164, script: 0x52, flags: 0x0}, + 290: {region: 0x164, script: 0x52, flags: 0x0}, + 291: {region: 0x164, script: 0x52, flags: 0x0}, + 292: {region: 0xcc, script: 0xd4, flags: 0x0}, + 293: {region: 0x164, script: 0x52, flags: 0x0}, + 294: {region: 0x164, script: 0x52, flags: 0x0}, + 295: {region: 0x113, script: 0x52, flags: 0x0}, + 296: {region: 0x36, script: 0x52, flags: 0x0}, + 297: {region: 0x42, script: 0xd6, flags: 0x0}, + 298: {region: 0x164, script: 0x52, flags: 0x0}, + 299: {region: 0xa3, script: 0x52, flags: 0x0}, + 300: {region: 0x7f, script: 0x52, flags: 0x0}, + 301: {region: 0xd5, script: 0x52, flags: 0x0}, + 302: {region: 0x9d, script: 0x52, flags: 0x0}, + 303: {region: 0x6a, script: 0x25, flags: 0x0}, + 304: {region: 0xc3, script: 0x43, flags: 0x0}, + 305: {region: 0x86, script: 0x2d, flags: 0x0}, + 306: {region: 0x164, script: 0x52, flags: 0x0}, + 307: {region: 0x164, script: 0x52, flags: 0x0}, + 308: {region: 0xc, script: 0x2, flags: 0x1}, + 309: {region: 0x164, script: 0x52, flags: 0x0}, + 310: {region: 0x164, script: 0x52, flags: 0x0}, + 311: {region: 0x1, script: 0x52, flags: 0x0}, + 312: {region: 0x164, script: 0x52, flags: 0x0}, + 313: {region: 0x6d, script: 0x52, flags: 0x0}, + 314: {region: 0x134, script: 0x52, flags: 0x0}, + 315: {region: 0x69, script: 0x52, flags: 0x0}, + 316: {region: 0x164, script: 0x52, flags: 0x0}, + 317: {region: 0x9d, script: 0x3e, flags: 0x0}, + 318: {region: 0x164, script: 0x52, flags: 0x0}, + 319: {region: 0x164, script: 0x52, flags: 0x0}, + 320: {region: 0x6d, script: 0x52, flags: 0x0}, + 321: {region: 0x51, script: 0x52, flags: 0x0}, + 322: {region: 0x6d, script: 0x52, flags: 0x0}, + 323: {region: 0x9b, script: 0x5, flags: 0x0}, + 324: {region: 0x164, script: 0x52, flags: 0x0}, + 325: {region: 0x164, script: 0x52, flags: 0x0}, + 326: {region: 0x164, script: 0x52, flags: 0x0}, + 327: {region: 0x164, script: 0x52, flags: 0x0}, + 328: {region: 0x85, script: 0x52, flags: 0x0}, + 329: {region: 0xe, script: 0x2, flags: 0x1}, + 330: {region: 0x164, script: 0x52, flags: 0x0}, + 331: {region: 0xc2, script: 0x52, flags: 0x0}, + 332: {region: 0x71, script: 0x52, flags: 0x0}, + 333: {region: 0x10a, script: 0x5, flags: 0x0}, + 334: {region: 0xe6, script: 0x52, flags: 0x0}, + 335: {region: 0x10b, script: 0x52, flags: 0x0}, + 336: {region: 0x72, script: 0x52, flags: 0x0}, + 337: {region: 0x164, script: 0x52, flags: 0x0}, + 338: {region: 0x164, script: 0x52, flags: 0x0}, + 339: {region: 0x75, script: 0x52, flags: 0x0}, + 340: {region: 0x164, script: 0x52, flags: 0x0}, + 341: {region: 0x3a, script: 0x52, flags: 0x0}, + 342: {region: 0x164, script: 0x52, flags: 0x0}, + 343: {region: 0x164, script: 0x52, flags: 0x0}, + 344: {region: 0x164, script: 0x52, flags: 0x0}, + 345: {region: 0x77, script: 0x52, flags: 0x0}, + 346: {region: 0x134, script: 0x52, flags: 0x0}, + 347: {region: 0x77, script: 0x52, flags: 0x0}, + 348: {region: 0x5f, script: 0x52, flags: 0x0}, + 349: {region: 0x5f, script: 0x52, flags: 0x0}, + 350: {region: 0x51, script: 0x5, flags: 0x0}, + 351: {region: 0x13f, script: 0x52, flags: 0x0}, + 352: {region: 0x164, script: 0x52, flags: 0x0}, + 353: {region: 0x83, script: 0x52, flags: 0x0}, + 354: {region: 0x164, script: 0x52, flags: 0x0}, + 355: {region: 0xd3, script: 0x52, flags: 0x0}, + 356: {region: 0x9d, script: 0x52, flags: 0x0}, + 357: {region: 0xd5, script: 0x52, flags: 0x0}, + 358: {region: 0x164, script: 0x52, flags: 0x0}, + 359: {region: 0x10a, script: 0x52, flags: 0x0}, + 360: {region: 0xd8, script: 0x52, flags: 0x0}, + 361: {region: 0x95, script: 0x52, flags: 0x0}, + 362: {region: 0x7f, script: 0x52, flags: 0x0}, + 363: {region: 0x164, script: 0x52, flags: 0x0}, + 364: {region: 0xbb, script: 0x52, flags: 0x0}, + 365: {region: 0x164, script: 0x52, flags: 0x0}, + 366: {region: 0x164, script: 0x52, flags: 0x0}, + 367: {region: 0x164, script: 0x52, flags: 0x0}, + 368: {region: 0x52, script: 0x34, flags: 0x0}, + 369: {region: 0x164, script: 0x52, flags: 0x0}, + 370: {region: 0x94, script: 0x52, flags: 0x0}, + 371: {region: 0x164, script: 0x52, flags: 0x0}, + 372: {region: 0x98, script: 0x20, flags: 0x0}, + 373: {region: 0x164, script: 0x52, flags: 0x0}, + 374: {region: 0x9b, script: 0x5, flags: 0x0}, + 375: {region: 0x7d, script: 0x52, flags: 0x0}, + 376: {region: 0x7a, script: 0x52, flags: 0x0}, + 377: {region: 0x164, script: 0x52, flags: 0x0}, + 378: {region: 0x164, script: 0x52, flags: 0x0}, + 379: {region: 0x164, script: 0x52, flags: 0x0}, + 380: {region: 0x164, script: 0x52, flags: 0x0}, + 381: {region: 0x164, script: 0x52, flags: 0x0}, + 382: {region: 0x164, script: 0x52, flags: 0x0}, + 383: {region: 0x6e, script: 0x27, flags: 0x0}, + 384: {region: 0x164, script: 0x52, flags: 0x0}, + 385: {region: 0xda, script: 0x20, flags: 0x0}, + 386: {region: 0x164, script: 0x52, flags: 0x0}, + 387: {region: 0xa6, script: 0x52, flags: 0x0}, + 388: {region: 0x164, script: 0x52, flags: 0x0}, + 389: {region: 0xe7, script: 0x5, flags: 0x0}, + 390: {region: 0x164, script: 0x52, flags: 0x0}, + 391: {region: 0xe7, script: 0x5, flags: 0x0}, + 392: {region: 0x164, script: 0x52, flags: 0x0}, + 393: {region: 0x164, script: 0x52, flags: 0x0}, + 394: {region: 0x6d, script: 0x52, flags: 0x0}, + 395: {region: 0x9b, script: 0x5, flags: 0x0}, + 396: {region: 0x164, script: 0x52, flags: 0x0}, + 397: {region: 0x164, script: 0x27, flags: 0x0}, + 398: {region: 0xf0, script: 0x52, flags: 0x0}, + 399: {region: 0x164, script: 0x52, flags: 0x0}, + 400: {region: 0x164, script: 0x52, flags: 0x0}, + 401: {region: 0x164, script: 0x52, flags: 0x0}, + 402: {region: 0x164, script: 0x27, flags: 0x0}, + 403: {region: 0x164, script: 0x52, flags: 0x0}, + 404: {region: 0x98, script: 0x20, flags: 0x0}, + 405: {region: 0x98, script: 0xd0, flags: 0x0}, + 406: {region: 0x94, script: 0x52, flags: 0x0}, + 407: {region: 0xd8, script: 0x52, flags: 0x0}, + 408: {region: 0x12f, script: 0x2b, flags: 0x0}, + 409: {region: 0x10, script: 0x2, flags: 0x1}, + 410: {region: 0x98, script: 0xe, flags: 0x0}, + 411: {region: 0x164, script: 0x52, flags: 0x0}, + 412: {region: 0x4d, script: 0x52, flags: 0x0}, + 413: {region: 0x98, script: 0x2e, flags: 0x0}, + 414: {region: 0x40, script: 0x52, flags: 0x0}, + 415: {region: 0x53, script: 0x52, flags: 0x0}, + 416: {region: 0x164, script: 0x52, flags: 0x0}, + 417: {region: 0x7f, script: 0x52, flags: 0x0}, + 418: {region: 0x164, script: 0x52, flags: 0x0}, + 419: {region: 0x164, script: 0x52, flags: 0x0}, + 420: {region: 0xa3, script: 0x52, flags: 0x0}, + 421: {region: 0x97, script: 0x52, flags: 0x0}, + 422: {region: 0x164, script: 0x52, flags: 0x0}, + 423: {region: 0xda, script: 0x20, flags: 0x0}, + 424: {region: 0x164, script: 0x52, flags: 0x0}, + 425: {region: 0x164, script: 0x5, flags: 0x0}, + 426: {region: 0x48, script: 0x52, flags: 0x0}, + 427: {region: 0x164, script: 0x5, flags: 0x0}, + 428: {region: 0x164, script: 0x52, flags: 0x0}, + 429: {region: 0x12, script: 0x3, flags: 0x1}, + 430: {region: 0x164, script: 0x52, flags: 0x0}, + 431: {region: 0x52, script: 0x34, flags: 0x0}, + 432: {region: 0x164, script: 0x52, flags: 0x0}, + 433: {region: 0x134, script: 0x52, flags: 0x0}, + 434: {region: 0x23, script: 0x5, flags: 0x0}, + 435: {region: 0x164, script: 0x52, flags: 0x0}, + 436: {region: 0x164, script: 0x27, flags: 0x0}, + 437: {region: 0x96, script: 0x37, flags: 0x0}, + 438: {region: 0x164, script: 0x52, flags: 0x0}, + 439: {region: 0x98, script: 0x20, flags: 0x0}, + 440: {region: 0x164, script: 0x52, flags: 0x0}, + 441: {region: 0x72, script: 0x52, flags: 0x0}, + 442: {region: 0x164, script: 0x52, flags: 0x0}, + 443: {region: 0x164, script: 0x52, flags: 0x0}, + 444: {region: 0xe6, script: 0x52, flags: 0x0}, + 445: {region: 0x164, script: 0x52, flags: 0x0}, + 446: {region: 0x12a, script: 0x39, flags: 0x0}, + 447: {region: 0x52, script: 0x81, flags: 0x0}, + 448: {region: 0x164, script: 0x52, flags: 0x0}, + 449: {region: 0xe7, script: 0x5, flags: 0x0}, + 450: {region: 0x98, script: 0x20, flags: 0x0}, + 451: {region: 0xae, script: 0x3a, flags: 0x0}, + 452: {region: 0xe6, script: 0x52, flags: 0x0}, + 453: {region: 0xe7, script: 0x5, flags: 0x0}, + 454: {region: 0xe5, script: 0x52, flags: 0x0}, + 455: {region: 0x98, script: 0x20, flags: 0x0}, + 456: {region: 0x98, script: 0x20, flags: 0x0}, + 457: {region: 0x164, script: 0x52, flags: 0x0}, + 458: {region: 0x8f, script: 0x52, flags: 0x0}, + 459: {region: 0x5f, script: 0x52, flags: 0x0}, + 460: {region: 0x52, script: 0x34, flags: 0x0}, + 461: {region: 0x90, script: 0x52, flags: 0x0}, + 462: {region: 0x91, script: 0x52, flags: 0x0}, + 463: {region: 0x164, script: 0x52, flags: 0x0}, + 464: {region: 0x27, script: 0x8, flags: 0x0}, + 465: {region: 0xd1, script: 0x52, flags: 0x0}, + 466: {region: 0x77, script: 0x52, flags: 0x0}, + 467: {region: 0x164, script: 0x52, flags: 0x0}, + 468: {region: 0x164, script: 0x52, flags: 0x0}, + 469: {region: 0xcf, script: 0x52, flags: 0x0}, + 470: {region: 0xd5, script: 0x52, flags: 0x0}, + 471: {region: 0x164, script: 0x52, flags: 0x0}, + 472: {region: 0x164, script: 0x52, flags: 0x0}, + 473: {region: 0x164, script: 0x52, flags: 0x0}, + 474: {region: 0x94, script: 0x52, flags: 0x0}, + 475: {region: 0x164, script: 0x52, flags: 0x0}, + 476: {region: 0x164, script: 0x52, flags: 0x0}, + 477: {region: 0x164, script: 0x52, flags: 0x0}, + 479: {region: 0xd5, script: 0x52, flags: 0x0}, + 480: {region: 0x164, script: 0x52, flags: 0x0}, + 481: {region: 0x164, script: 0x52, flags: 0x0}, + 482: {region: 0x52, script: 0xdf, flags: 0x0}, + 483: {region: 0x164, script: 0x52, flags: 0x0}, + 484: {region: 0x134, script: 0x52, flags: 0x0}, + 485: {region: 0x164, script: 0x52, flags: 0x0}, + 486: {region: 0x48, script: 0x52, flags: 0x0}, + 487: {region: 0x164, script: 0x52, flags: 0x0}, + 488: {region: 0x164, script: 0x52, flags: 0x0}, + 489: {region: 0xe6, script: 0x52, flags: 0x0}, + 490: {region: 0x164, script: 0x52, flags: 0x0}, + 491: {region: 0x94, script: 0x52, flags: 0x0}, + 492: {region: 0x105, script: 0x1e, flags: 0x0}, + 494: {region: 0x164, script: 0x52, flags: 0x0}, + 495: {region: 0x164, script: 0x52, flags: 0x0}, + 496: {region: 0x9c, script: 0x52, flags: 0x0}, + 497: {region: 0x9d, script: 0x52, flags: 0x0}, + 498: {region: 0x48, script: 0x17, flags: 0x0}, + 499: {region: 0x96, script: 0x37, flags: 0x0}, + 500: {region: 0x164, script: 0x52, flags: 0x0}, + 501: {region: 0x164, script: 0x52, flags: 0x0}, + 502: {region: 0x105, script: 0x52, flags: 0x0}, + 503: {region: 0x164, script: 0x52, flags: 0x0}, + 504: {region: 0xa1, script: 0x41, flags: 0x0}, + 505: {region: 0x164, script: 0x52, flags: 0x0}, + 506: {region: 0x9f, script: 0x52, flags: 0x0}, + 508: {region: 0x164, script: 0x52, flags: 0x0}, + 509: {region: 0x164, script: 0x52, flags: 0x0}, + 510: {region: 0x164, script: 0x52, flags: 0x0}, + 511: {region: 0x51, script: 0x52, flags: 0x0}, + 512: {region: 0x12f, script: 0x37, flags: 0x0}, + 513: {region: 0x164, script: 0x52, flags: 0x0}, + 514: {region: 0x12e, script: 0x52, flags: 0x0}, + 515: {region: 0xda, script: 0x20, flags: 0x0}, + 516: {region: 0x164, script: 0x52, flags: 0x0}, + 517: {region: 0x62, script: 0x52, flags: 0x0}, + 518: {region: 0x94, script: 0x52, flags: 0x0}, + 519: {region: 0x94, script: 0x52, flags: 0x0}, + 520: {region: 0x7c, script: 0x29, flags: 0x0}, + 521: {region: 0x136, script: 0x1e, flags: 0x0}, + 522: {region: 0x66, script: 0x52, flags: 0x0}, + 523: {region: 0xc3, script: 0x52, flags: 0x0}, + 524: {region: 0x164, script: 0x52, flags: 0x0}, + 525: {region: 0x164, script: 0x52, flags: 0x0}, + 526: {region: 0xd5, script: 0x52, flags: 0x0}, + 527: {region: 0xa3, script: 0x52, flags: 0x0}, + 528: {region: 0xc2, script: 0x52, flags: 0x0}, + 529: {region: 0x105, script: 0x1e, flags: 0x0}, + 530: {region: 0x164, script: 0x52, flags: 0x0}, + 531: {region: 0x164, script: 0x52, flags: 0x0}, + 532: {region: 0x164, script: 0x52, flags: 0x0}, + 533: {region: 0x164, script: 0x52, flags: 0x0}, + 534: {region: 0xd3, script: 0x5, flags: 0x0}, + 535: {region: 0xd5, script: 0x52, flags: 0x0}, + 536: {region: 0x163, script: 0x52, flags: 0x0}, + 537: {region: 0x164, script: 0x52, flags: 0x0}, + 538: {region: 0x164, script: 0x52, flags: 0x0}, + 539: {region: 0x12e, script: 0x52, flags: 0x0}, + 540: {region: 0x121, script: 0x5, flags: 0x0}, + 541: {region: 0x164, script: 0x52, flags: 0x0}, + 542: {region: 0x122, script: 0xd5, flags: 0x0}, + 543: {region: 0x59, script: 0x52, flags: 0x0}, + 544: {region: 0x51, script: 0x52, flags: 0x0}, + 545: {region: 0x164, script: 0x52, flags: 0x0}, + 546: {region: 0x4e, script: 0x52, flags: 0x0}, + 547: {region: 0x98, script: 0x20, flags: 0x0}, + 548: {region: 0x98, script: 0x20, flags: 0x0}, + 549: {region: 0x4a, script: 0x52, flags: 0x0}, + 550: {region: 0x94, script: 0x52, flags: 0x0}, + 551: {region: 0x164, script: 0x52, flags: 0x0}, + 552: {region: 0x40, script: 0x52, flags: 0x0}, + 553: {region: 0x98, script: 0x52, flags: 0x0}, + 554: {region: 0x52, script: 0xcc, flags: 0x0}, + 555: {region: 0x98, script: 0x20, flags: 0x0}, + 556: {region: 0xc2, script: 0x52, flags: 0x0}, + 557: {region: 0x164, script: 0x52, flags: 0x0}, + 558: {region: 0x98, script: 0x6b, flags: 0x0}, + 559: {region: 0xe7, script: 0x5, flags: 0x0}, + 560: {region: 0x164, script: 0x52, flags: 0x0}, + 561: {region: 0xa3, script: 0x52, flags: 0x0}, + 562: {region: 0x164, script: 0x52, flags: 0x0}, + 563: {region: 0x12a, script: 0x52, flags: 0x0}, + 564: {region: 0x164, script: 0x52, flags: 0x0}, + 565: {region: 0xd1, script: 0x52, flags: 0x0}, + 566: {region: 0x164, script: 0x52, flags: 0x0}, + 567: {region: 0xae, script: 0x4f, flags: 0x0}, + 568: {region: 0x164, script: 0x52, flags: 0x0}, + 569: {region: 0x164, script: 0x52, flags: 0x0}, + 570: {region: 0x15, script: 0x6, flags: 0x1}, + 571: {region: 0x164, script: 0x52, flags: 0x0}, + 572: {region: 0x51, script: 0x52, flags: 0x0}, + 573: {region: 0x81, script: 0x52, flags: 0x0}, + 574: {region: 0xa3, script: 0x52, flags: 0x0}, + 575: {region: 0x164, script: 0x52, flags: 0x0}, + 576: {region: 0x164, script: 0x52, flags: 0x0}, + 577: {region: 0x164, script: 0x52, flags: 0x0}, + 578: {region: 0xa5, script: 0x46, flags: 0x0}, + 579: {region: 0x29, script: 0x52, flags: 0x0}, + 580: {region: 0x164, script: 0x52, flags: 0x0}, + 581: {region: 0x164, script: 0x52, flags: 0x0}, + 582: {region: 0x164, script: 0x52, flags: 0x0}, + 583: {region: 0x164, script: 0x52, flags: 0x0}, + 584: {region: 0x164, script: 0x52, flags: 0x0}, + 585: {region: 0x98, script: 0x4a, flags: 0x0}, + 586: {region: 0x164, script: 0x52, flags: 0x0}, + 587: {region: 0xaa, script: 0x4b, flags: 0x0}, + 588: {region: 0x105, script: 0x1e, flags: 0x0}, + 589: {region: 0x98, script: 0x20, flags: 0x0}, + 590: {region: 0x164, script: 0x52, flags: 0x0}, + 591: {region: 0x74, script: 0x52, flags: 0x0}, + 592: {region: 0x164, script: 0x52, flags: 0x0}, + 593: {region: 0xb3, script: 0x52, flags: 0x0}, + 594: {region: 0x164, script: 0x52, flags: 0x0}, + 595: {region: 0x164, script: 0x52, flags: 0x0}, + 596: {region: 0x164, script: 0x52, flags: 0x0}, + 597: {region: 0x164, script: 0x52, flags: 0x0}, + 598: {region: 0x164, script: 0x52, flags: 0x0}, + 599: {region: 0x164, script: 0x52, flags: 0x0}, + 600: {region: 0x164, script: 0x52, flags: 0x0}, + 601: {region: 0x164, script: 0x27, flags: 0x0}, + 603: {region: 0x105, script: 0x1e, flags: 0x0}, + 604: {region: 0x111, script: 0x52, flags: 0x0}, + 605: {region: 0xe6, script: 0x52, flags: 0x0}, + 606: {region: 0x105, script: 0x52, flags: 0x0}, + 607: {region: 0x164, script: 0x52, flags: 0x0}, + 608: {region: 0x98, script: 0x20, flags: 0x0}, + 609: {region: 0x98, script: 0x5, flags: 0x0}, + 610: {region: 0x12e, script: 0x52, flags: 0x0}, + 611: {region: 0x164, script: 0x52, flags: 0x0}, + 612: {region: 0x51, script: 0x52, flags: 0x0}, + 613: {region: 0x5f, script: 0x52, flags: 0x0}, + 614: {region: 0x164, script: 0x52, flags: 0x0}, + 615: {region: 0x164, script: 0x52, flags: 0x0}, + 616: {region: 0x164, script: 0x27, flags: 0x0}, + 617: {region: 0x164, script: 0x52, flags: 0x0}, + 618: {region: 0x164, script: 0x52, flags: 0x0}, + 619: {region: 0x1b, script: 0x3, flags: 0x1}, + 620: {region: 0x164, script: 0x52, flags: 0x0}, + 621: {region: 0x164, script: 0x52, flags: 0x0}, + 622: {region: 0x164, script: 0x52, flags: 0x0}, + 623: {region: 0x164, script: 0x52, flags: 0x0}, + 624: {region: 0x105, script: 0x1e, flags: 0x0}, + 625: {region: 0x164, script: 0x52, flags: 0x0}, + 626: {region: 0x164, script: 0x52, flags: 0x0}, + 627: {region: 0x164, script: 0x52, flags: 0x0}, + 628: {region: 0x105, script: 0x1e, flags: 0x0}, + 629: {region: 0x164, script: 0x52, flags: 0x0}, + 630: {region: 0x94, script: 0x52, flags: 0x0}, + 631: {region: 0xe7, script: 0x5, flags: 0x0}, + 632: {region: 0x7a, script: 0x52, flags: 0x0}, + 633: {region: 0x164, script: 0x52, flags: 0x0}, + 634: {region: 0x164, script: 0x52, flags: 0x0}, + 635: {region: 0x164, script: 0x52, flags: 0x0}, + 636: {region: 0x164, script: 0x27, flags: 0x0}, + 637: {region: 0x122, script: 0xd5, flags: 0x0}, + 638: {region: 0xe7, script: 0x5, flags: 0x0}, + 639: {region: 0x164, script: 0x52, flags: 0x0}, + 640: {region: 0x164, script: 0x52, flags: 0x0}, + 641: {region: 0x1e, script: 0x5, flags: 0x1}, + 642: {region: 0x164, script: 0x52, flags: 0x0}, + 643: {region: 0x164, script: 0x52, flags: 0x0}, + 644: {region: 0x164, script: 0x52, flags: 0x0}, + 645: {region: 0x137, script: 0x52, flags: 0x0}, + 646: {region: 0x86, script: 0x56, flags: 0x0}, + 647: {region: 0x96, script: 0x37, flags: 0x0}, + 648: {region: 0x12e, script: 0x52, flags: 0x0}, + 649: {region: 0xe7, script: 0x5, flags: 0x0}, + 650: {region: 0x130, script: 0x52, flags: 0x0}, + 651: {region: 0x164, script: 0x52, flags: 0x0}, + 652: {region: 0xb6, script: 0x52, flags: 0x0}, + 653: {region: 0x105, script: 0x1e, flags: 0x0}, + 654: {region: 0x164, script: 0x52, flags: 0x0}, + 655: {region: 0x94, script: 0x52, flags: 0x0}, + 656: {region: 0x164, script: 0x52, flags: 0x0}, + 657: {region: 0x52, script: 0xd5, flags: 0x0}, + 658: {region: 0x164, script: 0x52, flags: 0x0}, + 659: {region: 0x164, script: 0x52, flags: 0x0}, + 660: {region: 0x164, script: 0x52, flags: 0x0}, + 661: {region: 0x164, script: 0x52, flags: 0x0}, + 662: {region: 0x98, script: 0x54, flags: 0x0}, + 663: {region: 0x164, script: 0x52, flags: 0x0}, + 664: {region: 0x164, script: 0x52, flags: 0x0}, + 665: {region: 0x105, script: 0x1e, flags: 0x0}, + 666: {region: 0x130, script: 0x52, flags: 0x0}, + 667: {region: 0x164, script: 0x52, flags: 0x0}, + 668: {region: 0xd8, script: 0x52, flags: 0x0}, + 669: {region: 0x164, script: 0x52, flags: 0x0}, + 670: {region: 0x164, script: 0x52, flags: 0x0}, + 671: {region: 0x23, script: 0x2, flags: 0x1}, + 672: {region: 0x164, script: 0x52, flags: 0x0}, + 673: {region: 0x164, script: 0x52, flags: 0x0}, + 674: {region: 0x9d, script: 0x52, flags: 0x0}, + 675: {region: 0x52, script: 0x58, flags: 0x0}, + 676: {region: 0x94, script: 0x52, flags: 0x0}, + 677: {region: 0x9b, script: 0x5, flags: 0x0}, + 678: {region: 0x134, script: 0x52, flags: 0x0}, + 679: {region: 0x164, script: 0x52, flags: 0x0}, + 680: {region: 0x164, script: 0x52, flags: 0x0}, + 681: {region: 0x98, script: 0xd0, flags: 0x0}, + 682: {region: 0x9d, script: 0x52, flags: 0x0}, + 683: {region: 0x164, script: 0x52, flags: 0x0}, + 684: {region: 0x4a, script: 0x52, flags: 0x0}, + 685: {region: 0x164, script: 0x52, flags: 0x0}, + 686: {region: 0x164, script: 0x52, flags: 0x0}, + 687: {region: 0xae, script: 0x4f, flags: 0x0}, + 688: {region: 0x164, script: 0x52, flags: 0x0}, + 689: {region: 0x164, script: 0x52, flags: 0x0}, + 690: {region: 0x4a, script: 0x52, flags: 0x0}, + 691: {region: 0x164, script: 0x52, flags: 0x0}, + 692: {region: 0x164, script: 0x52, flags: 0x0}, + 693: {region: 0x161, script: 0x52, flags: 0x0}, + 694: {region: 0x9b, script: 0x5, flags: 0x0}, + 695: {region: 0xb5, script: 0x52, flags: 0x0}, + 696: {region: 0xb7, script: 0x52, flags: 0x0}, + 697: {region: 0x4a, script: 0x52, flags: 0x0}, + 698: {region: 0x4a, script: 0x52, flags: 0x0}, + 699: {region: 0xa3, script: 0x52, flags: 0x0}, + 700: {region: 0xa3, script: 0x52, flags: 0x0}, + 701: {region: 0x9b, script: 0x5, flags: 0x0}, + 702: {region: 0xb7, script: 0x52, flags: 0x0}, + 703: {region: 0x122, script: 0xd5, flags: 0x0}, + 704: {region: 0x52, script: 0x34, flags: 0x0}, + 705: {region: 0x12a, script: 0x52, flags: 0x0}, + 706: {region: 0x94, script: 0x52, flags: 0x0}, + 707: {region: 0x51, script: 0x52, flags: 0x0}, + 708: {region: 0x98, script: 0x20, flags: 0x0}, + 709: {region: 0x98, script: 0x20, flags: 0x0}, + 710: {region: 0x94, script: 0x52, flags: 0x0}, + 711: {region: 0x25, script: 0x3, flags: 0x1}, + 712: {region: 0xa3, script: 0x52, flags: 0x0}, + 713: {region: 0x164, script: 0x52, flags: 0x0}, + 714: {region: 0xce, script: 0x52, flags: 0x0}, + 715: {region: 0x164, script: 0x52, flags: 0x0}, + 716: {region: 0x164, script: 0x52, flags: 0x0}, + 717: {region: 0x164, script: 0x52, flags: 0x0}, + 718: {region: 0x164, script: 0x52, flags: 0x0}, + 719: {region: 0x164, script: 0x52, flags: 0x0}, + 720: {region: 0x164, script: 0x52, flags: 0x0}, + 721: {region: 0x164, script: 0x52, flags: 0x0}, + 722: {region: 0x164, script: 0x52, flags: 0x0}, + 723: {region: 0x164, script: 0x52, flags: 0x0}, + 724: {region: 0x164, script: 0x52, flags: 0x0}, + 725: {region: 0x164, script: 0x52, flags: 0x0}, + 726: {region: 0x164, script: 0x5, flags: 0x0}, + 727: {region: 0x105, script: 0x1e, flags: 0x0}, + 728: {region: 0xe6, script: 0x52, flags: 0x0}, + 729: {region: 0x164, script: 0x52, flags: 0x0}, + 730: {region: 0x94, script: 0x52, flags: 0x0}, + 731: {region: 0x164, script: 0x27, flags: 0x0}, + 732: {region: 0x164, script: 0x52, flags: 0x0}, + 733: {region: 0x164, script: 0x52, flags: 0x0}, + 734: {region: 0x164, script: 0x52, flags: 0x0}, + 735: {region: 0x111, script: 0x52, flags: 0x0}, + 736: {region: 0xa3, script: 0x52, flags: 0x0}, + 737: {region: 0x164, script: 0x52, flags: 0x0}, + 738: {region: 0x164, script: 0x52, flags: 0x0}, + 739: {region: 0x122, script: 0x5, flags: 0x0}, + 740: {region: 0xcb, script: 0x52, flags: 0x0}, + 741: {region: 0x164, script: 0x52, flags: 0x0}, + 742: {region: 0x164, script: 0x52, flags: 0x0}, + 743: {region: 0x164, script: 0x52, flags: 0x0}, + 744: {region: 0xbe, script: 0x52, flags: 0x0}, + 745: {region: 0xd0, script: 0x52, flags: 0x0}, + 746: {region: 0x164, script: 0x52, flags: 0x0}, + 747: {region: 0x51, script: 0x52, flags: 0x0}, + 748: {region: 0xda, script: 0x20, flags: 0x0}, + 749: {region: 0x12e, script: 0x52, flags: 0x0}, + 750: {region: 0xbf, script: 0x52, flags: 0x0}, + 751: {region: 0x164, script: 0x52, flags: 0x0}, + 752: {region: 0x164, script: 0x52, flags: 0x0}, + 753: {region: 0xdf, script: 0x52, flags: 0x0}, + 754: {region: 0x164, script: 0x52, flags: 0x0}, + 755: {region: 0x94, script: 0x52, flags: 0x0}, + 756: {region: 0x9a, script: 0x36, flags: 0x0}, + 757: {region: 0x164, script: 0x52, flags: 0x0}, + 758: {region: 0xc1, script: 0x1e, flags: 0x0}, + 759: {region: 0x164, script: 0x5, flags: 0x0}, + 760: {region: 0x164, script: 0x52, flags: 0x0}, + 761: {region: 0x164, script: 0x52, flags: 0x0}, + 762: {region: 0x164, script: 0x52, flags: 0x0}, + 763: {region: 0x98, script: 0x64, flags: 0x0}, + 764: {region: 0x164, script: 0x52, flags: 0x0}, + 765: {region: 0x164, script: 0x52, flags: 0x0}, + 766: {region: 0x10a, script: 0x52, flags: 0x0}, + 767: {region: 0x164, script: 0x52, flags: 0x0}, + 768: {region: 0x164, script: 0x52, flags: 0x0}, + 769: {region: 0x164, script: 0x52, flags: 0x0}, + 770: {region: 0x28, script: 0x3, flags: 0x1}, + 771: {region: 0x164, script: 0x52, flags: 0x0}, + 772: {region: 0x164, script: 0x52, flags: 0x0}, + 773: {region: 0x98, script: 0xe, flags: 0x0}, + 774: {region: 0xc3, script: 0x6b, flags: 0x0}, + 776: {region: 0x164, script: 0x52, flags: 0x0}, + 777: {region: 0x48, script: 0x52, flags: 0x0}, + 778: {region: 0x48, script: 0x52, flags: 0x0}, + 779: {region: 0x36, script: 0x52, flags: 0x0}, + 780: {region: 0x164, script: 0x52, flags: 0x0}, + 781: {region: 0x164, script: 0x52, flags: 0x0}, + 782: {region: 0x164, script: 0x52, flags: 0x0}, + 783: {region: 0x164, script: 0x52, flags: 0x0}, + 784: {region: 0x164, script: 0x52, flags: 0x0}, + 785: {region: 0x164, script: 0x52, flags: 0x0}, + 786: {region: 0x98, script: 0x20, flags: 0x0}, + 787: {region: 0xda, script: 0x20, flags: 0x0}, + 788: {region: 0x105, script: 0x1e, flags: 0x0}, + 789: {region: 0x34, script: 0x68, flags: 0x0}, + 790: {region: 0x2b, script: 0x3, flags: 0x1}, + 791: {region: 0xca, script: 0x52, flags: 0x0}, + 792: {region: 0x164, script: 0x52, flags: 0x0}, + 793: {region: 0x164, script: 0x52, flags: 0x0}, + 794: {region: 0x164, script: 0x52, flags: 0x0}, + 795: {region: 0x98, script: 0x20, flags: 0x0}, + 796: {region: 0x51, script: 0x52, flags: 0x0}, + 798: {region: 0x164, script: 0x52, flags: 0x0}, + 799: {region: 0x134, script: 0x52, flags: 0x0}, + 800: {region: 0x164, script: 0x52, flags: 0x0}, + 801: {region: 0x164, script: 0x52, flags: 0x0}, + 802: {region: 0xe7, script: 0x5, flags: 0x0}, + 803: {region: 0xc2, script: 0x52, flags: 0x0}, + 804: {region: 0x98, script: 0x20, flags: 0x0}, + 805: {region: 0x94, script: 0x52, flags: 0x0}, + 806: {region: 0x163, script: 0x52, flags: 0x0}, + 807: {region: 0x164, script: 0x52, flags: 0x0}, + 808: {region: 0xc3, script: 0x6b, flags: 0x0}, + 809: {region: 0x164, script: 0x52, flags: 0x0}, + 810: {region: 0x164, script: 0x27, flags: 0x0}, + 811: {region: 0x105, script: 0x1e, flags: 0x0}, + 812: {region: 0x164, script: 0x52, flags: 0x0}, + 813: {region: 0x130, script: 0x52, flags: 0x0}, + 814: {region: 0x9b, script: 0x5d, flags: 0x0}, + 815: {region: 0x164, script: 0x52, flags: 0x0}, + 816: {region: 0x164, script: 0x52, flags: 0x0}, + 817: {region: 0x9b, script: 0x5, flags: 0x0}, + 818: {region: 0x164, script: 0x52, flags: 0x0}, + 819: {region: 0x164, script: 0x52, flags: 0x0}, + 820: {region: 0x164, script: 0x52, flags: 0x0}, + 821: {region: 0xdc, script: 0x52, flags: 0x0}, + 822: {region: 0x164, script: 0x52, flags: 0x0}, + 823: {region: 0x164, script: 0x52, flags: 0x0}, + 825: {region: 0x164, script: 0x52, flags: 0x0}, + 826: {region: 0x52, script: 0x34, flags: 0x0}, + 827: {region: 0x9d, script: 0x52, flags: 0x0}, + 828: {region: 0xd1, script: 0x52, flags: 0x0}, + 829: {region: 0x164, script: 0x52, flags: 0x0}, + 830: {region: 0xd9, script: 0x52, flags: 0x0}, + 831: {region: 0x164, script: 0x52, flags: 0x0}, + 832: {region: 0x164, script: 0x52, flags: 0x0}, + 833: {region: 0x164, script: 0x52, flags: 0x0}, + 834: {region: 0xce, script: 0x52, flags: 0x0}, + 835: {region: 0x164, script: 0x52, flags: 0x0}, + 836: {region: 0x164, script: 0x52, flags: 0x0}, + 837: {region: 0x163, script: 0x52, flags: 0x0}, + 838: {region: 0xd0, script: 0x52, flags: 0x0}, + 839: {region: 0x5f, script: 0x52, flags: 0x0}, + 840: {region: 0xda, script: 0x20, flags: 0x0}, + 841: {region: 0x164, script: 0x52, flags: 0x0}, + 842: {region: 0xda, script: 0x20, flags: 0x0}, + 843: {region: 0x164, script: 0x52, flags: 0x0}, + 844: {region: 0x164, script: 0x52, flags: 0x0}, + 845: {region: 0xd1, script: 0x52, flags: 0x0}, + 846: {region: 0x164, script: 0x52, flags: 0x0}, + 847: {region: 0x164, script: 0x52, flags: 0x0}, + 848: {region: 0xd0, script: 0x52, flags: 0x0}, + 849: {region: 0x164, script: 0x52, flags: 0x0}, + 850: {region: 0xce, script: 0x52, flags: 0x0}, + 851: {region: 0xce, script: 0x52, flags: 0x0}, + 852: {region: 0x164, script: 0x52, flags: 0x0}, + 853: {region: 0x164, script: 0x52, flags: 0x0}, + 854: {region: 0x94, script: 0x52, flags: 0x0}, + 855: {region: 0x164, script: 0x52, flags: 0x0}, + 856: {region: 0xde, script: 0x52, flags: 0x0}, + 857: {region: 0x164, script: 0x52, flags: 0x0}, + 858: {region: 0x164, script: 0x52, flags: 0x0}, + 859: {region: 0x98, script: 0x52, flags: 0x0}, + 860: {region: 0x164, script: 0x52, flags: 0x0}, + 861: {region: 0x164, script: 0x52, flags: 0x0}, + 862: {region: 0xd8, script: 0x52, flags: 0x0}, + 863: {region: 0x51, script: 0x52, flags: 0x0}, + 864: {region: 0x164, script: 0x52, flags: 0x0}, + 865: {region: 0xd9, script: 0x52, flags: 0x0}, + 866: {region: 0x164, script: 0x52, flags: 0x0}, + 867: {region: 0x51, script: 0x52, flags: 0x0}, + 868: {region: 0x164, script: 0x52, flags: 0x0}, + 869: {region: 0x164, script: 0x52, flags: 0x0}, + 870: {region: 0xd9, script: 0x52, flags: 0x0}, + 871: {region: 0x122, script: 0x4e, flags: 0x0}, + 872: {region: 0x98, script: 0x20, flags: 0x0}, + 873: {region: 0x10b, script: 0xb7, flags: 0x0}, + 874: {region: 0x164, script: 0x52, flags: 0x0}, + 875: {region: 0x164, script: 0x52, flags: 0x0}, + 876: {region: 0x83, script: 0x70, flags: 0x0}, + 877: {region: 0x160, script: 0x52, flags: 0x0}, + 878: {region: 0x164, script: 0x52, flags: 0x0}, + 879: {region: 0x48, script: 0x17, flags: 0x0}, + 880: {region: 0x164, script: 0x52, flags: 0x0}, + 881: {region: 0x160, script: 0x52, flags: 0x0}, + 882: {region: 0x164, script: 0x52, flags: 0x0}, + 883: {region: 0x164, script: 0x52, flags: 0x0}, + 884: {region: 0x164, script: 0x52, flags: 0x0}, + 885: {region: 0x164, script: 0x52, flags: 0x0}, + 886: {region: 0x164, script: 0x52, flags: 0x0}, + 887: {region: 0x116, script: 0x52, flags: 0x0}, + 888: {region: 0x164, script: 0x52, flags: 0x0}, + 889: {region: 0x164, script: 0x52, flags: 0x0}, + 890: {region: 0x134, script: 0x52, flags: 0x0}, + 891: {region: 0x164, script: 0x52, flags: 0x0}, + 892: {region: 0x52, script: 0x52, flags: 0x0}, + 893: {region: 0x164, script: 0x52, flags: 0x0}, + 894: {region: 0xcd, script: 0x52, flags: 0x0}, + 895: {region: 0x12e, script: 0x52, flags: 0x0}, + 896: {region: 0x130, script: 0x52, flags: 0x0}, + 897: {region: 0x7f, script: 0x52, flags: 0x0}, + 898: {region: 0x77, script: 0x52, flags: 0x0}, + 899: {region: 0x164, script: 0x52, flags: 0x0}, + 901: {region: 0x164, script: 0x52, flags: 0x0}, + 902: {region: 0x164, script: 0x52, flags: 0x0}, + 903: {region: 0x6e, script: 0x52, flags: 0x0}, + 904: {region: 0x164, script: 0x52, flags: 0x0}, + 905: {region: 0x164, script: 0x52, flags: 0x0}, + 906: {region: 0x164, script: 0x52, flags: 0x0}, + 907: {region: 0x164, script: 0x52, flags: 0x0}, + 908: {region: 0x98, script: 0x75, flags: 0x0}, + 909: {region: 0x164, script: 0x52, flags: 0x0}, + 910: {region: 0x164, script: 0x5, flags: 0x0}, + 911: {region: 0x7c, script: 0x1e, flags: 0x0}, + 912: {region: 0x134, script: 0x76, flags: 0x0}, + 913: {region: 0x164, script: 0x5, flags: 0x0}, + 914: {region: 0xc4, script: 0x74, flags: 0x0}, + 915: {region: 0x164, script: 0x52, flags: 0x0}, + 916: {region: 0x2e, script: 0x3, flags: 0x1}, + 917: {region: 0xe6, script: 0x52, flags: 0x0}, + 918: {region: 0x31, script: 0x2, flags: 0x1}, + 919: {region: 0xe6, script: 0x52, flags: 0x0}, + 920: {region: 0x2f, script: 0x52, flags: 0x0}, + 921: {region: 0xef, script: 0x52, flags: 0x0}, + 922: {region: 0x164, script: 0x52, flags: 0x0}, + 923: {region: 0x77, script: 0x52, flags: 0x0}, + 924: {region: 0xd5, script: 0x52, flags: 0x0}, + 925: {region: 0x134, script: 0x52, flags: 0x0}, + 926: {region: 0x48, script: 0x52, flags: 0x0}, + 927: {region: 0x164, script: 0x52, flags: 0x0}, + 928: {region: 0x9b, script: 0xdd, flags: 0x0}, + 929: {region: 0x164, script: 0x52, flags: 0x0}, + 930: {region: 0x5f, script: 0x52, flags: 0x0}, + 931: {region: 0x164, script: 0x5, flags: 0x0}, + 932: {region: 0xaf, script: 0x7f, flags: 0x0}, + 934: {region: 0x164, script: 0x52, flags: 0x0}, + 935: {region: 0x164, script: 0x52, flags: 0x0}, + 936: {region: 0x98, script: 0x12, flags: 0x0}, + 937: {region: 0xa3, script: 0x52, flags: 0x0}, + 938: {region: 0xe8, script: 0x52, flags: 0x0}, + 939: {region: 0x164, script: 0x52, flags: 0x0}, + 940: {region: 0x9d, script: 0x52, flags: 0x0}, + 941: {region: 0x164, script: 0x52, flags: 0x0}, + 942: {region: 0x164, script: 0x52, flags: 0x0}, + 943: {region: 0x86, script: 0x2d, flags: 0x0}, + 944: {region: 0x74, script: 0x52, flags: 0x0}, + 945: {region: 0x164, script: 0x52, flags: 0x0}, + 946: {region: 0xe7, script: 0x45, flags: 0x0}, + 947: {region: 0x9b, script: 0x5, flags: 0x0}, + 948: {region: 0x1, script: 0x52, flags: 0x0}, + 949: {region: 0x23, script: 0x5, flags: 0x0}, + 950: {region: 0x164, script: 0x52, flags: 0x0}, + 951: {region: 0x40, script: 0x52, flags: 0x0}, + 952: {region: 0x164, script: 0x52, flags: 0x0}, + 953: {region: 0x79, script: 0x52, flags: 0x0}, + 954: {region: 0x164, script: 0x52, flags: 0x0}, + 955: {region: 0xe3, script: 0x52, flags: 0x0}, + 956: {region: 0x88, script: 0x52, flags: 0x0}, + 957: {region: 0x68, script: 0x52, flags: 0x0}, + 958: {region: 0x164, script: 0x52, flags: 0x0}, + 959: {region: 0x98, script: 0x20, flags: 0x0}, + 960: {region: 0x164, script: 0x52, flags: 0x0}, + 961: {region: 0x101, script: 0x52, flags: 0x0}, + 962: {region: 0x94, script: 0x52, flags: 0x0}, + 963: {region: 0x164, script: 0x52, flags: 0x0}, + 964: {region: 0x164, script: 0x52, flags: 0x0}, + 965: {region: 0x9d, script: 0x52, flags: 0x0}, + 966: {region: 0x164, script: 0x5, flags: 0x0}, + 967: {region: 0x98, script: 0x52, flags: 0x0}, + 968: {region: 0x33, script: 0x2, flags: 0x1}, + 969: {region: 0xda, script: 0x20, flags: 0x0}, + 970: {region: 0x34, script: 0xe, flags: 0x0}, + 971: {region: 0x4d, script: 0x52, flags: 0x0}, + 972: {region: 0x71, script: 0x52, flags: 0x0}, + 973: {region: 0x4d, script: 0x52, flags: 0x0}, + 974: {region: 0x9b, script: 0x5, flags: 0x0}, + 975: {region: 0x10b, script: 0x52, flags: 0x0}, + 976: {region: 0x39, script: 0x52, flags: 0x0}, + 977: {region: 0x164, script: 0x52, flags: 0x0}, + 978: {region: 0xd0, script: 0x52, flags: 0x0}, + 979: {region: 0x103, script: 0x52, flags: 0x0}, + 980: {region: 0x94, script: 0x52, flags: 0x0}, + 981: {region: 0x12e, script: 0x52, flags: 0x0}, + 982: {region: 0x164, script: 0x52, flags: 0x0}, + 983: {region: 0x164, script: 0x52, flags: 0x0}, + 984: {region: 0x72, script: 0x52, flags: 0x0}, + 985: {region: 0x105, script: 0x1e, flags: 0x0}, + 986: {region: 0x12f, script: 0x1e, flags: 0x0}, + 987: {region: 0x108, script: 0x52, flags: 0x0}, + 988: {region: 0x106, script: 0x52, flags: 0x0}, + 989: {region: 0x12e, script: 0x52, flags: 0x0}, + 990: {region: 0x164, script: 0x52, flags: 0x0}, + 991: {region: 0xa1, script: 0x44, flags: 0x0}, + 992: {region: 0x98, script: 0x20, flags: 0x0}, + 993: {region: 0x7f, script: 0x52, flags: 0x0}, + 994: {region: 0x105, script: 0x1e, flags: 0x0}, + 995: {region: 0xa3, script: 0x52, flags: 0x0}, + 996: {region: 0x94, script: 0x52, flags: 0x0}, + 997: {region: 0x98, script: 0x52, flags: 0x0}, + 998: {region: 0x98, script: 0xbb, flags: 0x0}, + 999: {region: 0x164, script: 0x52, flags: 0x0}, + 1000: {region: 0x164, script: 0x52, flags: 0x0}, + 1001: {region: 0x12e, script: 0x52, flags: 0x0}, + 1002: {region: 0x9d, script: 0x52, flags: 0x0}, + 1003: {region: 0x98, script: 0x20, flags: 0x0}, + 1004: {region: 0x164, script: 0x5, flags: 0x0}, + 1005: {region: 0x9d, script: 0x52, flags: 0x0}, + 1006: {region: 0x7a, script: 0x52, flags: 0x0}, + 1007: {region: 0x48, script: 0x52, flags: 0x0}, + 1008: {region: 0x35, script: 0x4, flags: 0x1}, + 1009: {region: 0x9d, script: 0x52, flags: 0x0}, + 1010: {region: 0x9b, script: 0x5, flags: 0x0}, + 1011: {region: 0xd9, script: 0x52, flags: 0x0}, + 1012: {region: 0x4e, script: 0x52, flags: 0x0}, + 1013: {region: 0xd0, script: 0x52, flags: 0x0}, + 1014: {region: 0xce, script: 0x52, flags: 0x0}, + 1015: {region: 0xc2, script: 0x52, flags: 0x0}, + 1016: {region: 0x4b, script: 0x52, flags: 0x0}, + 1017: {region: 0x95, script: 0x72, flags: 0x0}, + 1018: {region: 0xb5, script: 0x52, flags: 0x0}, + 1019: {region: 0x164, script: 0x27, flags: 0x0}, + 1020: {region: 0x164, script: 0x52, flags: 0x0}, + 1022: {region: 0xb9, script: 0xd2, flags: 0x0}, + 1023: {region: 0x164, script: 0x52, flags: 0x0}, + 1024: {region: 0xc3, script: 0x6b, flags: 0x0}, + 1025: {region: 0x164, script: 0x5, flags: 0x0}, + 1026: {region: 0xb2, script: 0xc1, flags: 0x0}, + 1027: {region: 0x6e, script: 0x52, flags: 0x0}, + 1028: {region: 0x164, script: 0x52, flags: 0x0}, + 1029: {region: 0x164, script: 0x52, flags: 0x0}, + 1030: {region: 0x164, script: 0x52, flags: 0x0}, + 1031: {region: 0x164, script: 0x52, flags: 0x0}, + 1032: {region: 0x110, script: 0x52, flags: 0x0}, + 1033: {region: 0x164, script: 0x52, flags: 0x0}, + 1034: {region: 0xe7, script: 0x5, flags: 0x0}, + 1035: {region: 0x164, script: 0x52, flags: 0x0}, + 1036: {region: 0x10e, script: 0x52, flags: 0x0}, + 1037: {region: 0x164, script: 0x52, flags: 0x0}, + 1038: {region: 0xe8, script: 0x52, flags: 0x0}, + 1039: {region: 0x164, script: 0x52, flags: 0x0}, + 1040: {region: 0x94, script: 0x52, flags: 0x0}, + 1041: {region: 0x141, script: 0x52, flags: 0x0}, + 1042: {region: 0x10b, script: 0x52, flags: 0x0}, + 1044: {region: 0x10b, script: 0x52, flags: 0x0}, + 1045: {region: 0x71, script: 0x52, flags: 0x0}, + 1046: {region: 0x96, script: 0xb8, flags: 0x0}, + 1047: {region: 0x164, script: 0x52, flags: 0x0}, + 1048: {region: 0x71, script: 0x52, flags: 0x0}, + 1049: {region: 0x163, script: 0x52, flags: 0x0}, + 1050: {region: 0x164, script: 0x52, flags: 0x0}, + 1051: {region: 0xc2, script: 0x52, flags: 0x0}, + 1052: {region: 0x164, script: 0x52, flags: 0x0}, + 1053: {region: 0x164, script: 0x52, flags: 0x0}, + 1054: {region: 0x164, script: 0x52, flags: 0x0}, + 1055: {region: 0x114, script: 0x52, flags: 0x0}, + 1056: {region: 0x164, script: 0x52, flags: 0x0}, + 1057: {region: 0x164, script: 0x52, flags: 0x0}, + 1058: {region: 0x122, script: 0xd5, flags: 0x0}, + 1059: {region: 0x164, script: 0x52, flags: 0x0}, + 1060: {region: 0x164, script: 0x52, flags: 0x0}, + 1061: {region: 0x164, script: 0x52, flags: 0x0}, + 1062: {region: 0x164, script: 0x52, flags: 0x0}, + 1063: {region: 0x26, script: 0x52, flags: 0x0}, + 1064: {region: 0x39, script: 0x5, flags: 0x1}, + 1065: {region: 0x98, script: 0xc2, flags: 0x0}, + 1066: {region: 0x115, script: 0x52, flags: 0x0}, + 1067: {region: 0x113, script: 0x52, flags: 0x0}, + 1068: {region: 0x98, script: 0x20, flags: 0x0}, + 1069: {region: 0x160, script: 0x52, flags: 0x0}, + 1070: {region: 0x164, script: 0x52, flags: 0x0}, + 1071: {region: 0x164, script: 0x52, flags: 0x0}, + 1072: {region: 0x6c, script: 0x52, flags: 0x0}, + 1073: {region: 0x160, script: 0x52, flags: 0x0}, + 1074: {region: 0x164, script: 0x52, flags: 0x0}, + 1075: {region: 0x5f, script: 0x52, flags: 0x0}, + 1076: {region: 0x94, script: 0x52, flags: 0x0}, + 1077: {region: 0x164, script: 0x52, flags: 0x0}, + 1078: {region: 0x164, script: 0x52, flags: 0x0}, + 1079: {region: 0x12e, script: 0x52, flags: 0x0}, + 1080: {region: 0x164, script: 0x52, flags: 0x0}, + 1081: {region: 0x83, script: 0x52, flags: 0x0}, + 1082: {region: 0x10b, script: 0x52, flags: 0x0}, + 1083: {region: 0x12e, script: 0x52, flags: 0x0}, + 1084: {region: 0x15e, script: 0x5, flags: 0x0}, + 1085: {region: 0x4a, script: 0x52, flags: 0x0}, + 1086: {region: 0x5f, script: 0x52, flags: 0x0}, + 1087: {region: 0x164, script: 0x52, flags: 0x0}, + 1088: {region: 0x98, script: 0x20, flags: 0x0}, + 1089: {region: 0x94, script: 0x52, flags: 0x0}, + 1090: {region: 0x164, script: 0x52, flags: 0x0}, + 1091: {region: 0x34, script: 0xe, flags: 0x0}, + 1092: {region: 0x9a, script: 0xc5, flags: 0x0}, + 1093: {region: 0xe8, script: 0x52, flags: 0x0}, + 1094: {region: 0x98, script: 0xcd, flags: 0x0}, + 1095: {region: 0xda, script: 0x20, flags: 0x0}, + 1096: {region: 0x164, script: 0x52, flags: 0x0}, + 1097: {region: 0x164, script: 0x52, flags: 0x0}, + 1098: {region: 0x164, script: 0x52, flags: 0x0}, + 1099: {region: 0x164, script: 0x52, flags: 0x0}, + 1100: {region: 0x164, script: 0x52, flags: 0x0}, + 1101: {region: 0x164, script: 0x52, flags: 0x0}, + 1102: {region: 0x164, script: 0x52, flags: 0x0}, + 1103: {region: 0x164, script: 0x52, flags: 0x0}, + 1104: {region: 0xe6, script: 0x52, flags: 0x0}, + 1105: {region: 0x164, script: 0x52, flags: 0x0}, + 1106: {region: 0x164, script: 0x52, flags: 0x0}, + 1107: {region: 0x98, script: 0x4a, flags: 0x0}, + 1108: {region: 0x52, script: 0xcb, flags: 0x0}, + 1109: {region: 0xda, script: 0x20, flags: 0x0}, + 1110: {region: 0xda, script: 0x20, flags: 0x0}, + 1111: {region: 0x98, script: 0xd0, flags: 0x0}, + 1112: {region: 0x164, script: 0x52, flags: 0x0}, + 1113: {region: 0x111, script: 0x52, flags: 0x0}, + 1114: {region: 0x130, script: 0x52, flags: 0x0}, + 1115: {region: 0x125, script: 0x52, flags: 0x0}, + 1116: {region: 0x164, script: 0x52, flags: 0x0}, + 1117: {region: 0x3e, script: 0x3, flags: 0x1}, + 1118: {region: 0x164, script: 0x52, flags: 0x0}, + 1119: {region: 0x164, script: 0x52, flags: 0x0}, + 1120: {region: 0x164, script: 0x52, flags: 0x0}, + 1121: {region: 0x122, script: 0xd5, flags: 0x0}, + 1122: {region: 0xda, script: 0x20, flags: 0x0}, + 1123: {region: 0xda, script: 0x20, flags: 0x0}, + 1124: {region: 0xda, script: 0x20, flags: 0x0}, + 1125: {region: 0x6e, script: 0x27, flags: 0x0}, + 1126: {region: 0x164, script: 0x52, flags: 0x0}, + 1127: {region: 0x6c, script: 0x27, flags: 0x0}, + 1128: {region: 0x164, script: 0x52, flags: 0x0}, + 1129: {region: 0x164, script: 0x52, flags: 0x0}, + 1130: {region: 0x164, script: 0x52, flags: 0x0}, + 1131: {region: 0xd5, script: 0x52, flags: 0x0}, + 1132: {region: 0x126, script: 0x52, flags: 0x0}, + 1133: {region: 0x124, script: 0x52, flags: 0x0}, + 1134: {region: 0x31, script: 0x52, flags: 0x0}, + 1135: {region: 0xda, script: 0x20, flags: 0x0}, + 1136: {region: 0xe6, script: 0x52, flags: 0x0}, + 1137: {region: 0x164, script: 0x52, flags: 0x0}, + 1138: {region: 0x164, script: 0x52, flags: 0x0}, + 1139: {region: 0x31, script: 0x52, flags: 0x0}, + 1140: {region: 0xd3, script: 0x52, flags: 0x0}, + 1141: {region: 0x164, script: 0x52, flags: 0x0}, + 1142: {region: 0x160, script: 0x52, flags: 0x0}, + 1143: {region: 0x164, script: 0x52, flags: 0x0}, + 1144: {region: 0x128, script: 0x52, flags: 0x0}, + 1145: {region: 0x164, script: 0x52, flags: 0x0}, + 1146: {region: 0xcd, script: 0x52, flags: 0x0}, + 1147: {region: 0x164, script: 0x52, flags: 0x0}, + 1148: {region: 0xe5, script: 0x52, flags: 0x0}, + 1149: {region: 0x164, script: 0x52, flags: 0x0}, + 1150: {region: 0x164, script: 0x52, flags: 0x0}, + 1151: {region: 0x164, script: 0x52, flags: 0x0}, + 1152: {region: 0x12a, script: 0x52, flags: 0x0}, + 1153: {region: 0x12a, script: 0x52, flags: 0x0}, + 1154: {region: 0x12d, script: 0x52, flags: 0x0}, + 1155: {region: 0x164, script: 0x5, flags: 0x0}, + 1156: {region: 0x160, script: 0x52, flags: 0x0}, + 1157: {region: 0x86, script: 0x2d, flags: 0x0}, + 1158: {region: 0xda, script: 0x20, flags: 0x0}, + 1159: {region: 0xe6, script: 0x52, flags: 0x0}, + 1160: {region: 0x42, script: 0xd6, flags: 0x0}, + 1161: {region: 0x164, script: 0x52, flags: 0x0}, + 1162: {region: 0x105, script: 0x1e, flags: 0x0}, + 1163: {region: 0x164, script: 0x52, flags: 0x0}, + 1164: {region: 0x164, script: 0x52, flags: 0x0}, + 1165: {region: 0x130, script: 0x52, flags: 0x0}, + 1166: {region: 0x164, script: 0x52, flags: 0x0}, + 1167: {region: 0x122, script: 0xd5, flags: 0x0}, + 1168: {region: 0x31, script: 0x52, flags: 0x0}, + 1169: {region: 0x164, script: 0x52, flags: 0x0}, + 1170: {region: 0x164, script: 0x52, flags: 0x0}, + 1171: {region: 0xcd, script: 0x52, flags: 0x0}, + 1172: {region: 0x164, script: 0x52, flags: 0x0}, + 1173: {region: 0x164, script: 0x52, flags: 0x0}, + 1174: {region: 0x12c, script: 0x52, flags: 0x0}, + 1175: {region: 0x164, script: 0x52, flags: 0x0}, + 1177: {region: 0x164, script: 0x52, flags: 0x0}, + 1178: {region: 0xd3, script: 0x52, flags: 0x0}, + 1179: {region: 0x52, script: 0xce, flags: 0x0}, + 1180: {region: 0xe4, script: 0x52, flags: 0x0}, + 1181: {region: 0x164, script: 0x52, flags: 0x0}, + 1182: {region: 0x105, script: 0x1e, flags: 0x0}, + 1183: {region: 0xb9, script: 0x52, flags: 0x0}, + 1184: {region: 0x164, script: 0x52, flags: 0x0}, + 1185: {region: 0x105, script: 0x1e, flags: 0x0}, + 1186: {region: 0x41, script: 0x4, flags: 0x1}, + 1187: {region: 0x11b, script: 0xd8, flags: 0x0}, + 1188: {region: 0x12f, script: 0x1e, flags: 0x0}, + 1189: {region: 0x74, script: 0x52, flags: 0x0}, + 1190: {region: 0x29, script: 0x52, flags: 0x0}, + 1192: {region: 0x45, script: 0x3, flags: 0x1}, + 1193: {region: 0x98, script: 0xe, flags: 0x0}, + 1194: {region: 0xe7, script: 0x5, flags: 0x0}, + 1195: {region: 0x164, script: 0x52, flags: 0x0}, + 1196: {region: 0x164, script: 0x52, flags: 0x0}, + 1197: {region: 0x164, script: 0x52, flags: 0x0}, + 1198: {region: 0x164, script: 0x52, flags: 0x0}, + 1199: {region: 0x164, script: 0x52, flags: 0x0}, + 1200: {region: 0x164, script: 0x52, flags: 0x0}, + 1201: {region: 0x164, script: 0x52, flags: 0x0}, + 1202: {region: 0x48, script: 0x4, flags: 0x1}, + 1203: {region: 0x164, script: 0x52, flags: 0x0}, + 1204: {region: 0xb3, script: 0xd9, flags: 0x0}, + 1205: {region: 0x164, script: 0x52, flags: 0x0}, + 1206: {region: 0x160, script: 0x52, flags: 0x0}, + 1207: {region: 0x9d, script: 0x52, flags: 0x0}, + 1208: {region: 0x105, script: 0x52, flags: 0x0}, + 1209: {region: 0x13d, script: 0x52, flags: 0x0}, + 1210: {region: 0x11a, script: 0x52, flags: 0x0}, + 1211: {region: 0x164, script: 0x52, flags: 0x0}, + 1212: {region: 0x35, script: 0x52, flags: 0x0}, + 1213: {region: 0x5f, script: 0x52, flags: 0x0}, + 1214: {region: 0xd0, script: 0x52, flags: 0x0}, + 1215: {region: 0x1, script: 0x52, flags: 0x0}, + 1216: {region: 0x105, script: 0x52, flags: 0x0}, + 1217: {region: 0x69, script: 0x52, flags: 0x0}, + 1218: {region: 0x12e, script: 0x52, flags: 0x0}, + 1219: {region: 0x164, script: 0x52, flags: 0x0}, + 1220: {region: 0x35, script: 0x52, flags: 0x0}, + 1221: {region: 0x4d, script: 0x52, flags: 0x0}, + 1222: {region: 0x164, script: 0x52, flags: 0x0}, + 1223: {region: 0x6e, script: 0x27, flags: 0x0}, + 1224: {region: 0x164, script: 0x52, flags: 0x0}, + 1225: {region: 0xe6, script: 0x52, flags: 0x0}, + 1226: {region: 0x2e, script: 0x52, flags: 0x0}, + 1227: {region: 0x98, script: 0xd0, flags: 0x0}, + 1228: {region: 0x98, script: 0x20, flags: 0x0}, + 1229: {region: 0x164, script: 0x52, flags: 0x0}, + 1230: {region: 0x164, script: 0x52, flags: 0x0}, + 1231: {region: 0x164, script: 0x52, flags: 0x0}, + 1232: {region: 0x164, script: 0x52, flags: 0x0}, + 1233: {region: 0x164, script: 0x52, flags: 0x0}, + 1234: {region: 0x164, script: 0x52, flags: 0x0}, + 1235: {region: 0x164, script: 0x52, flags: 0x0}, + 1236: {region: 0x164, script: 0x52, flags: 0x0}, + 1237: {region: 0x164, script: 0x52, flags: 0x0}, + 1238: {region: 0x13f, script: 0x52, flags: 0x0}, + 1239: {region: 0x164, script: 0x52, flags: 0x0}, + 1240: {region: 0x164, script: 0x52, flags: 0x0}, + 1241: {region: 0xa7, script: 0x5, flags: 0x0}, + 1242: {region: 0x164, script: 0x52, flags: 0x0}, + 1243: {region: 0x113, script: 0x52, flags: 0x0}, + 1244: {region: 0x164, script: 0x52, flags: 0x0}, + 1245: {region: 0x164, script: 0x52, flags: 0x0}, + 1246: {region: 0x164, script: 0x52, flags: 0x0}, + 1247: {region: 0x164, script: 0x52, flags: 0x0}, + 1248: {region: 0x98, script: 0x20, flags: 0x0}, + 1249: {region: 0x52, script: 0x34, flags: 0x0}, + 1250: {region: 0x164, script: 0x52, flags: 0x0}, + 1251: {region: 0x164, script: 0x52, flags: 0x0}, + 1252: {region: 0x40, script: 0x52, flags: 0x0}, + 1253: {region: 0x164, script: 0x52, flags: 0x0}, + 1254: {region: 0x12a, script: 0x18, flags: 0x0}, + 1255: {region: 0x164, script: 0x52, flags: 0x0}, + 1256: {region: 0x160, script: 0x52, flags: 0x0}, + 1257: {region: 0x164, script: 0x52, flags: 0x0}, + 1258: {region: 0x12a, script: 0x5a, flags: 0x0}, + 1259: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1260: {region: 0x7c, script: 0x29, flags: 0x0}, + 1261: {region: 0x52, script: 0x5e, flags: 0x0}, + 1262: {region: 0x10a, script: 0x62, flags: 0x0}, + 1263: {region: 0x107, script: 0x6c, flags: 0x0}, + 1264: {region: 0x98, script: 0x20, flags: 0x0}, + 1265: {region: 0x130, script: 0x52, flags: 0x0}, + 1266: {region: 0x164, script: 0x52, flags: 0x0}, + 1267: {region: 0x9b, script: 0x82, flags: 0x0}, + 1268: {region: 0x164, script: 0x52, flags: 0x0}, + 1269: {region: 0x15d, script: 0xba, flags: 0x0}, + 1270: {region: 0x164, script: 0x52, flags: 0x0}, + 1271: {region: 0x164, script: 0x52, flags: 0x0}, + 1272: {region: 0xda, script: 0x20, flags: 0x0}, + 1273: {region: 0x164, script: 0x52, flags: 0x0}, + 1274: {region: 0x164, script: 0x52, flags: 0x0}, + 1275: {region: 0xd0, script: 0x52, flags: 0x0}, + 1276: {region: 0x74, script: 0x52, flags: 0x0}, + 1277: {region: 0x164, script: 0x52, flags: 0x0}, + 1278: {region: 0x164, script: 0x52, flags: 0x0}, + 1279: {region: 0x51, script: 0x52, flags: 0x0}, + 1280: {region: 0x164, script: 0x52, flags: 0x0}, + 1281: {region: 0x164, script: 0x52, flags: 0x0}, + 1282: {region: 0x164, script: 0x52, flags: 0x0}, + 1283: {region: 0x51, script: 0x52, flags: 0x0}, + 1284: {region: 0x164, script: 0x52, flags: 0x0}, + 1285: {region: 0x164, script: 0x52, flags: 0x0}, + 1286: {region: 0x164, script: 0x52, flags: 0x0}, + 1287: {region: 0x164, script: 0x52, flags: 0x0}, + 1288: {region: 0x1, script: 0x37, flags: 0x0}, + 1289: {region: 0x164, script: 0x52, flags: 0x0}, + 1290: {region: 0x164, script: 0x52, flags: 0x0}, + 1291: {region: 0x164, script: 0x52, flags: 0x0}, + 1292: {region: 0x164, script: 0x52, flags: 0x0}, + 1293: {region: 0x164, script: 0x52, flags: 0x0}, + 1294: {region: 0xd5, script: 0x52, flags: 0x0}, + 1295: {region: 0x164, script: 0x52, flags: 0x0}, + 1296: {region: 0x164, script: 0x52, flags: 0x0}, + 1297: {region: 0x164, script: 0x52, flags: 0x0}, + 1298: {region: 0x40, script: 0x52, flags: 0x0}, + 1299: {region: 0x164, script: 0x52, flags: 0x0}, + 1300: {region: 0xce, script: 0x52, flags: 0x0}, + 1301: {region: 0x4c, script: 0x3, flags: 0x1}, + 1302: {region: 0x164, script: 0x52, flags: 0x0}, + 1303: {region: 0x164, script: 0x52, flags: 0x0}, + 1304: {region: 0x164, script: 0x52, flags: 0x0}, + 1305: {region: 0x52, script: 0x52, flags: 0x0}, + 1306: {region: 0x10a, script: 0x52, flags: 0x0}, + 1308: {region: 0xa7, script: 0x5, flags: 0x0}, + 1309: {region: 0xd8, script: 0x52, flags: 0x0}, + 1310: {region: 0xb9, script: 0xd2, flags: 0x0}, + 1311: {region: 0x4f, script: 0x14, flags: 0x1}, + 1312: {region: 0x164, script: 0x52, flags: 0x0}, + 1313: {region: 0x121, script: 0x52, flags: 0x0}, + 1314: {region: 0xcf, script: 0x52, flags: 0x0}, + 1315: {region: 0x164, script: 0x52, flags: 0x0}, + 1316: {region: 0x160, script: 0x52, flags: 0x0}, + 1318: {region: 0x12a, script: 0x52, flags: 0x0}, +} + +// likelyLangList holds lists info associated with likelyLang. +// Size: 396 bytes, 99 elements +var likelyLangList = [99]likelyScriptRegion{ + 0: {region: 0x9b, script: 0x7, flags: 0x0}, + 1: {region: 0xa0, script: 0x6d, flags: 0x2}, + 2: {region: 0x11b, script: 0x78, flags: 0x2}, + 3: {region: 0x31, script: 0x52, flags: 0x0}, + 4: {region: 0x9a, script: 0x5, flags: 0x4}, + 5: {region: 0x9b, script: 0x5, flags: 0x4}, + 6: {region: 0x105, script: 0x1e, flags: 0x4}, + 7: {region: 0x9b, script: 0x5, flags: 0x2}, + 8: {region: 0x98, script: 0xe, flags: 0x0}, + 9: {region: 0x34, script: 0x16, flags: 0x2}, + 10: {region: 0x105, script: 0x1e, flags: 0x0}, + 11: {region: 0x37, script: 0x2a, flags: 0x2}, + 12: {region: 0x134, script: 0x52, flags: 0x0}, + 13: {region: 0x7a, script: 0xbd, flags: 0x2}, + 14: {region: 0x113, script: 0x52, flags: 0x0}, + 15: {region: 0x83, script: 0x1, flags: 0x2}, + 16: {region: 0x5c, script: 0x1d, flags: 0x0}, + 17: {region: 0x86, script: 0x57, flags: 0x2}, + 18: {region: 0xd5, script: 0x52, flags: 0x0}, + 19: {region: 0x51, script: 0x5, flags: 0x4}, + 20: {region: 0x10a, script: 0x5, flags: 0x4}, + 21: {region: 0xad, script: 0x1e, flags: 0x0}, + 22: {region: 0x23, script: 0x5, flags: 0x4}, + 23: {region: 0x52, script: 0x5, flags: 0x4}, + 24: {region: 0x9b, script: 0x5, flags: 0x4}, + 25: {region: 0xc4, script: 0x5, flags: 0x4}, + 26: {region: 0x52, script: 0x5, flags: 0x2}, + 27: {region: 0x12a, script: 0x52, flags: 0x0}, + 28: {region: 0xaf, script: 0x5, flags: 0x4}, + 29: {region: 0x9a, script: 0x5, flags: 0x2}, + 30: {region: 0xa4, script: 0x1e, flags: 0x0}, + 31: {region: 0x52, script: 0x5, flags: 0x4}, + 32: {region: 0x12a, script: 0x52, flags: 0x4}, + 33: {region: 0x52, script: 0x5, flags: 0x2}, + 34: {region: 0x12a, script: 0x52, flags: 0x2}, + 35: {region: 0xda, script: 0x20, flags: 0x0}, + 36: {region: 0x98, script: 0x55, flags: 0x2}, + 37: {region: 0x82, script: 0x52, flags: 0x0}, + 38: {region: 0x83, script: 0x70, flags: 0x4}, + 39: {region: 0x83, script: 0x70, flags: 0x2}, + 40: {region: 0xc4, script: 0x1e, flags: 0x0}, + 41: {region: 0x52, script: 0x66, flags: 0x4}, + 42: {region: 0x52, script: 0x66, flags: 0x2}, + 43: {region: 0xcf, script: 0x52, flags: 0x0}, + 44: {region: 0x49, script: 0x5, flags: 0x4}, + 45: {region: 0x94, script: 0x5, flags: 0x4}, + 46: {region: 0x98, script: 0x2f, flags: 0x0}, + 47: {region: 0xe7, script: 0x5, flags: 0x4}, + 48: {region: 0xe7, script: 0x5, flags: 0x2}, + 49: {region: 0x9b, script: 0x7c, flags: 0x0}, + 50: {region: 0x52, script: 0x7d, flags: 0x2}, + 51: {region: 0xb9, script: 0xd2, flags: 0x0}, + 52: {region: 0xd8, script: 0x52, flags: 0x4}, + 53: {region: 0xe7, script: 0x5, flags: 0x0}, + 54: {region: 0x98, script: 0x20, flags: 0x2}, + 55: {region: 0x98, script: 0x47, flags: 0x2}, + 56: {region: 0x98, script: 0xc0, flags: 0x2}, + 57: {region: 0x104, script: 0x1e, flags: 0x0}, + 58: {region: 0xbc, script: 0x52, flags: 0x4}, + 59: {region: 0x103, script: 0x52, flags: 0x4}, + 60: {region: 0x105, script: 0x52, flags: 0x4}, + 61: {region: 0x12a, script: 0x52, flags: 0x4}, + 62: {region: 0x123, script: 0x1e, flags: 0x0}, + 63: {region: 0xe7, script: 0x5, flags: 0x4}, + 64: {region: 0xe7, script: 0x5, flags: 0x2}, + 65: {region: 0x52, script: 0x5, flags: 0x0}, + 66: {region: 0xad, script: 0x1e, flags: 0x4}, + 67: {region: 0xc4, script: 0x1e, flags: 0x4}, + 68: {region: 0xad, script: 0x1e, flags: 0x2}, + 69: {region: 0x98, script: 0xe, flags: 0x0}, + 70: {region: 0xda, script: 0x20, flags: 0x4}, + 71: {region: 0xda, script: 0x20, flags: 0x2}, + 72: {region: 0x136, script: 0x52, flags: 0x0}, + 73: {region: 0x23, script: 0x5, flags: 0x4}, + 74: {region: 0x52, script: 0x1e, flags: 0x4}, + 75: {region: 0x23, script: 0x5, flags: 0x2}, + 76: {region: 0x8c, script: 0x35, flags: 0x0}, + 77: {region: 0x52, script: 0x34, flags: 0x4}, + 78: {region: 0x52, script: 0x34, flags: 0x2}, + 79: {region: 0x52, script: 0x34, flags: 0x0}, + 80: {region: 0x2e, script: 0x35, flags: 0x4}, + 81: {region: 0x3d, script: 0x35, flags: 0x4}, + 82: {region: 0x7a, script: 0x35, flags: 0x4}, + 83: {region: 0x7d, script: 0x35, flags: 0x4}, + 84: {region: 0x8c, script: 0x35, flags: 0x4}, + 85: {region: 0x94, script: 0x35, flags: 0x4}, + 86: {region: 0xc5, script: 0x35, flags: 0x4}, + 87: {region: 0xcf, script: 0x35, flags: 0x4}, + 88: {region: 0xe1, script: 0x35, flags: 0x4}, + 89: {region: 0xe4, script: 0x35, flags: 0x4}, + 90: {region: 0xe6, script: 0x35, flags: 0x4}, + 91: {region: 0x115, script: 0x35, flags: 0x4}, + 92: {region: 0x122, script: 0x35, flags: 0x4}, + 93: {region: 0x12d, script: 0x35, flags: 0x4}, + 94: {region: 0x134, script: 0x35, flags: 0x4}, + 95: {region: 0x13d, script: 0x35, flags: 0x4}, + 96: {region: 0x12d, script: 0x11, flags: 0x2}, + 97: {region: 0x12d, script: 0x30, flags: 0x2}, + 98: {region: 0x12d, script: 0x35, flags: 0x2}, +} + +type likelyLangScript struct { + lang uint16 + script uint8 + flags uint8 +} + +// likelyRegion is a lookup table, indexed by regionID, for the most likely +// languages and scripts given incomplete information. If more entries exist +// for a given regionID, lang and script are the index and size respectively +// of the list in likelyRegionList. +// TODO: exclude containers and user-definable regions from the list. +// Size: 1428 bytes, 357 elements +var likelyRegion = [357]likelyLangScript{ + 33: {lang: 0xd5, script: 0x52, flags: 0x0}, + 34: {lang: 0x39, script: 0x5, flags: 0x0}, + 35: {lang: 0x0, script: 0x2, flags: 0x1}, + 38: {lang: 0x2, script: 0x2, flags: 0x1}, + 39: {lang: 0x4, script: 0x2, flags: 0x1}, + 41: {lang: 0x3b7, script: 0x52, flags: 0x0}, + 42: {lang: 0x0, script: 0x52, flags: 0x0}, + 43: {lang: 0x139, script: 0x52, flags: 0x0}, + 44: {lang: 0x411, script: 0x52, flags: 0x0}, + 45: {lang: 0x109, script: 0x52, flags: 0x0}, + 47: {lang: 0x35e, script: 0x52, flags: 0x0}, + 48: {lang: 0x43a, script: 0x52, flags: 0x0}, + 49: {lang: 0x57, script: 0x52, flags: 0x0}, + 50: {lang: 0x6, script: 0x2, flags: 0x1}, + 52: {lang: 0xa3, script: 0xe, flags: 0x0}, + 53: {lang: 0x35e, script: 0x52, flags: 0x0}, + 54: {lang: 0x159, script: 0x52, flags: 0x0}, + 55: {lang: 0x7d, script: 0x1e, flags: 0x0}, + 56: {lang: 0x39, script: 0x5, flags: 0x0}, + 57: {lang: 0x3d0, script: 0x52, flags: 0x0}, + 58: {lang: 0x159, script: 0x52, flags: 0x0}, + 59: {lang: 0x159, script: 0x52, flags: 0x0}, + 61: {lang: 0x316, script: 0x52, flags: 0x0}, + 62: {lang: 0x139, script: 0x52, flags: 0x0}, + 63: {lang: 0x398, script: 0x52, flags: 0x0}, + 64: {lang: 0x3b7, script: 0x52, flags: 0x0}, + 66: {lang: 0x8, script: 0x2, flags: 0x1}, + 68: {lang: 0x0, script: 0x52, flags: 0x0}, + 70: {lang: 0x70, script: 0x1e, flags: 0x0}, + 72: {lang: 0x508, script: 0x37, flags: 0x2}, + 73: {lang: 0x316, script: 0x5, flags: 0x2}, + 74: {lang: 0x43b, script: 0x52, flags: 0x0}, + 75: {lang: 0x159, script: 0x52, flags: 0x0}, + 76: {lang: 0x159, script: 0x52, flags: 0x0}, + 77: {lang: 0x109, script: 0x52, flags: 0x0}, + 78: {lang: 0x159, script: 0x52, flags: 0x0}, + 80: {lang: 0x139, script: 0x52, flags: 0x0}, + 81: {lang: 0x159, script: 0x52, flags: 0x0}, + 82: {lang: 0xa, script: 0x5, flags: 0x1}, + 83: {lang: 0x139, script: 0x52, flags: 0x0}, + 84: {lang: 0x0, script: 0x52, flags: 0x0}, + 85: {lang: 0x139, script: 0x52, flags: 0x0}, + 88: {lang: 0x139, script: 0x52, flags: 0x0}, + 89: {lang: 0x3b7, script: 0x52, flags: 0x0}, + 90: {lang: 0x398, script: 0x52, flags: 0x0}, + 92: {lang: 0xf, script: 0x2, flags: 0x1}, + 93: {lang: 0xf6, script: 0x52, flags: 0x0}, + 95: {lang: 0x109, script: 0x52, flags: 0x0}, + 97: {lang: 0x1, script: 0x52, flags: 0x0}, + 98: {lang: 0xfd, script: 0x52, flags: 0x0}, + 100: {lang: 0x139, script: 0x52, flags: 0x0}, + 102: {lang: 0x11, script: 0x2, flags: 0x1}, + 103: {lang: 0x139, script: 0x52, flags: 0x0}, + 104: {lang: 0x139, script: 0x52, flags: 0x0}, + 105: {lang: 0x13b, script: 0x52, flags: 0x0}, + 106: {lang: 0x39, script: 0x5, flags: 0x0}, + 107: {lang: 0x39, script: 0x5, flags: 0x0}, + 108: {lang: 0x465, script: 0x27, flags: 0x0}, + 109: {lang: 0x139, script: 0x52, flags: 0x0}, + 110: {lang: 0x13, script: 0x2, flags: 0x1}, + 112: {lang: 0x109, script: 0x52, flags: 0x0}, + 113: {lang: 0x14c, script: 0x52, flags: 0x0}, + 114: {lang: 0x1b9, script: 0x20, flags: 0x2}, + 117: {lang: 0x153, script: 0x52, flags: 0x0}, + 119: {lang: 0x159, script: 0x52, flags: 0x0}, + 121: {lang: 0x159, script: 0x52, flags: 0x0}, + 122: {lang: 0x15, script: 0x2, flags: 0x1}, + 124: {lang: 0x17, script: 0x3, flags: 0x1}, + 125: {lang: 0x159, script: 0x52, flags: 0x0}, + 127: {lang: 0x20, script: 0x52, flags: 0x0}, + 129: {lang: 0x23d, script: 0x52, flags: 0x0}, + 131: {lang: 0x159, script: 0x52, flags: 0x0}, + 132: {lang: 0x159, script: 0x52, flags: 0x0}, + 133: {lang: 0x139, script: 0x52, flags: 0x0}, + 134: {lang: 0x1a, script: 0x2, flags: 0x1}, + 135: {lang: 0x0, script: 0x52, flags: 0x0}, + 136: {lang: 0x139, script: 0x52, flags: 0x0}, + 138: {lang: 0x3b7, script: 0x52, flags: 0x0}, + 140: {lang: 0x51f, script: 0x35, flags: 0x0}, + 141: {lang: 0x0, script: 0x52, flags: 0x0}, + 142: {lang: 0x139, script: 0x52, flags: 0x0}, + 143: {lang: 0x1ca, script: 0x52, flags: 0x0}, + 144: {lang: 0x1cd, script: 0x52, flags: 0x0}, + 145: {lang: 0x1ce, script: 0x52, flags: 0x0}, + 147: {lang: 0x139, script: 0x52, flags: 0x0}, + 148: {lang: 0x1c, script: 0x2, flags: 0x1}, + 150: {lang: 0x1b5, script: 0x37, flags: 0x0}, + 152: {lang: 0x1e, script: 0x3, flags: 0x1}, + 154: {lang: 0x39, script: 0x5, flags: 0x0}, + 155: {lang: 0x21, script: 0x2, flags: 0x1}, + 156: {lang: 0x1f0, script: 0x52, flags: 0x0}, + 157: {lang: 0x1f1, script: 0x52, flags: 0x0}, + 160: {lang: 0x39, script: 0x5, flags: 0x0}, + 161: {lang: 0x1f8, script: 0x41, flags: 0x0}, + 163: {lang: 0x43b, script: 0x52, flags: 0x0}, + 164: {lang: 0x281, script: 0x1e, flags: 0x0}, + 165: {lang: 0x23, script: 0x3, flags: 0x1}, + 167: {lang: 0x26, script: 0x2, flags: 0x1}, + 169: {lang: 0x24b, script: 0x4b, flags: 0x0}, + 170: {lang: 0x24b, script: 0x4b, flags: 0x0}, + 171: {lang: 0x39, script: 0x5, flags: 0x0}, + 173: {lang: 0x3d9, script: 0x1e, flags: 0x0}, + 174: {lang: 0x28, script: 0x2, flags: 0x1}, + 175: {lang: 0x39, script: 0x5, flags: 0x0}, + 177: {lang: 0x109, script: 0x52, flags: 0x0}, + 178: {lang: 0x402, script: 0xc1, flags: 0x0}, + 180: {lang: 0x431, script: 0x52, flags: 0x0}, + 181: {lang: 0x2b7, script: 0x52, flags: 0x0}, + 182: {lang: 0x159, script: 0x52, flags: 0x0}, + 183: {lang: 0x2be, script: 0x52, flags: 0x0}, + 184: {lang: 0x39, script: 0x5, flags: 0x0}, + 185: {lang: 0x2a, script: 0x2, flags: 0x1}, + 186: {lang: 0x159, script: 0x52, flags: 0x0}, + 187: {lang: 0x2c, script: 0x2, flags: 0x1}, + 188: {lang: 0x428, script: 0x52, flags: 0x0}, + 189: {lang: 0x159, script: 0x52, flags: 0x0}, + 190: {lang: 0x2e8, script: 0x52, flags: 0x0}, + 193: {lang: 0x2e, script: 0x2, flags: 0x1}, + 194: {lang: 0x9e, script: 0x52, flags: 0x0}, + 195: {lang: 0x30, script: 0x2, flags: 0x1}, + 196: {lang: 0x32, script: 0x2, flags: 0x1}, + 197: {lang: 0x34, script: 0x2, flags: 0x1}, + 199: {lang: 0x159, script: 0x52, flags: 0x0}, + 200: {lang: 0x36, script: 0x2, flags: 0x1}, + 202: {lang: 0x317, script: 0x52, flags: 0x0}, + 203: {lang: 0x38, script: 0x3, flags: 0x1}, + 204: {lang: 0x124, script: 0xd4, flags: 0x0}, + 206: {lang: 0x139, script: 0x52, flags: 0x0}, + 207: {lang: 0x316, script: 0x52, flags: 0x0}, + 208: {lang: 0x3b7, script: 0x52, flags: 0x0}, + 209: {lang: 0x15, script: 0x52, flags: 0x0}, + 210: {lang: 0x159, script: 0x52, flags: 0x0}, + 211: {lang: 0x1ad, script: 0x52, flags: 0x0}, + 213: {lang: 0x1ad, script: 0x5, flags: 0x2}, + 215: {lang: 0x139, script: 0x52, flags: 0x0}, + 216: {lang: 0x35e, script: 0x52, flags: 0x0}, + 217: {lang: 0x33e, script: 0x52, flags: 0x0}, + 218: {lang: 0x348, script: 0x20, flags: 0x0}, + 224: {lang: 0x39, script: 0x5, flags: 0x0}, + 225: {lang: 0x139, script: 0x52, flags: 0x0}, + 227: {lang: 0x139, script: 0x52, flags: 0x0}, + 228: {lang: 0x159, script: 0x52, flags: 0x0}, + 229: {lang: 0x47c, script: 0x52, flags: 0x0}, + 230: {lang: 0x14e, script: 0x52, flags: 0x0}, + 231: {lang: 0x3b, script: 0x3, flags: 0x1}, + 232: {lang: 0x3e, script: 0x2, flags: 0x1}, + 233: {lang: 0x159, script: 0x52, flags: 0x0}, + 235: {lang: 0x139, script: 0x52, flags: 0x0}, + 236: {lang: 0x39, script: 0x5, flags: 0x0}, + 237: {lang: 0x3b7, script: 0x52, flags: 0x0}, + 239: {lang: 0x399, script: 0x52, flags: 0x0}, + 240: {lang: 0x18e, script: 0x52, flags: 0x0}, + 242: {lang: 0x39, script: 0x5, flags: 0x0}, + 257: {lang: 0x159, script: 0x52, flags: 0x0}, + 259: {lang: 0x40, script: 0x2, flags: 0x1}, + 260: {lang: 0x428, script: 0x1e, flags: 0x0}, + 261: {lang: 0x42, script: 0x2, flags: 0x1}, + 262: {lang: 0x3dc, script: 0x52, flags: 0x0}, + 263: {lang: 0x39, script: 0x5, flags: 0x0}, + 265: {lang: 0x159, script: 0x52, flags: 0x0}, + 266: {lang: 0x39, script: 0x5, flags: 0x0}, + 267: {lang: 0x44, script: 0x2, flags: 0x1}, + 270: {lang: 0x40c, script: 0x52, flags: 0x0}, + 271: {lang: 0x33e, script: 0x52, flags: 0x0}, + 272: {lang: 0x46, script: 0x2, flags: 0x1}, + 274: {lang: 0x1f1, script: 0x52, flags: 0x0}, + 275: {lang: 0x159, script: 0x52, flags: 0x0}, + 276: {lang: 0x41f, script: 0x52, flags: 0x0}, + 277: {lang: 0x35e, script: 0x52, flags: 0x0}, + 279: {lang: 0x3b7, script: 0x52, flags: 0x0}, + 281: {lang: 0x139, script: 0x52, flags: 0x0}, + 283: {lang: 0x48, script: 0x2, flags: 0x1}, + 287: {lang: 0x159, script: 0x52, flags: 0x0}, + 288: {lang: 0x159, script: 0x52, flags: 0x0}, + 289: {lang: 0x4a, script: 0x2, flags: 0x1}, + 290: {lang: 0x4c, script: 0x3, flags: 0x1}, + 291: {lang: 0x4f, script: 0x2, flags: 0x1}, + 292: {lang: 0x46d, script: 0x52, flags: 0x0}, + 293: {lang: 0x3b7, script: 0x52, flags: 0x0}, + 294: {lang: 0x46c, script: 0x52, flags: 0x0}, + 295: {lang: 0x51, script: 0x2, flags: 0x1}, + 296: {lang: 0x478, script: 0x52, flags: 0x0}, + 298: {lang: 0x53, script: 0x4, flags: 0x1}, + 300: {lang: 0x496, script: 0x52, flags: 0x0}, + 301: {lang: 0x57, script: 0x2, flags: 0x1}, + 302: {lang: 0x43b, script: 0x52, flags: 0x0}, + 303: {lang: 0x59, script: 0x3, flags: 0x1}, + 304: {lang: 0x43b, script: 0x52, flags: 0x0}, + 308: {lang: 0x508, script: 0x37, flags: 0x2}, + 309: {lang: 0x139, script: 0x52, flags: 0x0}, + 310: {lang: 0x4b2, script: 0x52, flags: 0x0}, + 311: {lang: 0x1f1, script: 0x52, flags: 0x0}, + 314: {lang: 0x139, script: 0x52, flags: 0x0}, + 317: {lang: 0x4b9, script: 0x52, flags: 0x0}, + 318: {lang: 0x89, script: 0x52, flags: 0x0}, + 319: {lang: 0x159, script: 0x52, flags: 0x0}, + 321: {lang: 0x411, script: 0x52, flags: 0x0}, + 332: {lang: 0x5c, script: 0x2, flags: 0x1}, + 349: {lang: 0x39, script: 0x5, flags: 0x0}, + 350: {lang: 0x5e, script: 0x2, flags: 0x1}, + 355: {lang: 0x419, script: 0x52, flags: 0x0}, +} + +// likelyRegionList holds lists info associated with likelyRegion. +// Size: 384 bytes, 96 elements +var likelyRegionList = [96]likelyLangScript{ + 0: {lang: 0x143, script: 0x5, flags: 0x0}, + 1: {lang: 0x46c, script: 0x52, flags: 0x0}, + 2: {lang: 0x427, script: 0x52, flags: 0x0}, + 3: {lang: 0x2f6, script: 0x1e, flags: 0x0}, + 4: {lang: 0x1d0, script: 0x8, flags: 0x0}, + 5: {lang: 0x26b, script: 0x52, flags: 0x0}, + 6: {lang: 0xb5, script: 0x52, flags: 0x0}, + 7: {lang: 0x428, script: 0x1e, flags: 0x0}, + 8: {lang: 0x129, script: 0xd6, flags: 0x0}, + 9: {lang: 0x348, script: 0x20, flags: 0x0}, + 10: {lang: 0x51f, script: 0x34, flags: 0x0}, + 11: {lang: 0x4a2, script: 0x5, flags: 0x0}, + 12: {lang: 0x515, script: 0x35, flags: 0x0}, + 13: {lang: 0x519, script: 0x52, flags: 0x0}, + 14: {lang: 0x291, script: 0xd5, flags: 0x0}, + 15: {lang: 0x131, script: 0x2d, flags: 0x0}, + 16: {lang: 0x480, script: 0x52, flags: 0x0}, + 17: {lang: 0x39, script: 0x5, flags: 0x0}, + 18: {lang: 0x159, script: 0x52, flags: 0x0}, + 19: {lang: 0x26, script: 0x27, flags: 0x0}, + 20: {lang: 0x134, script: 0x52, flags: 0x0}, + 21: {lang: 0x261, script: 0x5, flags: 0x2}, + 22: {lang: 0x508, script: 0x37, flags: 0x2}, + 23: {lang: 0x208, script: 0x29, flags: 0x0}, + 24: {lang: 0x5, script: 0x1e, flags: 0x0}, + 25: {lang: 0x26b, script: 0x52, flags: 0x0}, + 26: {lang: 0x131, script: 0x2d, flags: 0x0}, + 27: {lang: 0x2f6, script: 0x1e, flags: 0x0}, + 28: {lang: 0x1da, script: 0x52, flags: 0x0}, + 29: {lang: 0x316, script: 0x5, flags: 0x0}, + 30: {lang: 0x1b7, script: 0x20, flags: 0x0}, + 31: {lang: 0x4aa, script: 0x5, flags: 0x0}, + 32: {lang: 0x22e, script: 0x6b, flags: 0x0}, + 33: {lang: 0x143, script: 0x5, flags: 0x0}, + 34: {lang: 0x46c, script: 0x52, flags: 0x0}, + 35: {lang: 0x242, script: 0x46, flags: 0x0}, + 36: {lang: 0xe4, script: 0x5, flags: 0x0}, + 37: {lang: 0x21e, script: 0xd5, flags: 0x0}, + 38: {lang: 0x39, script: 0x5, flags: 0x0}, + 39: {lang: 0x159, script: 0x52, flags: 0x0}, + 40: {lang: 0x2af, script: 0x4f, flags: 0x0}, + 41: {lang: 0x21e, script: 0xd5, flags: 0x0}, + 42: {lang: 0x39, script: 0x5, flags: 0x0}, + 43: {lang: 0x159, script: 0x52, flags: 0x0}, + 44: {lang: 0x3d3, script: 0x52, flags: 0x0}, + 45: {lang: 0x4a4, script: 0x1e, flags: 0x0}, + 46: {lang: 0x2f6, script: 0x1e, flags: 0x0}, + 47: {lang: 0x427, script: 0x52, flags: 0x0}, + 48: {lang: 0x328, script: 0x6b, flags: 0x0}, + 49: {lang: 0x20b, script: 0x52, flags: 0x0}, + 50: {lang: 0x302, script: 0x1e, flags: 0x0}, + 51: {lang: 0x23a, script: 0x5, flags: 0x0}, + 52: {lang: 0x51f, script: 0x35, flags: 0x0}, + 53: {lang: 0x3b7, script: 0x52, flags: 0x0}, + 54: {lang: 0x39, script: 0x5, flags: 0x0}, + 55: {lang: 0x159, script: 0x52, flags: 0x0}, + 56: {lang: 0x2e4, script: 0x52, flags: 0x0}, + 57: {lang: 0x4aa, script: 0x5, flags: 0x0}, + 58: {lang: 0x87, script: 0x20, flags: 0x0}, + 59: {lang: 0x4aa, script: 0x5, flags: 0x0}, + 60: {lang: 0x4aa, script: 0x5, flags: 0x0}, + 61: {lang: 0xbc, script: 0x20, flags: 0x0}, + 62: {lang: 0x3aa, script: 0x52, flags: 0x0}, + 63: {lang: 0x70, script: 0x1e, flags: 0x0}, + 64: {lang: 0x3d3, script: 0x52, flags: 0x0}, + 65: {lang: 0x7d, script: 0x1e, flags: 0x0}, + 66: {lang: 0x3d9, script: 0x1e, flags: 0x0}, + 67: {lang: 0x25e, script: 0x52, flags: 0x0}, + 68: {lang: 0x43a, script: 0x52, flags: 0x0}, + 69: {lang: 0x508, script: 0x37, flags: 0x0}, + 70: {lang: 0x408, script: 0x52, flags: 0x0}, + 71: {lang: 0x4a4, script: 0x1e, flags: 0x0}, + 72: {lang: 0x39, script: 0x5, flags: 0x0}, + 73: {lang: 0x159, script: 0x52, flags: 0x0}, + 74: {lang: 0x159, script: 0x52, flags: 0x0}, + 75: {lang: 0x34, script: 0x5, flags: 0x0}, + 76: {lang: 0x461, script: 0xd5, flags: 0x0}, + 77: {lang: 0x2e3, script: 0x5, flags: 0x0}, + 78: {lang: 0x306, script: 0x6b, flags: 0x0}, + 79: {lang: 0x45d, script: 0x1e, flags: 0x0}, + 80: {lang: 0x143, script: 0x5, flags: 0x0}, + 81: {lang: 0x39, script: 0x5, flags: 0x0}, + 82: {lang: 0x159, script: 0x52, flags: 0x0}, + 83: {lang: 0x480, script: 0x52, flags: 0x0}, + 84: {lang: 0x57, script: 0x5, flags: 0x0}, + 85: {lang: 0x211, script: 0x1e, flags: 0x0}, + 86: {lang: 0x80, script: 0x2d, flags: 0x0}, + 87: {lang: 0x51f, script: 0x35, flags: 0x0}, + 88: {lang: 0x482, script: 0x52, flags: 0x0}, + 89: {lang: 0x4a4, script: 0x1e, flags: 0x0}, + 90: {lang: 0x508, script: 0x37, flags: 0x0}, + 91: {lang: 0x3aa, script: 0x52, flags: 0x0}, + 92: {lang: 0x427, script: 0x52, flags: 0x0}, + 93: {lang: 0x428, script: 0x1e, flags: 0x0}, + 94: {lang: 0x159, script: 0x52, flags: 0x0}, + 95: {lang: 0x43c, script: 0x5, flags: 0x0}, +} + +type likelyTag struct { + lang uint16 + region uint16 + script uint8 +} + +// Size: 192 bytes, 32 elements +var likelyRegionGroup = [32]likelyTag{ + 1: {lang: 0x134, region: 0xd5, script: 0x52}, + 2: {lang: 0x134, region: 0x134, script: 0x52}, + 3: {lang: 0x3b7, region: 0x40, script: 0x52}, + 4: {lang: 0x134, region: 0x2e, script: 0x52}, + 5: {lang: 0x134, region: 0xd5, script: 0x52}, + 6: {lang: 0x139, region: 0xce, script: 0x52}, + 7: {lang: 0x43b, region: 0x12e, script: 0x52}, + 8: {lang: 0x39, region: 0x6a, script: 0x5}, + 9: {lang: 0x43b, region: 0x4a, script: 0x52}, + 10: {lang: 0x134, region: 0x160, script: 0x52}, + 11: {lang: 0x134, region: 0x134, script: 0x52}, + 12: {lang: 0x134, region: 0x134, script: 0x52}, + 13: {lang: 0x139, region: 0x58, script: 0x52}, + 14: {lang: 0x51f, region: 0x52, script: 0x34}, + 15: {lang: 0x1b7, region: 0x98, script: 0x20}, + 16: {lang: 0x1da, region: 0x94, script: 0x52}, + 17: {lang: 0x1f1, region: 0x9d, script: 0x52}, + 18: {lang: 0x134, region: 0x2e, script: 0x52}, + 19: {lang: 0x134, region: 0xe5, script: 0x52}, + 20: {lang: 0x134, region: 0x89, script: 0x52}, + 21: {lang: 0x411, region: 0x141, script: 0x52}, + 22: {lang: 0x51f, region: 0x52, script: 0x34}, + 23: {lang: 0x4b2, region: 0x136, script: 0x52}, + 24: {lang: 0x39, region: 0x107, script: 0x5}, + 25: {lang: 0x3d9, region: 0x105, script: 0x1e}, + 26: {lang: 0x3d9, region: 0x105, script: 0x1e}, + 27: {lang: 0x134, region: 0x7a, script: 0x52}, + 28: {lang: 0x109, region: 0x5f, script: 0x52}, + 29: {lang: 0x139, region: 0x1e, script: 0x52}, + 30: {lang: 0x134, region: 0x99, script: 0x52}, + 31: {lang: 0x134, region: 0x7a, script: 0x52}, +} + +type mutualIntelligibility struct { + want uint16 + have uint16 + conf uint8 + oneway bool +} + +type scriptIntelligibility struct { + lang uint16 + want uint8 + have uint8 + conf uint8 +} + +// matchLang holds pairs of langIDs of base languages that are typically +// mutually intelligible. Each pair is associated with a confidence and +// whether the intelligibility goes one or both ways. +// Size: 708 bytes, 118 elements +var matchLang = [118]mutualIntelligibility{ + 0: {want: 0x366, have: 0x33e, conf: 0x2, oneway: false}, + 1: {want: 0x26b, have: 0xe7, conf: 0x2, oneway: false}, + 2: {want: 0x1ca, have: 0xb5, conf: 0x2, oneway: false}, + 3: {want: 0x3fd, have: 0xb5, conf: 0x2, oneway: false}, + 4: {want: 0x428, have: 0xb5, conf: 0x2, oneway: false}, + 5: {want: 0x3fd, have: 0x1ca, conf: 0x2, oneway: false}, + 6: {want: 0x428, have: 0x1ca, conf: 0x2, oneway: false}, + 7: {want: 0x3fd, have: 0x428, conf: 0x2, oneway: false}, + 8: {want: 0x430, have: 0x1, conf: 0x2, oneway: false}, + 9: {want: 0x19c, have: 0x109, conf: 0x2, oneway: true}, + 10: {want: 0x28c, have: 0x109, conf: 0x2, oneway: true}, + 11: {want: 0xfd, have: 0x366, conf: 0x2, oneway: false}, + 12: {want: 0xfd, have: 0x33e, conf: 0x2, oneway: false}, + 13: {want: 0xe7, have: 0x26b, conf: 0x2, oneway: false}, + 14: {want: 0x5, have: 0x3d9, conf: 0x2, oneway: true}, + 15: {want: 0xc, have: 0x134, conf: 0x2, oneway: true}, + 16: {want: 0x15, have: 0x35e, conf: 0x2, oneway: true}, + 17: {want: 0x20, have: 0x134, conf: 0x2, oneway: true}, + 18: {want: 0x55, have: 0x139, conf: 0x2, oneway: true}, + 19: {want: 0x57, have: 0x3d9, conf: 0x2, oneway: true}, + 20: {want: 0x70, have: 0x3d9, conf: 0x2, oneway: true}, + 21: {want: 0x74, have: 0x134, conf: 0x2, oneway: true}, + 22: {want: 0x81, have: 0x1b7, conf: 0x2, oneway: true}, + 23: {want: 0xa3, have: 0x134, conf: 0x2, oneway: true}, + 24: {want: 0xb0, have: 0x159, conf: 0x2, oneway: true}, + 25: {want: 0xdb, have: 0x14e, conf: 0x2, oneway: true}, + 26: {want: 0xe3, have: 0x134, conf: 0x2, oneway: true}, + 27: {want: 0xe7, have: 0x39, conf: 0x2, oneway: true}, + 28: {want: 0xed, have: 0x159, conf: 0x2, oneway: true}, + 29: {want: 0xf5, have: 0x159, conf: 0x2, oneway: true}, + 30: {want: 0xfc, have: 0x134, conf: 0x2, oneway: true}, + 31: {want: 0x12c, have: 0x134, conf: 0x2, oneway: true}, + 32: {want: 0x137, have: 0x134, conf: 0x2, oneway: true}, + 33: {want: 0x13b, have: 0x14c, conf: 0x2, oneway: true}, + 34: {want: 0x140, have: 0x139, conf: 0x2, oneway: true}, + 35: {want: 0x153, have: 0xfd, conf: 0x2, oneway: true}, + 36: {want: 0x168, have: 0x35e, conf: 0x2, oneway: true}, + 37: {want: 0x169, have: 0x134, conf: 0x2, oneway: true}, + 38: {want: 0x16a, have: 0x134, conf: 0x2, oneway: true}, + 39: {want: 0x178, have: 0x134, conf: 0x2, oneway: true}, + 40: {want: 0x18a, have: 0x139, conf: 0x2, oneway: true}, + 41: {want: 0x18e, have: 0x139, conf: 0x2, oneway: true}, + 42: {want: 0x19d, have: 0x1b7, conf: 0x2, oneway: true}, + 43: {want: 0x1ad, have: 0x134, conf: 0x2, oneway: true}, + 44: {want: 0x1b1, have: 0x134, conf: 0x2, oneway: true}, + 45: {want: 0x1cd, have: 0x159, conf: 0x2, oneway: true}, + 46: {want: 0x1d0, have: 0x3d9, conf: 0x2, oneway: true}, + 47: {want: 0x1d2, have: 0x134, conf: 0x2, oneway: true}, + 48: {want: 0x1df, have: 0x134, conf: 0x2, oneway: true}, + 49: {want: 0x1f0, have: 0x134, conf: 0x2, oneway: true}, + 50: {want: 0x206, have: 0x1da, conf: 0x2, oneway: true}, + 51: {want: 0x208, have: 0x134, conf: 0x2, oneway: true}, + 52: {want: 0x225, have: 0x159, conf: 0x2, oneway: true}, + 53: {want: 0x23a, have: 0x3d9, conf: 0x2, oneway: true}, + 54: {want: 0x242, have: 0x134, conf: 0x2, oneway: true}, + 55: {want: 0x249, have: 0x134, conf: 0x2, oneway: true}, + 56: {want: 0x25c, have: 0x134, conf: 0x2, oneway: true}, + 57: {want: 0x26b, have: 0x480, conf: 0x2, oneway: true}, + 58: {want: 0x281, have: 0x3d9, conf: 0x2, oneway: true}, + 59: {want: 0x285, have: 0x1f1, conf: 0x2, oneway: true}, + 60: {want: 0x29a, have: 0x134, conf: 0x2, oneway: true}, + 61: {want: 0x2ac, have: 0x159, conf: 0x2, oneway: true}, + 62: {want: 0x2af, have: 0x134, conf: 0x2, oneway: true}, + 63: {want: 0x2b5, have: 0x134, conf: 0x2, oneway: true}, + 64: {want: 0x2ba, have: 0x159, conf: 0x2, oneway: true}, + 65: {want: 0x2e4, have: 0x134, conf: 0x2, oneway: true}, + 66: {want: 0x2e8, have: 0x159, conf: 0x2, oneway: true}, + 67: {want: 0x2f1, have: 0x134, conf: 0x2, oneway: true}, + 68: {want: 0x2f6, have: 0x7d, conf: 0x2, oneway: true}, + 69: {want: 0x2fb, have: 0x134, conf: 0x2, oneway: true}, + 70: {want: 0x302, have: 0x3d9, conf: 0x2, oneway: true}, + 71: {want: 0x312, have: 0x1b7, conf: 0x2, oneway: true}, + 72: {want: 0x316, have: 0x1da, conf: 0x2, oneway: true}, + 73: {want: 0x317, have: 0x134, conf: 0x2, oneway: true}, + 74: {want: 0x328, have: 0x134, conf: 0x2, oneway: true}, + 75: {want: 0x348, have: 0x134, conf: 0x2, oneway: true}, + 76: {want: 0x361, have: 0x33e, conf: 0x2, oneway: false}, + 77: {want: 0x361, have: 0x366, conf: 0x2, oneway: true}, + 78: {want: 0x371, have: 0x134, conf: 0x2, oneway: true}, + 79: {want: 0x37e, have: 0x134, conf: 0x2, oneway: true}, + 80: {want: 0x380, have: 0x134, conf: 0x2, oneway: true}, + 81: {want: 0x382, have: 0x159, conf: 0x2, oneway: true}, + 82: {want: 0x387, have: 0x134, conf: 0x2, oneway: true}, + 83: {want: 0x38c, have: 0x134, conf: 0x2, oneway: true}, + 84: {want: 0x394, have: 0x134, conf: 0x2, oneway: true}, + 85: {want: 0x39c, have: 0x134, conf: 0x2, oneway: true}, + 86: {want: 0x3b5, have: 0x134, conf: 0x2, oneway: true}, + 87: {want: 0x3bb, have: 0x139, conf: 0x2, oneway: true}, + 88: {want: 0x3cb, have: 0x109, conf: 0x2, oneway: true}, + 89: {want: 0x3d0, have: 0x134, conf: 0x2, oneway: true}, + 90: {want: 0x3dc, have: 0x159, conf: 0x2, oneway: true}, + 91: {want: 0x3e0, have: 0x1b7, conf: 0x2, oneway: true}, + 92: {want: 0x3f0, have: 0x134, conf: 0x2, oneway: true}, + 93: {want: 0x402, have: 0x134, conf: 0x2, oneway: true}, + 94: {want: 0x419, have: 0x134, conf: 0x2, oneway: true}, + 95: {want: 0x41f, have: 0x134, conf: 0x2, oneway: true}, + 96: {want: 0x427, have: 0x134, conf: 0x2, oneway: true}, + 97: {want: 0x431, have: 0x134, conf: 0x2, oneway: true}, + 98: {want: 0x434, have: 0x1da, conf: 0x2, oneway: true}, + 99: {want: 0x43b, have: 0x134, conf: 0x2, oneway: true}, + 100: {want: 0x446, have: 0x134, conf: 0x2, oneway: true}, + 101: {want: 0x457, have: 0x134, conf: 0x2, oneway: true}, + 102: {want: 0x45d, have: 0x3d9, conf: 0x2, oneway: true}, + 103: {want: 0x465, have: 0x134, conf: 0x2, oneway: true}, + 104: {want: 0x46c, have: 0x3d9, conf: 0x2, oneway: true}, + 105: {want: 0x3878, have: 0x134, conf: 0x2, oneway: true}, + 106: {want: 0x476, have: 0x134, conf: 0x2, oneway: true}, + 107: {want: 0x478, have: 0x134, conf: 0x2, oneway: true}, + 108: {want: 0x48a, have: 0x3d9, conf: 0x2, oneway: true}, + 109: {want: 0x493, have: 0x134, conf: 0x2, oneway: true}, + 110: {want: 0x4a2, have: 0x51f, conf: 0x2, oneway: true}, + 111: {want: 0x4aa, have: 0x134, conf: 0x2, oneway: true}, + 112: {want: 0x4b2, have: 0x3d9, conf: 0x2, oneway: true}, + 113: {want: 0x4db, have: 0x159, conf: 0x2, oneway: true}, + 114: {want: 0x4e8, have: 0x134, conf: 0x2, oneway: true}, + 115: {want: 0x508, have: 0x134, conf: 0x2, oneway: true}, + 116: {want: 0x50e, have: 0x134, conf: 0x2, oneway: true}, + 117: {want: 0x524, have: 0x134, conf: 0x2, oneway: true}, +} + +// matchScript holds pairs of scriptIDs where readers of one script +// can typically also read the other. Each is associated with a confidence. +// Size: 24 bytes, 4 elements +var matchScript = [4]scriptIntelligibility{ + 0: {lang: 0x428, want: 0x52, have: 0x1e, conf: 0x2}, + 1: {lang: 0x428, want: 0x1e, have: 0x52, conf: 0x2}, + 2: {lang: 0x0, want: 0x34, have: 0x35, conf: 0x1}, + 3: {lang: 0x0, want: 0x35, have: 0x34, conf: 0x1}, +} + +// Size: 128 bytes, 32 elements +var regionContainment = [32]uint32{ + 0xffffffff, 0x000007a2, 0x00003044, 0x00000008, + 0x403c0010, 0x00000020, 0x00000040, 0x00000080, + 0x00000100, 0x00000200, 0x00000400, 0x2000384c, + 0x00001000, 0x00002000, 0x00004000, 0x00008000, + 0x00010000, 0x00020000, 0x00040000, 0x00080000, + 0x00100000, 0x00200000, 0x01c1c000, 0x00800000, + 0x01000000, 0x1e020000, 0x04000000, 0x08000000, + 0x10000000, 0x20002048, 0x40000000, 0x80000000, +} + +// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +// where each set holds all groupings that are directly connected in a region +// containment graph. +// Size: 357 bytes, 357 elements +var regionInclusion = [357]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, + 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, + 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, + 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x20, + 0x21, 0x22, 0x23, 0x24, 0x25, 0x25, 0x22, 0x23, + 0x25, 0x26, 0x21, 0x27, 0x28, 0x29, 0x2a, 0x25, + 0x2b, 0x23, 0x22, 0x25, 0x24, 0x29, 0x2c, 0x2d, + 0x23, 0x2e, 0x2c, 0x25, 0x2f, 0x30, 0x27, 0x25, + // Entry 40 - 7F + 0x27, 0x25, 0x24, 0x30, 0x21, 0x31, 0x32, 0x33, + 0x2f, 0x21, 0x26, 0x26, 0x26, 0x34, 0x2c, 0x28, + 0x27, 0x26, 0x35, 0x27, 0x21, 0x33, 0x22, 0x20, + 0x25, 0x2c, 0x25, 0x21, 0x36, 0x2d, 0x34, 0x29, + 0x21, 0x2e, 0x37, 0x25, 0x25, 0x20, 0x38, 0x38, + 0x27, 0x37, 0x38, 0x38, 0x2e, 0x39, 0x2e, 0x1f, + 0x20, 0x37, 0x3a, 0x27, 0x3b, 0x2b, 0x20, 0x29, + 0x34, 0x26, 0x37, 0x25, 0x23, 0x27, 0x2b, 0x2c, + // Entry 80 - BF + 0x22, 0x2f, 0x2c, 0x2c, 0x25, 0x26, 0x39, 0x21, + 0x33, 0x3b, 0x2c, 0x27, 0x35, 0x21, 0x33, 0x39, + 0x25, 0x2d, 0x20, 0x38, 0x30, 0x37, 0x23, 0x2b, + 0x24, 0x21, 0x23, 0x24, 0x2b, 0x39, 0x2b, 0x25, + 0x23, 0x35, 0x20, 0x2e, 0x3c, 0x30, 0x3b, 0x2e, + 0x25, 0x35, 0x35, 0x23, 0x25, 0x3c, 0x30, 0x23, + 0x25, 0x34, 0x24, 0x2c, 0x31, 0x37, 0x29, 0x37, + 0x38, 0x38, 0x34, 0x32, 0x22, 0x25, 0x2e, 0x3b, + // Entry C0 - FF + 0x20, 0x22, 0x2c, 0x30, 0x35, 0x35, 0x3b, 0x25, + 0x2c, 0x25, 0x39, 0x2e, 0x24, 0x2e, 0x33, 0x30, + 0x2e, 0x31, 0x3a, 0x2c, 0x2a, 0x2c, 0x20, 0x33, + 0x29, 0x2b, 0x24, 0x20, 0x3b, 0x23, 0x28, 0x2a, + 0x23, 0x33, 0x20, 0x27, 0x28, 0x3a, 0x30, 0x24, + 0x2d, 0x2f, 0x28, 0x25, 0x23, 0x39, 0x20, 0x3b, + 0x27, 0x20, 0x23, 0x20, 0x20, 0x1e, 0x20, 0x20, + 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, + // Entry 100 - 13F + 0x20, 0x2e, 0x20, 0x2d, 0x22, 0x32, 0x2e, 0x23, + 0x3a, 0x2e, 0x38, 0x37, 0x30, 0x2c, 0x39, 0x2b, + 0x2d, 0x2c, 0x22, 0x2c, 0x2e, 0x27, 0x2e, 0x26, + 0x32, 0x33, 0x25, 0x23, 0x31, 0x21, 0x25, 0x26, + 0x21, 0x2c, 0x30, 0x3c, 0x28, 0x30, 0x3c, 0x38, + 0x28, 0x30, 0x23, 0x25, 0x28, 0x35, 0x2e, 0x32, + 0x2e, 0x20, 0x21, 0x20, 0x2f, 0x27, 0x3c, 0x22, + 0x25, 0x20, 0x27, 0x25, 0x25, 0x30, 0x3a, 0x28, + // Entry 140 - 17F + 0x20, 0x28, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, + 0x20, 0x20, 0x20, 0x20, 0x22, 0x20, 0x20, 0x20, + 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, + 0x20, 0x20, 0x20, 0x20, 0x23, 0x23, 0x2e, 0x22, + 0x31, 0x2e, 0x26, 0x2e, 0x20, +} + +// regionInclusionBits is an array of bit vectors where every vector represents +// a set of region groupings. These sets are used to compute the distance +// between two regions for the purpose of language matching. +// Size: 288 bytes, 72 elements +var regionInclusionBits = [72]uint32{ + // Entry 0 - 1F + 0x82400813, 0x000007a3, 0x00003844, 0x20000808, + 0x403c0011, 0x00000022, 0x20000844, 0x00000082, + 0x00000102, 0x00000202, 0x00000402, 0x2000384d, + 0x00001804, 0x20002804, 0x00404000, 0x00408000, + 0x00410000, 0x02020000, 0x00040010, 0x00080010, + 0x00100010, 0x00200010, 0x01c1c001, 0x00c00000, + 0x01400000, 0x1e020001, 0x06000000, 0x0a000000, + 0x12000000, 0x20002848, 0x40000010, 0x80000001, + // Entry 20 - 3F + 0x00000001, 0x40000000, 0x00020000, 0x01000000, + 0x00008000, 0x00002000, 0x00000200, 0x00000008, + 0x00200000, 0x90000000, 0x00040000, 0x08000000, + 0x00000020, 0x84000000, 0x00000080, 0x00001000, + 0x00010000, 0x00000400, 0x04000000, 0x00000040, + 0x10000000, 0x00004000, 0x81000000, 0x88000000, + 0x00000100, 0x80020000, 0x00080000, 0x00100000, + 0x00800000, 0xffffffff, 0x82400fb3, 0xc27c0813, + // Entry 40 - 5F + 0xa240385f, 0x83c1c813, 0x9e420813, 0x92000001, + 0x86000001, 0x81400001, 0x8a000001, 0x82020001, +} + +// regionInclusionNext marks, for each entry in regionInclusionBits, the set of +// all groups that are reachable from the groups set in the respective entry. +// Size: 72 bytes, 72 elements +var regionInclusionNext = [72]uint8{ + // Entry 0 - 3F + 0x3d, 0x3e, 0x0b, 0x0b, 0x3f, 0x01, 0x0b, 0x01, + 0x01, 0x01, 0x01, 0x40, 0x0b, 0x0b, 0x16, 0x16, + 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x41, 0x16, + 0x16, 0x42, 0x19, 0x19, 0x19, 0x0b, 0x04, 0x00, + 0x00, 0x1e, 0x11, 0x18, 0x0f, 0x0d, 0x09, 0x03, + 0x15, 0x43, 0x12, 0x1b, 0x05, 0x44, 0x07, 0x0c, + 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x45, 0x46, + 0x08, 0x47, 0x13, 0x14, 0x17, 0x3d, 0x3d, 0x3d, + // Entry 40 - 7F + 0x3d, 0x3d, 0x3d, 0x42, 0x42, 0x41, 0x42, 0x42, +} + +type parentRel struct { + lang uint16 + script uint8 + maxScript uint8 + toRegion uint16 + fromRegion []uint16 +} + +// Size: 412 bytes, 5 elements +var parents = [5]parentRel{ + 0: {lang: 0x134, script: 0x0, maxScript: 0x52, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x24, 0x25, 0x2e, 0x33, 0x35, 0x3c, 0x41, 0x45, 0x47, 0x48, 0x49, 0x4f, 0x51, 0x5b, 0x5c, 0x60, 0x63, 0x6c, 0x72, 0x73, 0x74, 0x7a, 0x7b, 0x7e, 0x7f, 0x80, 0x82, 0x8b, 0x8c, 0x95, 0x96, 0x97, 0x98, 0x99, 0x9e, 0x9f, 0xa3, 0xa6, 0xa8, 0xac, 0xb0, 0xb3, 0xb4, 0xbe, 0xc5, 0xc9, 0xca, 0xcb, 0xcd, 0xcf, 0xd1, 0xd4, 0xd5, 0xdc, 0xde, 0xdf, 0xe5, 0xe6, 0xe7, 0xea, 0xef, 0x106, 0x108, 0x109, 0x10a, 0x10c, 0x10d, 0x111, 0x116, 0x11a, 0x11c, 0x11e, 0x124, 0x128, 0x12b, 0x12c, 0x12e, 0x130, 0x138, 0x13b, 0x13e, 0x141, 0x160, 0x161, 0x163}}, + 1: {lang: 0x134, script: 0x0, maxScript: 0x52, toRegion: 0x1a, fromRegion: []uint16{0x2d, 0x4d, 0x5f, 0x62, 0x71, 0xd8, 0x10b, 0x10e}}, + 2: {lang: 0x139, script: 0x0, maxScript: 0x52, toRegion: 0x1e, fromRegion: []uint16{0x2b, 0x3e, 0x40, 0x50, 0x53, 0x55, 0x58, 0x64, 0x68, 0x88, 0x8e, 0xce, 0xd7, 0xe1, 0xe3, 0xeb, 0xf0, 0x119, 0x134, 0x135, 0x13a}}, + 3: {lang: 0x3b7, script: 0x0, maxScript: 0x52, toRegion: 0xed, fromRegion: []uint16{0x29, 0x4d, 0x59, 0x85, 0x8a, 0xb6, 0xc5, 0xd0, 0x117, 0x125}}, + 4: {lang: 0x51f, script: 0x35, maxScript: 0x35, toRegion: 0x8c, fromRegion: []uint16{0xc5}}, +} + +// Total table size 25825 bytes (25KiB); checksum: 4E97CC5E diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go new file mode 100644 index 000000000..de30155a2 --- /dev/null +++ b/vendor/golang.org/x/text/language/tags.go @@ -0,0 +1,143 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// TODO: Various sets of commonly use tags and regions. + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func (c CanonType) MustParse(s string) Tag { + t, err := c.Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Base { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag{lang: _af} // af + Amharic Tag = Tag{lang: _am} // am + Arabic Tag = Tag{lang: _ar} // ar + ModernStandardArabic Tag = Tag{lang: _ar, region: _001} // ar-001 + Azerbaijani Tag = Tag{lang: _az} // az + Bulgarian Tag = Tag{lang: _bg} // bg + Bengali Tag = Tag{lang: _bn} // bn + Catalan Tag = Tag{lang: _ca} // ca + Czech Tag = Tag{lang: _cs} // cs + Danish Tag = Tag{lang: _da} // da + German Tag = Tag{lang: _de} // de + Greek Tag = Tag{lang: _el} // el + English Tag = Tag{lang: _en} // en + AmericanEnglish Tag = Tag{lang: _en, region: _US} // en-US + BritishEnglish Tag = Tag{lang: _en, region: _GB} // en-GB + Spanish Tag = Tag{lang: _es} // es + EuropeanSpanish Tag = Tag{lang: _es, region: _ES} // es-ES + LatinAmericanSpanish Tag = Tag{lang: _es, region: _419} // es-419 + Estonian Tag = Tag{lang: _et} // et + Persian Tag = Tag{lang: _fa} // fa + Finnish Tag = Tag{lang: _fi} // fi + Filipino Tag = Tag{lang: _fil} // fil + French Tag = Tag{lang: _fr} // fr + CanadianFrench Tag = Tag{lang: _fr, region: _CA} // fr-CA + Gujarati Tag = Tag{lang: _gu} // gu + Hebrew Tag = Tag{lang: _he} // he + Hindi Tag = Tag{lang: _hi} // hi + Croatian Tag = Tag{lang: _hr} // hr + Hungarian Tag = Tag{lang: _hu} // hu + Armenian Tag = Tag{lang: _hy} // hy + Indonesian Tag = Tag{lang: _id} // id + Icelandic Tag = Tag{lang: _is} // is + Italian Tag = Tag{lang: _it} // it + Japanese Tag = Tag{lang: _ja} // ja + Georgian Tag = Tag{lang: _ka} // ka + Kazakh Tag = Tag{lang: _kk} // kk + Khmer Tag = Tag{lang: _km} // km + Kannada Tag = Tag{lang: _kn} // kn + Korean Tag = Tag{lang: _ko} // ko + Kirghiz Tag = Tag{lang: _ky} // ky + Lao Tag = Tag{lang: _lo} // lo + Lithuanian Tag = Tag{lang: _lt} // lt + Latvian Tag = Tag{lang: _lv} // lv + Macedonian Tag = Tag{lang: _mk} // mk + Malayalam Tag = Tag{lang: _ml} // ml + Mongolian Tag = Tag{lang: _mn} // mn + Marathi Tag = Tag{lang: _mr} // mr + Malay Tag = Tag{lang: _ms} // ms + Burmese Tag = Tag{lang: _my} // my + Nepali Tag = Tag{lang: _ne} // ne + Dutch Tag = Tag{lang: _nl} // nl + Norwegian Tag = Tag{lang: _no} // no + Punjabi Tag = Tag{lang: _pa} // pa + Polish Tag = Tag{lang: _pl} // pl + Portuguese Tag = Tag{lang: _pt} // pt + BrazilianPortuguese Tag = Tag{lang: _pt, region: _BR} // pt-BR + EuropeanPortuguese Tag = Tag{lang: _pt, region: _PT} // pt-PT + Romanian Tag = Tag{lang: _ro} // ro + Russian Tag = Tag{lang: _ru} // ru + Sinhala Tag = Tag{lang: _si} // si + Slovak Tag = Tag{lang: _sk} // sk + Slovenian Tag = Tag{lang: _sl} // sl + Albanian Tag = Tag{lang: _sq} // sq + Serbian Tag = Tag{lang: _sr} // sr + SerbianLatin Tag = Tag{lang: _sr, script: _Latn} // sr-Latn + Swedish Tag = Tag{lang: _sv} // sv + Swahili Tag = Tag{lang: _sw} // sw + Tamil Tag = Tag{lang: _ta} // ta + Telugu Tag = Tag{lang: _te} // te + Thai Tag = Tag{lang: _th} // th + Turkish Tag = Tag{lang: _tr} // tr + Ukrainian Tag = Tag{lang: _uk} // uk + Urdu Tag = Tag{lang: _ur} // ur + Uzbek Tag = Tag{lang: _uz} // uz + Vietnamese Tag = Tag{lang: _vi} // vi + Chinese Tag = Tag{lang: _zh} // zh + SimplifiedChinese Tag = Tag{lang: _zh, script: _Hans} // zh-Hans + TraditionalChinese Tag = Tag{lang: _zh, script: _Hant} // zh-Hant + Zulu Tag = Tag{lang: _zu} // zu +) diff --git a/vendor/golang.org/x/text/runes/cond.go b/vendor/golang.org/x/text/runes/cond.go new file mode 100644 index 000000000..df7aa02db --- /dev/null +++ b/vendor/golang.org/x/text/runes/cond.go @@ -0,0 +1,187 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package runes + +import ( + "unicode/utf8" + + "golang.org/x/text/transform" +) + +// Note: below we pass invalid UTF-8 to the tIn and tNotIn transformers as is. +// This is done for various reasons: +// - To retain the semantics of the Nop transformer: if input is passed to a Nop +// one would expect it to be unchanged. +// - It would be very expensive to pass a converted RuneError to a transformer: +// a transformer might need more source bytes after RuneError, meaning that +// the only way to pass it safely is to create a new buffer and manage the +// intermingling of RuneErrors and normal input. +// - Many transformers leave ill-formed UTF-8 as is, so this is not +// inconsistent. Generally ill-formed UTF-8 is only replaced if it is a +// logical consequence of the operation (as for Map) or if it otherwise would +// pose security concerns (as for Remove). +// - An alternative would be to return an error on ill-formed UTF-8, but this +// would be inconsistent with other operations. + +// If returns a transformer that applies tIn to consecutive runes for which +// s.Contains(r) and tNotIn to consecutive runes for which !s.Contains(r). Reset +// is called on tIn and tNotIn at the start of each run. A Nop transformer will +// substitute a nil value passed to tIn or tNotIn. Invalid UTF-8 is translated +// to RuneError to determine which transformer to apply, but is passed as is to +// the respective transformer. +func If(s Set, tIn, tNotIn transform.Transformer) Transformer { + if tIn == nil && tNotIn == nil { + return Transformer{transform.Nop} + } + if tIn == nil { + tIn = transform.Nop + } + if tNotIn == nil { + tNotIn = transform.Nop + } + sIn, ok := tIn.(transform.SpanningTransformer) + if !ok { + sIn = dummySpan{tIn} + } + sNotIn, ok := tNotIn.(transform.SpanningTransformer) + if !ok { + sNotIn = dummySpan{tNotIn} + } + + a := &cond{ + tIn: sIn, + tNotIn: sNotIn, + f: s.Contains, + } + a.Reset() + return Transformer{a} +} + +type dummySpan struct{ transform.Transformer } + +func (d dummySpan) Span(src []byte, atEOF bool) (n int, err error) { + return 0, transform.ErrEndOfSpan +} + +type cond struct { + tIn, tNotIn transform.SpanningTransformer + f func(rune) bool + check func(rune) bool // current check to perform + t transform.SpanningTransformer // current transformer to use +} + +// Reset implements transform.Transformer. +func (t *cond) Reset() { + t.check = t.is + t.t = t.tIn + t.t.Reset() // notIn will be reset on first usage. +} + +func (t *cond) is(r rune) bool { + if t.f(r) { + return true + } + t.check = t.isNot + t.t = t.tNotIn + t.tNotIn.Reset() + return false +} + +func (t *cond) isNot(r rune) bool { + if !t.f(r) { + return true + } + t.check = t.is + t.t = t.tIn + t.tIn.Reset() + return false +} + +// This implementation of Span doesn't help all too much, but it needs to be +// there to satisfy this package's Transformer interface. +// TODO: there are certainly room for improvements, though. For example, if +// t.t == transform.Nop (which will a common occurrence) it will save a bundle +// to special-case that loop. +func (t *cond) Span(src []byte, atEOF bool) (n int, err error) { + p := 0 + for n < len(src) && err == nil { + // Don't process too much at a time as the Spanner that will be + // called on this block may terminate early. + const maxChunk = 4096 + max := len(src) + if v := n + maxChunk; v < max { + max = v + } + atEnd := false + size := 0 + current := t.t + for ; p < max; p += size { + r := rune(src[p]) + if r < utf8.RuneSelf { + size = 1 + } else if r, size = utf8.DecodeRune(src[p:]); size == 1 { + if !atEOF && !utf8.FullRune(src[p:]) { + err = transform.ErrShortSrc + break + } + } + if !t.check(r) { + // The next rune will be the start of a new run. + atEnd = true + break + } + } + n2, err2 := current.Span(src[n:p], atEnd || (atEOF && p == len(src))) + n += n2 + if err2 != nil { + return n, err2 + } + // At this point either err != nil or t.check will pass for the rune at p. + p = n + size + } + return n, err +} + +func (t *cond) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + p := 0 + for nSrc < len(src) && err == nil { + // Don't process too much at a time, as the work might be wasted if the + // destination buffer isn't large enough to hold the result or a + // transform returns an error early. + const maxChunk = 4096 + max := len(src) + if n := nSrc + maxChunk; n < len(src) { + max = n + } + atEnd := false + size := 0 + current := t.t + for ; p < max; p += size { + r := rune(src[p]) + if r < utf8.RuneSelf { + size = 1 + } else if r, size = utf8.DecodeRune(src[p:]); size == 1 { + if !atEOF && !utf8.FullRune(src[p:]) { + err = transform.ErrShortSrc + break + } + } + if !t.check(r) { + // The next rune will be the start of a new run. + atEnd = true + break + } + } + nDst2, nSrc2, err2 := current.Transform(dst[nDst:], src[nSrc:p], atEnd || (atEOF && p == len(src))) + nDst += nDst2 + nSrc += nSrc2 + if err2 != nil { + return nDst, nSrc, err2 + } + // At this point either err != nil or t.check will pass for the rune at p. + p = nSrc + size + } + return nDst, nSrc, err +} diff --git a/vendor/golang.org/x/text/runes/runes.go b/vendor/golang.org/x/text/runes/runes.go new file mode 100644 index 000000000..71933696f --- /dev/null +++ b/vendor/golang.org/x/text/runes/runes.go @@ -0,0 +1,355 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package runes provide transforms for UTF-8 encoded text. +package runes // import "golang.org/x/text/runes" + +import ( + "unicode" + "unicode/utf8" + + "golang.org/x/text/transform" +) + +// A Set is a collection of runes. +type Set interface { + // Contains returns true if r is contained in the set. + Contains(r rune) bool +} + +type setFunc func(rune) bool + +func (s setFunc) Contains(r rune) bool { + return s(r) +} + +// Note: using funcs here instead of wrapping types result in cleaner +// documentation and a smaller API. + +// In creates a Set with a Contains method that returns true for all runes in +// the given RangeTable. +func In(rt *unicode.RangeTable) Set { + return setFunc(func(r rune) bool { return unicode.Is(rt, r) }) +} + +// In creates a Set with a Contains method that returns true for all runes not +// in the given RangeTable. +func NotIn(rt *unicode.RangeTable) Set { + return setFunc(func(r rune) bool { return !unicode.Is(rt, r) }) +} + +// Predicate creates a Set with a Contains method that returns f(r). +func Predicate(f func(rune) bool) Set { + return setFunc(f) +} + +// Transformer implements the transform.Transformer interface. +type Transformer struct { + t transform.SpanningTransformer +} + +func (t Transformer) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + return t.t.Transform(dst, src, atEOF) +} + +func (t Transformer) Span(b []byte, atEOF bool) (n int, err error) { + return t.t.Span(b, atEOF) +} + +func (t Transformer) Reset() { t.t.Reset() } + +// Bytes returns a new byte slice with the result of converting b using t. It +// calls Reset on t. It returns nil if any error was found. This can only happen +// if an error-producing Transformer is passed to If. +func (t Transformer) Bytes(b []byte) []byte { + b, _, err := transform.Bytes(t, b) + if err != nil { + return nil + } + return b +} + +// String returns a string with the result of converting s using t. It calls +// Reset on t. It returns the empty string if any error was found. This can only +// happen if an error-producing Transformer is passed to If. +func (t Transformer) String(s string) string { + s, _, err := transform.String(t, s) + if err != nil { + return "" + } + return s +} + +// TODO: +// - Copy: copying strings and bytes in whole-rune units. +// - Validation (maybe) +// - Well-formed-ness (maybe) + +const runeErrorString = string(utf8.RuneError) + +// Remove returns a Transformer that removes runes r for which s.Contains(r). +// Illegal input bytes are replaced by RuneError before being passed to f. +func Remove(s Set) Transformer { + if f, ok := s.(setFunc); ok { + // This little trick cuts the running time of BenchmarkRemove for sets + // created by Predicate roughly in half. + // TODO: special-case RangeTables as well. + return Transformer{remove(f)} + } + return Transformer{remove(s.Contains)} +} + +// TODO: remove transform.RemoveFunc. + +type remove func(r rune) bool + +func (remove) Reset() {} + +// Span implements transform.Spanner. +func (t remove) Span(src []byte, atEOF bool) (n int, err error) { + for r, size := rune(0), 0; n < len(src); { + if r = rune(src[n]); r < utf8.RuneSelf { + size = 1 + } else if r, size = utf8.DecodeRune(src[n:]); size == 1 { + // Invalid rune. + if !atEOF && !utf8.FullRune(src[n:]) { + err = transform.ErrShortSrc + } else { + err = transform.ErrEndOfSpan + } + break + } + if t(r) { + err = transform.ErrEndOfSpan + break + } + n += size + } + return +} + +// Transform implements transform.Transformer. +func (t remove) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + for r, size := rune(0), 0; nSrc < len(src); { + if r = rune(src[nSrc]); r < utf8.RuneSelf { + size = 1 + } else if r, size = utf8.DecodeRune(src[nSrc:]); size == 1 { + // Invalid rune. + if !atEOF && !utf8.FullRune(src[nSrc:]) { + err = transform.ErrShortSrc + break + } + // We replace illegal bytes with RuneError. Not doing so might + // otherwise turn a sequence of invalid UTF-8 into valid UTF-8. + // The resulting byte sequence may subsequently contain runes + // for which t(r) is true that were passed unnoticed. + if !t(utf8.RuneError) { + if nDst+3 > len(dst) { + err = transform.ErrShortDst + break + } + dst[nDst+0] = runeErrorString[0] + dst[nDst+1] = runeErrorString[1] + dst[nDst+2] = runeErrorString[2] + nDst += 3 + } + nSrc++ + continue + } + if t(r) { + nSrc += size + continue + } + if nDst+size > len(dst) { + err = transform.ErrShortDst + break + } + for i := 0; i < size; i++ { + dst[nDst] = src[nSrc] + nDst++ + nSrc++ + } + } + return +} + +// Map returns a Transformer that maps the runes in the input using the given +// mapping. Illegal bytes in the input are converted to utf8.RuneError before +// being passed to the mapping func. +func Map(mapping func(rune) rune) Transformer { + return Transformer{mapper(mapping)} +} + +type mapper func(rune) rune + +func (mapper) Reset() {} + +// Span implements transform.Spanner. +func (t mapper) Span(src []byte, atEOF bool) (n int, err error) { + for r, size := rune(0), 0; n < len(src); n += size { + if r = rune(src[n]); r < utf8.RuneSelf { + size = 1 + } else if r, size = utf8.DecodeRune(src[n:]); size == 1 { + // Invalid rune. + if !atEOF && !utf8.FullRune(src[n:]) { + err = transform.ErrShortSrc + } else { + err = transform.ErrEndOfSpan + } + break + } + if t(r) != r { + err = transform.ErrEndOfSpan + break + } + } + return n, err +} + +// Transform implements transform.Transformer. +func (t mapper) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + var replacement rune + var b [utf8.UTFMax]byte + + for r, size := rune(0), 0; nSrc < len(src); { + if r = rune(src[nSrc]); r < utf8.RuneSelf { + if replacement = t(r); replacement < utf8.RuneSelf { + if nDst == len(dst) { + err = transform.ErrShortDst + break + } + dst[nDst] = byte(replacement) + nDst++ + nSrc++ + continue + } + size = 1 + } else if r, size = utf8.DecodeRune(src[nSrc:]); size == 1 { + // Invalid rune. + if !atEOF && !utf8.FullRune(src[nSrc:]) { + err = transform.ErrShortSrc + break + } + + if replacement = t(utf8.RuneError); replacement == utf8.RuneError { + if nDst+3 > len(dst) { + err = transform.ErrShortDst + break + } + dst[nDst+0] = runeErrorString[0] + dst[nDst+1] = runeErrorString[1] + dst[nDst+2] = runeErrorString[2] + nDst += 3 + nSrc++ + continue + } + } else if replacement = t(r); replacement == r { + if nDst+size > len(dst) { + err = transform.ErrShortDst + break + } + for i := 0; i < size; i++ { + dst[nDst] = src[nSrc] + nDst++ + nSrc++ + } + continue + } + + n := utf8.EncodeRune(b[:], replacement) + + if nDst+n > len(dst) { + err = transform.ErrShortDst + break + } + for i := 0; i < n; i++ { + dst[nDst] = b[i] + nDst++ + } + nSrc += size + } + return +} + +// ReplaceIllFormed returns a transformer that replaces all input bytes that are +// not part of a well-formed UTF-8 code sequence with utf8.RuneError. +func ReplaceIllFormed() Transformer { + return Transformer{&replaceIllFormed{}} +} + +type replaceIllFormed struct{ transform.NopResetter } + +func (t replaceIllFormed) Span(src []byte, atEOF bool) (n int, err error) { + for n < len(src) { + // ASCII fast path. + if src[n] < utf8.RuneSelf { + n++ + continue + } + + r, size := utf8.DecodeRune(src[n:]) + + // Look for a valid non-ASCII rune. + if r != utf8.RuneError || size != 1 { + n += size + continue + } + + // Look for short source data. + if !atEOF && !utf8.FullRune(src[n:]) { + err = transform.ErrShortSrc + break + } + + // We have an invalid rune. + err = transform.ErrEndOfSpan + break + } + return n, err +} + +func (t replaceIllFormed) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + for nSrc < len(src) { + // ASCII fast path. + if r := src[nSrc]; r < utf8.RuneSelf { + if nDst == len(dst) { + err = transform.ErrShortDst + break + } + dst[nDst] = r + nDst++ + nSrc++ + continue + } + + // Look for a valid non-ASCII rune. + if _, size := utf8.DecodeRune(src[nSrc:]); size != 1 { + if size != copy(dst[nDst:], src[nSrc:nSrc+size]) { + err = transform.ErrShortDst + break + } + nDst += size + nSrc += size + continue + } + + // Look for short source data. + if !atEOF && !utf8.FullRune(src[nSrc:]) { + err = transform.ErrShortSrc + break + } + + // We have an invalid rune. + if nDst+3 > len(dst) { + err = transform.ErrShortDst + break + } + dst[nDst+0] = runeErrorString[0] + dst[nDst+1] = runeErrorString[1] + dst[nDst+2] = runeErrorString[2] + nDst += 3 + nSrc++ + } + return nDst, nSrc, err +} diff --git a/vendor/golang.org/x/text/secure/bidirule/bidirule.go b/vendor/golang.org/x/text/secure/bidirule/bidirule.go new file mode 100644 index 000000000..a7161bdd9 --- /dev/null +++ b/vendor/golang.org/x/text/secure/bidirule/bidirule.go @@ -0,0 +1,342 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package bidirule implements the Bidi Rule defined by RFC 5893. +// +// This package is under development. The API may change without notice and +// without preserving backward compatibility. +package bidirule + +import ( + "errors" + "unicode/utf8" + + "golang.org/x/text/transform" + "golang.org/x/text/unicode/bidi" +) + +// This file contains an implementation of RFC 5893: Right-to-Left Scripts for +// Internationalized Domain Names for Applications (IDNA) +// +// A label is an individual component of a domain name. Labels are usually +// shown separated by dots; for example, the domain name "www.example.com" is +// composed of three labels: "www", "example", and "com". +// +// An RTL label is a label that contains at least one character of class R, AL, +// or AN. An LTR label is any label that is not an RTL label. +// +// A "Bidi domain name" is a domain name that contains at least one RTL label. +// +// The following guarantees can be made based on the above: +// +// o In a domain name consisting of only labels that satisfy the rule, +// the requirements of Section 3 are satisfied. Note that even LTR +// labels and pure ASCII labels have to be tested. +// +// o In a domain name consisting of only LDH labels (as defined in the +// Definitions document [RFC5890]) and labels that satisfy the rule, +// the requirements of Section 3 are satisfied as long as a label +// that starts with an ASCII digit does not come after a +// right-to-left label. +// +// No guarantee is given for other combinations. + +// ErrInvalid indicates a label is invalid according to the Bidi Rule. +var ErrInvalid = errors.New("bidirule: failed Bidi Rule") + +type ruleState uint8 + +const ( + ruleInitial ruleState = iota + ruleLTR + ruleLTRFinal + ruleRTL + ruleRTLFinal + ruleInvalid +) + +type ruleTransition struct { + next ruleState + mask uint16 +} + +var transitions = [...][2]ruleTransition{ + // [2.1] The first character must be a character with Bidi property L, R, or + // AL. If it has the R or AL property, it is an RTL label; if it has the L + // property, it is an LTR label. + ruleInitial: { + {ruleLTRFinal, 1 << bidi.L}, + {ruleRTLFinal, 1<<bidi.R | 1<<bidi.AL}, + }, + ruleRTL: { + // [2.3] In an RTL label, the end of the label must be a character with + // Bidi property R, AL, EN, or AN, followed by zero or more characters + // with Bidi property NSM. + {ruleRTLFinal, 1<<bidi.R | 1<<bidi.AL | 1<<bidi.EN | 1<<bidi.AN}, + + // [2.2] In an RTL label, only characters with the Bidi properties R, + // AL, AN, EN, ES, CS, ET, ON, BN, or NSM are allowed. + // We exclude the entries from [2.3] + {ruleRTL, 1<<bidi.ES | 1<<bidi.CS | 1<<bidi.ET | 1<<bidi.ON | 1<<bidi.BN | 1<<bidi.NSM}, + }, + ruleRTLFinal: { + // [2.3] In an RTL label, the end of the label must be a character with + // Bidi property R, AL, EN, or AN, followed by zero or more characters + // with Bidi property NSM. + {ruleRTLFinal, 1<<bidi.R | 1<<bidi.AL | 1<<bidi.EN | 1<<bidi.AN | 1<<bidi.NSM}, + + // [2.2] In an RTL label, only characters with the Bidi properties R, + // AL, AN, EN, ES, CS, ET, ON, BN, or NSM are allowed. + // We exclude the entries from [2.3] and NSM. + {ruleRTL, 1<<bidi.ES | 1<<bidi.CS | 1<<bidi.ET | 1<<bidi.ON | 1<<bidi.BN}, + }, + ruleLTR: { + // [2.6] In an LTR label, the end of the label must be a character with + // Bidi property L or EN, followed by zero or more characters with Bidi + // property NSM. + {ruleLTRFinal, 1<<bidi.L | 1<<bidi.EN}, + + // [2.5] In an LTR label, only characters with the Bidi properties L, + // EN, ES, CS, ET, ON, BN, or NSM are allowed. + // We exclude the entries from [2.6]. + {ruleLTR, 1<<bidi.ES | 1<<bidi.CS | 1<<bidi.ET | 1<<bidi.ON | 1<<bidi.BN | 1<<bidi.NSM}, + }, + ruleLTRFinal: { + // [2.6] In an LTR label, the end of the label must be a character with + // Bidi property L or EN, followed by zero or more characters with Bidi + // property NSM. + {ruleLTRFinal, 1<<bidi.L | 1<<bidi.EN | 1<<bidi.NSM}, + + // [2.5] In an LTR label, only characters with the Bidi properties L, + // EN, ES, CS, ET, ON, BN, or NSM are allowed. + // We exclude the entries from [2.6]. + {ruleLTR, 1<<bidi.ES | 1<<bidi.CS | 1<<bidi.ET | 1<<bidi.ON | 1<<bidi.BN}, + }, + ruleInvalid: { + {ruleInvalid, 0}, + {ruleInvalid, 0}, + }, +} + +// [2.4] In an RTL label, if an EN is present, no AN may be present, and +// vice versa. +const exclusiveRTL = uint16(1<<bidi.EN | 1<<bidi.AN) + +// From RFC 5893 +// An RTL label is a label that contains at least one character of type +// R, AL, or AN. +// +// An LTR label is any label that is not an RTL label. + +// Direction reports the direction of the given label as defined by RFC 5893. +// The Bidi Rule does not have to be applied to labels of the category +// LeftToRight. +func Direction(b []byte) bidi.Direction { + for i := 0; i < len(b); { + e, sz := bidi.Lookup(b[i:]) + if sz == 0 { + i++ + } + c := e.Class() + if c == bidi.R || c == bidi.AL || c == bidi.AN { + return bidi.RightToLeft + } + i += sz + } + return bidi.LeftToRight +} + +// DirectionString reports the direction of the given label as defined by RFC +// 5893. The Bidi Rule does not have to be applied to labels of the category +// LeftToRight. +func DirectionString(s string) bidi.Direction { + for i := 0; i < len(s); { + e, sz := bidi.LookupString(s[i:]) + if sz == 0 { + i++ + } + c := e.Class() + if c == bidi.R || c == bidi.AL || c == bidi.AN { + return bidi.RightToLeft + } + i += sz + } + return bidi.LeftToRight +} + +// Valid reports whether b conforms to the BiDi rule. +func Valid(b []byte) bool { + var t Transformer + if n, ok := t.advance(b); !ok || n < len(b) { + return false + } + return t.isFinal() +} + +// ValidString reports whether s conforms to the BiDi rule. +func ValidString(s string) bool { + var t Transformer + if n, ok := t.advanceString(s); !ok || n < len(s) { + return false + } + return t.isFinal() +} + +// New returns a Transformer that verifies that input adheres to the Bidi Rule. +func New() *Transformer { + return &Transformer{} +} + +// Transformer implements transform.Transform. +type Transformer struct { + state ruleState + hasRTL bool + seen uint16 +} + +// A rule can only be violated for "Bidi Domain names", meaning if one of the +// following categories has been observed. +func (t *Transformer) isRTL() bool { + const isRTL = 1<<bidi.R | 1<<bidi.AL | 1<<bidi.AN + return t.seen&isRTL != 0 +} + +func (t *Transformer) isFinal() bool { + if !t.isRTL() { + return true + } + return t.state == ruleLTRFinal || t.state == ruleRTLFinal || t.state == ruleInitial +} + +// Reset implements transform.Transformer. +func (t *Transformer) Reset() { *t = Transformer{} } + +// Transform implements transform.Transformer. This Transformer has state and +// needs to be reset between uses. +func (t *Transformer) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + if len(dst) < len(src) { + src = src[:len(dst)] + atEOF = false + err = transform.ErrShortDst + } + n, err1 := t.Span(src, atEOF) + copy(dst, src[:n]) + if err == nil || err1 != nil && err1 != transform.ErrShortSrc { + err = err1 + } + return n, n, err +} + +// Span returns the first n bytes of src that conform to the Bidi rule. +func (t *Transformer) Span(src []byte, atEOF bool) (n int, err error) { + if t.state == ruleInvalid && t.isRTL() { + return 0, ErrInvalid + } + n, ok := t.advance(src) + switch { + case !ok: + err = ErrInvalid + case n < len(src): + if !atEOF { + err = transform.ErrShortSrc + break + } + err = ErrInvalid + case !t.isFinal(): + err = ErrInvalid + } + return n, err +} + +// Precomputing the ASCII values decreases running time for the ASCII fast path +// by about 30%. +var asciiTable [128]bidi.Properties + +func init() { + for i := range asciiTable { + p, _ := bidi.LookupRune(rune(i)) + asciiTable[i] = p + } +} + +func (t *Transformer) advance(s []byte) (n int, ok bool) { + var e bidi.Properties + var sz int + for n < len(s) { + if s[n] < utf8.RuneSelf { + e, sz = asciiTable[s[n]], 1 + } else { + e, sz = bidi.Lookup(s[n:]) + if sz <= 1 { + if sz == 1 { + // We always consider invalid UTF-8 to be invalid, even if + // the string has not yet been determined to be RTL. + // TODO: is this correct? + return n, false + } + return n, true // incomplete UTF-8 encoding + } + } + // TODO: using CompactClass would result in noticeable speedup. + // See unicode/bidi/prop.go:Properties.CompactClass. + c := uint16(1 << e.Class()) + t.seen |= c + if t.seen&exclusiveRTL == exclusiveRTL { + t.state = ruleInvalid + return n, false + } + switch tr := transitions[t.state]; { + case tr[0].mask&c != 0: + t.state = tr[0].next + case tr[1].mask&c != 0: + t.state = tr[1].next + default: + t.state = ruleInvalid + if t.isRTL() { + return n, false + } + } + n += sz + } + return n, true +} + +func (t *Transformer) advanceString(s string) (n int, ok bool) { + var e bidi.Properties + var sz int + for n < len(s) { + if s[n] < utf8.RuneSelf { + e, sz = asciiTable[s[n]], 1 + } else { + e, sz = bidi.LookupString(s[n:]) + if sz <= 1 { + if sz == 1 { + return n, false // invalid UTF-8 + } + return n, true // incomplete UTF-8 encoding + } + } + // TODO: using CompactClass results in noticeable speedup. + // See unicode/bidi/prop.go:Properties.CompactClass. + c := uint16(1 << e.Class()) + t.seen |= c + if t.seen&exclusiveRTL == exclusiveRTL { + t.state = ruleInvalid + return n, false + } + switch tr := transitions[t.state]; { + case tr[0].mask&c != 0: + t.state = tr[0].next + case tr[1].mask&c != 0: + t.state = tr[1].next + default: + t.state = ruleInvalid + if t.isRTL() { + return n, false + } + } + n += sz + } + return n, true +} diff --git a/vendor/golang.org/x/text/secure/precis/class.go b/vendor/golang.org/x/text/secure/precis/class.go new file mode 100644 index 000000000..f6b56413b --- /dev/null +++ b/vendor/golang.org/x/text/secure/precis/class.go @@ -0,0 +1,36 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package precis + +import ( + "unicode/utf8" +) + +// TODO: Add contextual character rules from Appendix A of RFC5892. + +// A class is a set of characters that match certain derived properties. The +// PRECIS framework defines two classes: The Freeform class and the Identifier +// class. The freeform class should be used for profiles where expressiveness is +// prioritized over safety such as nicknames or passwords. The identifier class +// should be used for profiles where safety is the first priority such as +// addressable network labels and usernames. +type class struct { + validFrom property +} + +// Contains satisfies the runes.Set interface and returns whether the given rune +// is a member of the class. +func (c class) Contains(r rune) bool { + b := make([]byte, 4) + n := utf8.EncodeRune(b, r) + + trieval, _ := dpTrie.lookup(b[:n]) + return c.validFrom <= property(trieval) +} + +var ( + identifier = &class{validFrom: pValid} + freeform = &class{validFrom: idDisOrFreePVal} +) diff --git a/vendor/golang.org/x/text/secure/precis/context.go b/vendor/golang.org/x/text/secure/precis/context.go new file mode 100644 index 000000000..2dcaf29d7 --- /dev/null +++ b/vendor/golang.org/x/text/secure/precis/context.go @@ -0,0 +1,139 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package precis + +import "errors" + +// This file contains tables and code related to context rules. + +type catBitmap uint16 + +const ( + // These bits, once set depending on the current value, are never unset. + bJapanese catBitmap = 1 << iota + bArabicIndicDigit + bExtendedArabicIndicDigit + + // These bits are set on each iteration depending on the current value. + bJoinStart + bJoinMid + bJoinEnd + bVirama + bLatinSmallL + bGreek + bHebrew + + // These bits indicated which of the permanent bits need to be set at the + // end of the checks. + bMustHaveJapn + + permanent = bJapanese | bArabicIndicDigit | bExtendedArabicIndicDigit | bMustHaveJapn +) + +const finalShift = 10 + +var errContext = errors.New("precis: contextual rule violated") + +func init() { + // Programmatically set these required bits as, manually setting them seems + // too error prone. + for i, ct := range categoryTransitions { + categoryTransitions[i].keep |= permanent + categoryTransitions[i].accept |= ct.term + } +} + +var categoryTransitions = []struct { + keep catBitmap // mask selecting which bits to keep from the previous state + set catBitmap // mask for which bits to set for this transition + + // These bitmaps are used for rules that require lookahead. + // term&accept == term must be true, which is enforced programmatically. + term catBitmap // bits accepted as termination condition + accept catBitmap // bits that pass, but not sufficient as termination + + // The rule function cannot take a *context as an argument, as it would + // cause the context to escape, adding significant overhead. + rule func(beforeBits catBitmap) (doLookahead bool, err error) +}{ + joiningL: {set: bJoinStart}, + joiningD: {set: bJoinStart | bJoinEnd}, + joiningT: {keep: bJoinStart, set: bJoinMid}, + joiningR: {set: bJoinEnd}, + viramaModifier: {set: bVirama}, + viramaJoinT: {set: bVirama | bJoinMid}, + latinSmallL: {set: bLatinSmallL}, + greek: {set: bGreek}, + greekJoinT: {set: bGreek | bJoinMid}, + hebrew: {set: bHebrew}, + hebrewJoinT: {set: bHebrew | bJoinMid}, + japanese: {set: bJapanese}, + katakanaMiddleDot: {set: bMustHaveJapn}, + + zeroWidthNonJoiner: { + term: bJoinEnd, + accept: bJoinMid, + rule: func(before catBitmap) (doLookAhead bool, err error) { + if before&bVirama != 0 { + return false, nil + } + if before&bJoinStart == 0 { + return false, errContext + } + return true, nil + }, + }, + zeroWidthJoiner: { + rule: func(before catBitmap) (doLookAhead bool, err error) { + if before&bVirama == 0 { + err = errContext + } + return false, err + }, + }, + middleDot: { + term: bLatinSmallL, + rule: func(before catBitmap) (doLookAhead bool, err error) { + if before&bLatinSmallL == 0 { + return false, errContext + } + return true, nil + }, + }, + greekLowerNumeralSign: { + set: bGreek, + term: bGreek, + rule: func(before catBitmap) (doLookAhead bool, err error) { + return true, nil + }, + }, + hebrewPreceding: { + set: bHebrew, + rule: func(before catBitmap) (doLookAhead bool, err error) { + if before&bHebrew == 0 { + err = errContext + } + return false, err + }, + }, + arabicIndicDigit: { + set: bArabicIndicDigit, + rule: func(before catBitmap) (doLookAhead bool, err error) { + if before&bExtendedArabicIndicDigit != 0 { + err = errContext + } + return false, err + }, + }, + extendedArabicIndicDigit: { + set: bExtendedArabicIndicDigit, + rule: func(before catBitmap) (doLookAhead bool, err error) { + if before&bArabicIndicDigit != 0 { + err = errContext + } + return false, err + }, + }, +} diff --git a/vendor/golang.org/x/text/secure/precis/doc.go b/vendor/golang.org/x/text/secure/precis/doc.go new file mode 100644 index 000000000..48500fe1c --- /dev/null +++ b/vendor/golang.org/x/text/secure/precis/doc.go @@ -0,0 +1,14 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package precis contains types and functions for the preparation, +// enforcement, and comparison of internationalized strings ("PRECIS") as +// defined in RFC 7564. It also contains several pre-defined profiles for +// passwords, nicknames, and usernames as defined in RFC 7613 and RFC 7700. +// +// BE ADVISED: This package is under construction and the API may change in +// backwards incompatible ways and without notice. +package precis // import "golang.org/x/text/secure/precis" + +//go:generate go run gen.go gen_trieval.go diff --git a/vendor/golang.org/x/text/secure/precis/gen.go b/vendor/golang.org/x/text/secure/precis/gen.go new file mode 100644 index 000000000..dba9004a6 --- /dev/null +++ b/vendor/golang.org/x/text/secure/precis/gen.go @@ -0,0 +1,310 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Unicode table generator. +// Data read from the web. + +// +build ignore + +package main + +import ( + "flag" + "log" + "unicode" + "unicode/utf8" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/internal/triegen" + "golang.org/x/text/internal/ucd" + "golang.org/x/text/unicode/norm" + "golang.org/x/text/unicode/rangetable" +) + +var outputFile = flag.String("output", "tables.go", "output file for generated tables; default tables.go") + +var assigned, disallowedRunes *unicode.RangeTable + +var runeCategory = map[rune]category{} + +var overrides = map[category]category{ + viramaModifier: viramaJoinT, + greek: greekJoinT, + hebrew: hebrewJoinT, +} + +func setCategory(r rune, cat category) { + if c, ok := runeCategory[r]; ok { + if override, ok := overrides[c]; cat == joiningT && ok { + cat = override + } else { + log.Fatalf("%U: multiple categories for rune (%v and %v)", r, c, cat) + } + } + runeCategory[r] = cat +} + +func init() { + if numCategories > 1<<propShift { + log.Fatalf("Number of categories is %d; may at most be %d", numCategories, 1<<propShift) + } +} + +func main() { + gen.Init() + + // Load data + runes := []rune{} + // PrecisIgnorableProperties: https://tools.ietf.org/html/rfc7564#section-9.13 + ucd.Parse(gen.OpenUCDFile("DerivedCoreProperties.txt"), func(p *ucd.Parser) { + if p.String(1) == "Default_Ignorable_Code_Point" { + runes = append(runes, p.Rune(0)) + } + }) + ucd.Parse(gen.OpenUCDFile("PropList.txt"), func(p *ucd.Parser) { + switch p.String(1) { + case "Noncharacter_Code_Point": + runes = append(runes, p.Rune(0)) + } + }) + // OldHangulJamo: https://tools.ietf.org/html/rfc5892#section-2.9 + ucd.Parse(gen.OpenUCDFile("HangulSyllableType.txt"), func(p *ucd.Parser) { + switch p.String(1) { + case "L", "V", "T": + runes = append(runes, p.Rune(0)) + } + }) + + disallowedRunes = rangetable.New(runes...) + assigned = rangetable.Assigned(unicode.Version) + + // Load category data. + runeCategory['l'] = latinSmallL + ucd.Parse(gen.OpenUCDFile("UnicodeData.txt"), func(p *ucd.Parser) { + const cccVirama = 9 + if p.Int(ucd.CanonicalCombiningClass) == cccVirama { + setCategory(p.Rune(0), viramaModifier) + } + }) + ucd.Parse(gen.OpenUCDFile("Scripts.txt"), func(p *ucd.Parser) { + switch p.String(1) { + case "Greek": + setCategory(p.Rune(0), greek) + case "Hebrew": + setCategory(p.Rune(0), hebrew) + case "Hiragana", "Katakana", "Han": + setCategory(p.Rune(0), japanese) + } + }) + + // Set the rule categories associated with exceptions. This overrides any + // previously set categories. The original categories are manually + // reintroduced in the categoryTransitions table. + for r, e := range exceptions { + if e.cat != 0 { + runeCategory[r] = e.cat + } + } + cat := map[string]category{ + "L": joiningL, + "D": joiningD, + "T": joiningT, + + "R": joiningR, + } + ucd.Parse(gen.OpenUCDFile("extracted/DerivedJoiningType.txt"), func(p *ucd.Parser) { + switch v := p.String(1); v { + case "L", "D", "T", "R": + setCategory(p.Rune(0), cat[v]) + } + }) + + writeTables() + gen.Repackage("gen_trieval.go", "trieval.go", "precis") +} + +type exception struct { + prop property + cat category +} + +func init() { + // Programmatically add the Arabic and Indic digits to the exceptions map. + // See comment in the exceptions map below why these are marked disallowed. + for i := rune(0); i <= 9; i++ { + exceptions[0x0660+i] = exception{ + prop: disallowed, + cat: arabicIndicDigit, + } + exceptions[0x06F0+i] = exception{ + prop: disallowed, + cat: extendedArabicIndicDigit, + } + } +} + +// The Exceptions class as defined in RFC 5892 +// https://tools.ietf.org/html/rfc5892#section-2.6 +var exceptions = map[rune]exception{ + 0x00DF: {prop: pValid}, + 0x03C2: {prop: pValid}, + 0x06FD: {prop: pValid}, + 0x06FE: {prop: pValid}, + 0x0F0B: {prop: pValid}, + 0x3007: {prop: pValid}, + + // ContextO|J rules are marked as disallowed, taking a "guilty until proven + // innocent" approach. The main reason for this is that the check for + // whether a context rule should be applied can be moved to the logic for + // handing disallowed runes, taken it off the common path. The exception to + // this rule is for katakanaMiddleDot, as the rule logic is handled without + // using a rule function. + + // ContextJ (Join control) + 0x200C: {prop: disallowed, cat: zeroWidthNonJoiner}, + 0x200D: {prop: disallowed, cat: zeroWidthJoiner}, + + // ContextO + 0x00B7: {prop: disallowed, cat: middleDot}, + 0x0375: {prop: disallowed, cat: greekLowerNumeralSign}, + 0x05F3: {prop: disallowed, cat: hebrewPreceding}, // punctuation Geresh + 0x05F4: {prop: disallowed, cat: hebrewPreceding}, // punctuation Gershayim + 0x30FB: {prop: pValid, cat: katakanaMiddleDot}, + + // These are officially ContextO, but the implementation does not require + // special treatment of these, so we simply mark them as valid. + 0x0660: {prop: pValid}, + 0x0661: {prop: pValid}, + 0x0662: {prop: pValid}, + 0x0663: {prop: pValid}, + 0x0664: {prop: pValid}, + 0x0665: {prop: pValid}, + 0x0666: {prop: pValid}, + 0x0667: {prop: pValid}, + 0x0668: {prop: pValid}, + 0x0669: {prop: pValid}, + 0x06F0: {prop: pValid}, + 0x06F1: {prop: pValid}, + 0x06F2: {prop: pValid}, + 0x06F3: {prop: pValid}, + 0x06F4: {prop: pValid}, + 0x06F5: {prop: pValid}, + 0x06F6: {prop: pValid}, + 0x06F7: {prop: pValid}, + 0x06F8: {prop: pValid}, + 0x06F9: {prop: pValid}, + + 0x0640: {prop: disallowed}, + 0x07FA: {prop: disallowed}, + 0x302E: {prop: disallowed}, + 0x302F: {prop: disallowed}, + 0x3031: {prop: disallowed}, + 0x3032: {prop: disallowed}, + 0x3033: {prop: disallowed}, + 0x3034: {prop: disallowed}, + 0x3035: {prop: disallowed}, + 0x303B: {prop: disallowed}, +} + +// LetterDigits: https://tools.ietf.org/html/rfc5892#section-2.1 +// r in {Ll, Lu, Lo, Nd, Lm, Mn, Mc}. +func isLetterDigits(r rune) bool { + return unicode.In(r, + unicode.Ll, unicode.Lu, unicode.Lm, unicode.Lo, // Letters + unicode.Mn, unicode.Mc, // Modifiers + unicode.Nd, // Digits + ) +} + +func isIdDisAndFreePVal(r rune) bool { + return unicode.In(r, + // OtherLetterDigits: https://tools.ietf.org/html/rfc7564#section-9.18 + // r in in {Lt, Nl, No, Me} + unicode.Lt, unicode.Nl, unicode.No, // Other letters / numbers + unicode.Me, // Modifiers + + // Spaces: https://tools.ietf.org/html/rfc7564#section-9.14 + // r in in {Zs} + unicode.Zs, + + // Symbols: https://tools.ietf.org/html/rfc7564#section-9.15 + // r in {Sm, Sc, Sk, So} + unicode.Sm, unicode.Sc, unicode.Sk, unicode.So, + + // Punctuation: https://tools.ietf.org/html/rfc7564#section-9.16 + // r in {Pc, Pd, Ps, Pe, Pi, Pf, Po} + unicode.Pc, unicode.Pd, unicode.Ps, unicode.Pe, + unicode.Pi, unicode.Pf, unicode.Po, + ) +} + +// HasCompat: https://tools.ietf.org/html/rfc7564#section-9.17 +func hasCompat(r rune) bool { + return !norm.NFKC.IsNormalString(string(r)) +} + +// From https://tools.ietf.org/html/rfc5892: +// +// If .cp. .in. Exceptions Then Exceptions(cp); +// Else If .cp. .in. BackwardCompatible Then BackwardCompatible(cp); +// Else If .cp. .in. Unassigned Then UNASSIGNED; +// Else If .cp. .in. ASCII7 Then PVALID; +// Else If .cp. .in. JoinControl Then CONTEXTJ; +// Else If .cp. .in. OldHangulJamo Then DISALLOWED; +// Else If .cp. .in. PrecisIgnorableProperties Then DISALLOWED; +// Else If .cp. .in. Controls Then DISALLOWED; +// Else If .cp. .in. HasCompat Then ID_DIS or FREE_PVAL; +// Else If .cp. .in. LetterDigits Then PVALID; +// Else If .cp. .in. OtherLetterDigits Then ID_DIS or FREE_PVAL; +// Else If .cp. .in. Spaces Then ID_DIS or FREE_PVAL; +// Else If .cp. .in. Symbols Then ID_DIS or FREE_PVAL; +// Else If .cp. .in. Punctuation Then ID_DIS or FREE_PVAL; +// Else DISALLOWED; + +func writeTables() { + propTrie := triegen.NewTrie("derivedProperties") + w := gen.NewCodeWriter() + defer w.WriteGoFile(*outputFile, "precis") + gen.WriteUnicodeVersion(w) + + // Iterate over all the runes... + for i := rune(0); i < unicode.MaxRune; i++ { + r := rune(i) + + if !utf8.ValidRune(r) { + continue + } + + e, ok := exceptions[i] + p := e.prop + switch { + case ok: + case !unicode.In(r, assigned): + p = unassigned + case r >= 0x0021 && r <= 0x007e: // Is ASCII 7 + p = pValid + case unicode.In(r, disallowedRunes, unicode.Cc): + p = disallowed + case hasCompat(r): + p = idDisOrFreePVal + case isLetterDigits(r): + p = pValid + case isIdDisAndFreePVal(r): + p = idDisOrFreePVal + default: + p = disallowed + } + cat := runeCategory[r] + // Don't set category for runes that are disallowed. + if p == disallowed { + cat = exceptions[r].cat + } + propTrie.Insert(r, uint64(p)|uint64(cat)) + } + sz, err := propTrie.Gen(w) + if err != nil { + log.Fatal(err) + } + w.Size += sz +} diff --git a/vendor/golang.org/x/text/secure/precis/gen_trieval.go b/vendor/golang.org/x/text/secure/precis/gen_trieval.go new file mode 100644 index 000000000..308510c9a --- /dev/null +++ b/vendor/golang.org/x/text/secure/precis/gen_trieval.go @@ -0,0 +1,68 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +// entry is the entry of a trie table +// 7..6 property (unassigned, disallowed, maybe, valid) +// 5..0 category +type entry uint8 + +const ( + propShift = 6 + propMask = 0xc0 + catMask = 0x3f +) + +func (e entry) property() property { return property(e & propMask) } +func (e entry) category() category { return category(e & catMask) } + +type property uint8 + +// The order of these constants matter. A Profile may consider runes to be +// allowed either from pValid or idDisOrFreePVal. +const ( + unassigned property = iota << propShift + disallowed + idDisOrFreePVal // disallowed for Identifier, pValid for FreeForm + pValid +) + +// compute permutations of all properties and specialCategories. +type category uint8 + +const ( + other category = iota + + // Special rune types + joiningL + joiningD + joiningT + joiningR + viramaModifier + viramaJoinT // Virama + JoiningT + latinSmallL // U+006c + greek + greekJoinT // Greek + JoiningT + hebrew + hebrewJoinT // Hebrew + JoiningT + japanese // hirigana, katakana, han + + // Special rune types associated with contextual rules defined in + // https://tools.ietf.org/html/rfc5892#appendix-A. + // ContextO + zeroWidthNonJoiner // rule 1 + zeroWidthJoiner // rule 2 + // ContextJ + middleDot // rule 3 + greekLowerNumeralSign // rule 4 + hebrewPreceding // rule 5 and 6 + katakanaMiddleDot // rule 7 + arabicIndicDigit // rule 8 + extendedArabicIndicDigit // rule 9 + + numCategories +) diff --git a/vendor/golang.org/x/text/secure/precis/nickname.go b/vendor/golang.org/x/text/secure/precis/nickname.go new file mode 100644 index 000000000..cd54b9e69 --- /dev/null +++ b/vendor/golang.org/x/text/secure/precis/nickname.go @@ -0,0 +1,70 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package precis + +import ( + "unicode" + "unicode/utf8" + + "golang.org/x/text/transform" +) + +type nickAdditionalMapping struct { + // TODO: This transformer needs to be stateless somehow… + notStart bool + prevSpace bool +} + +func (t *nickAdditionalMapping) Reset() { + t.prevSpace = false + t.notStart = false +} + +func (t *nickAdditionalMapping) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + // RFC 7700 §2.1. Rules + // + // 2. Additional Mapping Rule: The additional mapping rule consists of + // the following sub-rules. + // + // 1. Any instances of non-ASCII space MUST be mapped to ASCII + // space (U+0020); a non-ASCII space is any Unicode code point + // having a general category of "Zs", naturally with the + // exception of U+0020. + // + // 2. Any instances of the ASCII space character at the beginning + // or end of a nickname MUST be removed (e.g., "stpeter " is + // mapped to "stpeter"). + // + // 3. Interior sequences of more than one ASCII space character + // MUST be mapped to a single ASCII space character (e.g., + // "St Peter" is mapped to "St Peter"). + + for nSrc < len(src) { + r, size := utf8.DecodeRune(src[nSrc:]) + if size == 0 { // Incomplete UTF-8 encoding + if !atEOF { + return nDst, nSrc, transform.ErrShortSrc + } + size = 1 + } + if unicode.Is(unicode.Zs, r) { + t.prevSpace = true + } else { + if t.prevSpace && t.notStart { + dst[nDst] = ' ' + nDst += 1 + } + if size != copy(dst[nDst:], src[nSrc:nSrc+size]) { + nDst += size + return nDst, nSrc, transform.ErrShortDst + } + nDst += size + t.prevSpace = false + t.notStart = true + } + nSrc += size + } + return nDst, nSrc, nil +} diff --git a/vendor/golang.org/x/text/secure/precis/options.go b/vendor/golang.org/x/text/secure/precis/options.go new file mode 100644 index 000000000..488f0b1f7 --- /dev/null +++ b/vendor/golang.org/x/text/secure/precis/options.go @@ -0,0 +1,153 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package precis + +import ( + "golang.org/x/text/cases" + "golang.org/x/text/language" + "golang.org/x/text/runes" + "golang.org/x/text/transform" + "golang.org/x/text/unicode/norm" +) + +// An Option is used to define the behavior and rules of a Profile. +type Option func(*options) + +type options struct { + // Preparation options + foldWidth bool + + // Enforcement options + asciiLower bool + cases transform.SpanningTransformer + disallow runes.Set + norm transform.SpanningTransformer + additional []func() transform.SpanningTransformer + width transform.SpanningTransformer + disallowEmpty bool + bidiRule bool + + // Comparison options + ignorecase bool +} + +func getOpts(o ...Option) (res options) { + for _, f := range o { + f(&res) + } + // Using a SpanningTransformer, instead of norm.Form prevents an allocation + // down the road. + if res.norm == nil { + res.norm = norm.NFC + } + return +} + +var ( + // The IgnoreCase option causes the profile to perform a case insensitive + // comparison during the PRECIS comparison step. + IgnoreCase Option = ignoreCase + + // The FoldWidth option causes the profile to map non-canonical wide and + // narrow variants to their decomposition mapping. This is useful for + // profiles that are based on the identifier class which would otherwise + // disallow such characters. + FoldWidth Option = foldWidth + + // The DisallowEmpty option causes the enforcement step to return an error if + // the resulting string would be empty. + DisallowEmpty Option = disallowEmpty + + // The BidiRule option causes the Bidi Rule defined in RFC 5893 to be + // applied. + BidiRule Option = bidiRule +) + +var ( + ignoreCase = func(o *options) { + o.ignorecase = true + } + foldWidth = func(o *options) { + o.foldWidth = true + } + disallowEmpty = func(o *options) { + o.disallowEmpty = true + } + bidiRule = func(o *options) { + o.bidiRule = true + } +) + +// TODO: move this logic to package transform + +type spanWrap struct{ transform.Transformer } + +func (s spanWrap) Span(src []byte, atEOF bool) (n int, err error) { + return 0, transform.ErrEndOfSpan +} + +// TODO: allow different types? For instance: +// func() transform.Transformer +// func() transform.SpanningTransformer +// func([]byte) bool // validation only +// +// Also, would be great if we could detect if a transformer is reentrant. + +// The AdditionalMapping option defines the additional mapping rule for the +// Profile by applying Transformer's in sequence. +func AdditionalMapping(t ...func() transform.Transformer) Option { + return func(o *options) { + for _, f := range t { + sf := func() transform.SpanningTransformer { + return f().(transform.SpanningTransformer) + } + if _, ok := f().(transform.SpanningTransformer); !ok { + sf = func() transform.SpanningTransformer { + return spanWrap{f()} + } + } + o.additional = append(o.additional, sf) + } + } +} + +// The Norm option defines a Profile's normalization rule. Defaults to NFC. +func Norm(f norm.Form) Option { + return func(o *options) { + o.norm = f + } +} + +// The FoldCase option defines a Profile's case mapping rule. Options can be +// provided to determine the type of case folding used. +func FoldCase(opts ...cases.Option) Option { + return func(o *options) { + o.asciiLower = true + o.cases = cases.Fold(opts...) + } +} + +// The LowerCase option defines a Profile's case mapping rule. Options can be +// provided to determine the type of case folding used. +func LowerCase(opts ...cases.Option) Option { + return func(o *options) { + o.asciiLower = true + if len(opts) == 0 { + o.cases = cases.Lower(language.Und, cases.HandleFinalSigma(false)) + return + } + + opts = append([]cases.Option{cases.HandleFinalSigma(false)}, opts...) + o.cases = cases.Lower(language.Und, opts...) + } +} + +// The Disallow option further restricts a Profile's allowed characters beyond +// what is disallowed by the underlying string class. +func Disallow(set runes.Set) Option { + return func(o *options) { + o.disallow = set + } +} diff --git a/vendor/golang.org/x/text/secure/precis/profile.go b/vendor/golang.org/x/text/secure/precis/profile.go new file mode 100644 index 000000000..1d7898d47 --- /dev/null +++ b/vendor/golang.org/x/text/secure/precis/profile.go @@ -0,0 +1,388 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package precis + +import ( + "bytes" + "errors" + "unicode/utf8" + + "golang.org/x/text/cases" + "golang.org/x/text/language" + "golang.org/x/text/runes" + "golang.org/x/text/secure/bidirule" + "golang.org/x/text/transform" + "golang.org/x/text/width" +) + +var ( + errDisallowedRune = errors.New("precis: disallowed rune encountered") +) + +var dpTrie = newDerivedPropertiesTrie(0) + +// A Profile represents a set of rules for normalizing and validating strings in +// the PRECIS framework. +type Profile struct { + options + class *class +} + +// NewIdentifier creates a new PRECIS profile based on the Identifier string +// class. Profiles created from this class are suitable for use where safety is +// prioritized over expressiveness like network identifiers, user accounts, chat +// rooms, and file names. +func NewIdentifier(opts ...Option) *Profile { + return &Profile{ + options: getOpts(opts...), + class: identifier, + } +} + +// NewFreeform creates a new PRECIS profile based on the Freeform string class. +// Profiles created from this class are suitable for use where expressiveness is +// prioritized over safety like passwords, and display-elements such as +// nicknames in a chat room. +func NewFreeform(opts ...Option) *Profile { + return &Profile{ + options: getOpts(opts...), + class: freeform, + } +} + +// NewTransformer creates a new transform.Transformer that performs the PRECIS +// preparation and enforcement steps on the given UTF-8 encoded bytes. +func (p *Profile) NewTransformer() *Transformer { + var ts []transform.Transformer + + // These transforms are applied in the order defined in + // https://tools.ietf.org/html/rfc7564#section-7 + + if p.options.foldWidth { + ts = append(ts, width.Fold) + } + + for _, f := range p.options.additional { + ts = append(ts, f()) + } + + if p.options.cases != nil { + ts = append(ts, p.options.cases) + } + + ts = append(ts, p.options.norm) + + if p.options.bidiRule { + ts = append(ts, bidirule.New()) + } + + ts = append(ts, &checker{p: p, allowed: p.Allowed()}) + + // TODO: Add the disallow empty rule with a dummy transformer? + + return &Transformer{transform.Chain(ts...)} +} + +var errEmptyString = errors.New("precis: transformation resulted in empty string") + +type buffers struct { + src []byte + buf [2][]byte + next int +} + +func (b *buffers) apply(t transform.SpanningTransformer) (err error) { + n, err := t.Span(b.src, true) + if err != transform.ErrEndOfSpan { + return err + } + x := b.next & 1 + if b.buf[x] == nil { + b.buf[x] = make([]byte, 0, 8+len(b.src)+len(b.src)>>2) + } + span := append(b.buf[x][:0], b.src[:n]...) + b.src, _, err = transform.Append(t, span, b.src[n:]) + b.buf[x] = b.src + b.next++ + return err +} + +// Pre-allocate transformers when possible. In some cases this avoids allocation. +var ( + foldWidthT transform.SpanningTransformer = width.Fold + lowerCaseT transform.SpanningTransformer = cases.Lower(language.Und, cases.HandleFinalSigma(false)) +) + +// TODO: make this a method on profile. + +func (b *buffers) enforce(p *Profile, src []byte, comparing bool) (str []byte, err error) { + b.src = src + + ascii := true + for _, c := range src { + if c >= utf8.RuneSelf { + ascii = false + break + } + } + // ASCII fast path. + if ascii { + for _, f := range p.options.additional { + if err = b.apply(f()); err != nil { + return nil, err + } + } + switch { + case p.options.asciiLower || (comparing && p.options.ignorecase): + for i, c := range b.src { + if 'A' <= c && c <= 'Z' { + b.src[i] = c ^ 1<<5 + } + } + case p.options.cases != nil: + b.apply(p.options.cases) + } + c := checker{p: p} + if _, err := c.span(b.src, true); err != nil { + return nil, err + } + if p.disallow != nil { + for _, c := range b.src { + if p.disallow.Contains(rune(c)) { + return nil, errDisallowedRune + } + } + } + if p.options.disallowEmpty && len(b.src) == 0 { + return nil, errEmptyString + } + return b.src, nil + } + + // These transforms are applied in the order defined in + // https://tools.ietf.org/html/rfc7564#section-7 + + // TODO: allow different width transforms options. + if p.options.foldWidth || (p.options.ignorecase && comparing) { + b.apply(foldWidthT) + } + for _, f := range p.options.additional { + if err = b.apply(f()); err != nil { + return nil, err + } + } + if p.options.cases != nil { + b.apply(p.options.cases) + } + if comparing && p.options.ignorecase { + b.apply(lowerCaseT) + } + b.apply(p.norm) + if p.options.bidiRule && !bidirule.Valid(b.src) { + return nil, bidirule.ErrInvalid + } + c := checker{p: p} + if _, err := c.span(b.src, true); err != nil { + return nil, err + } + if p.disallow != nil { + for i := 0; i < len(b.src); { + r, size := utf8.DecodeRune(b.src[i:]) + if p.disallow.Contains(r) { + return nil, errDisallowedRune + } + i += size + } + } + if p.options.disallowEmpty && len(b.src) == 0 { + return nil, errEmptyString + } + return b.src, nil +} + +// Append appends the result of applying p to src writing the result to dst. +// It returns an error if the input string is invalid. +func (p *Profile) Append(dst, src []byte) ([]byte, error) { + var buf buffers + b, err := buf.enforce(p, src, false) + if err != nil { + return nil, err + } + return append(dst, b...), nil +} + +func processBytes(p *Profile, b []byte, key bool) ([]byte, error) { + var buf buffers + b, err := buf.enforce(p, b, key) + if err != nil { + return nil, err + } + if buf.next == 0 { + c := make([]byte, len(b)) + copy(c, b) + return c, nil + } + return b, nil +} + +// Bytes returns a new byte slice with the result of applying the profile to b. +func (p *Profile) Bytes(b []byte) ([]byte, error) { + return processBytes(p, b, false) +} + +// AppendCompareKey appends the result of applying p to src (including any +// optional rules to make strings comparable or useful in a map key such as +// applying lowercasing) writing the result to dst. It returns an error if the +// input string is invalid. +func (p *Profile) AppendCompareKey(dst, src []byte) ([]byte, error) { + var buf buffers + b, err := buf.enforce(p, src, true) + if err != nil { + return nil, err + } + return append(dst, b...), nil +} + +func processString(p *Profile, s string, key bool) (string, error) { + var buf buffers + b, err := buf.enforce(p, []byte(s), key) + if err != nil { + return "", err + } + return string(b), nil +} + +// String returns a string with the result of applying the profile to s. +func (p *Profile) String(s string) (string, error) { + return processString(p, s, false) +} + +// CompareKey returns a string that can be used for comparison, hashing, or +// collation. +func (p *Profile) CompareKey(s string) (string, error) { + return processString(p, s, true) +} + +// Compare enforces both strings, and then compares them for bit-string identity +// (byte-for-byte equality). If either string cannot be enforced, the comparison +// is false. +func (p *Profile) Compare(a, b string) bool { + var buf buffers + + akey, err := buf.enforce(p, []byte(a), true) + if err != nil { + return false + } + + buf = buffers{} + bkey, err := buf.enforce(p, []byte(b), true) + if err != nil { + return false + } + + return bytes.Compare(akey, bkey) == 0 +} + +// Allowed returns a runes.Set containing every rune that is a member of the +// underlying profile's string class and not disallowed by any profile specific +// rules. +func (p *Profile) Allowed() runes.Set { + if p.options.disallow != nil { + return runes.Predicate(func(r rune) bool { + return p.class.Contains(r) && !p.options.disallow.Contains(r) + }) + } + return p.class +} + +type checker struct { + p *Profile + allowed runes.Set + + beforeBits catBitmap + termBits catBitmap + acceptBits catBitmap +} + +func (c *checker) Reset() { + c.beforeBits = 0 + c.termBits = 0 + c.acceptBits = 0 +} + +func (c *checker) span(src []byte, atEOF bool) (n int, err error) { + for n < len(src) { + e, sz := dpTrie.lookup(src[n:]) + d := categoryTransitions[category(e&catMask)] + if sz == 0 { + if !atEOF { + return n, transform.ErrShortSrc + } + return n, errDisallowedRune + } + if property(e) < c.p.class.validFrom { + if d.rule == nil { + return n, errDisallowedRune + } + doLookAhead, err := d.rule(c.beforeBits) + if err != nil { + return n, err + } + if doLookAhead { + c.beforeBits &= d.keep + c.beforeBits |= d.set + // We may still have a lookahead rule which we will require to + // complete (by checking termBits == 0) before setting the new + // bits. + if c.termBits != 0 && (!c.checkLookahead() || c.termBits == 0) { + return n, err + } + c.termBits = d.term + c.acceptBits = d.accept + n += sz + continue + } + } + c.beforeBits &= d.keep + c.beforeBits |= d.set + if c.termBits != 0 && !c.checkLookahead() { + return n, errContext + } + n += sz + } + if m := c.beforeBits >> finalShift; c.beforeBits&m != m || c.termBits != 0 { + err = errContext + } + return n, err +} + +func (c *checker) checkLookahead() bool { + switch { + case c.beforeBits&c.termBits != 0: + c.termBits = 0 + c.acceptBits = 0 + case c.beforeBits&c.acceptBits != 0: + default: + return false + } + return true +} + +// TODO: we may get rid of this transform if transform.Chain understands +// something like a Spanner interface. +func (c checker) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + short := false + if len(dst) < len(src) { + src = src[:len(dst)] + atEOF = false + short = true + } + nSrc, err = c.span(src, atEOF) + nDst = copy(dst, src[:nSrc]) + if short && (err == transform.ErrShortSrc || err == nil) { + err = transform.ErrShortDst + } + return nDst, nSrc, err +} diff --git a/vendor/golang.org/x/text/secure/precis/profiles.go b/vendor/golang.org/x/text/secure/precis/profiles.go new file mode 100644 index 000000000..8b46d504c --- /dev/null +++ b/vendor/golang.org/x/text/secure/precis/profiles.go @@ -0,0 +1,69 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package precis + +import ( + "unicode" + + "golang.org/x/text/runes" + "golang.org/x/text/transform" + "golang.org/x/text/unicode/norm" +) + +var ( + Nickname *Profile = nickname // Implements the Nickname profile specified in RFC 7700. + UsernameCaseMapped *Profile = usernameCaseMap // Implements the UsernameCaseMapped profile specified in RFC 7613. + UsernameCasePreserved *Profile = usernameNoCaseMap // Implements the UsernameCasePreserved profile specified in RFC 7613. + OpaqueString *Profile = opaquestring // Implements the OpaqueString profile defined in RFC 7613 for passwords and other secure labels. +) + +var ( + nickname = &Profile{ + options: getOpts( + AdditionalMapping(func() transform.Transformer { + return &nickAdditionalMapping{} + }), + IgnoreCase, + Norm(norm.NFKC), + DisallowEmpty, + ), + class: freeform, + } + usernameCaseMap = &Profile{ + options: getOpts( + FoldWidth, + LowerCase(), + Norm(norm.NFC), + BidiRule, + ), + class: identifier, + } + usernameNoCaseMap = &Profile{ + options: getOpts( + FoldWidth, + Norm(norm.NFC), + BidiRule, + ), + class: identifier, + } + opaquestring = &Profile{ + options: getOpts( + AdditionalMapping(func() transform.Transformer { + return mapSpaces + }), + Norm(norm.NFC), + DisallowEmpty, + ), + class: freeform, + } +) + +// mapSpaces is a shared value of a runes.Map transformer. +var mapSpaces transform.Transformer = runes.Map(func(r rune) rune { + if unicode.Is(unicode.Zs, r) { + return ' ' + } + return r +}) diff --git a/vendor/golang.org/x/text/secure/precis/tables.go b/vendor/golang.org/x/text/secure/precis/tables.go new file mode 100644 index 000000000..a9b500deb --- /dev/null +++ b/vendor/golang.org/x/text/secure/precis/tables.go @@ -0,0 +1,3788 @@ +// This file was generated by go generate; DO NOT EDIT + +package precis + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "9.0.0" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *derivedPropertiesTrie) lookup(s []byte) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return derivedPropertiesValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := derivedPropertiesIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := derivedPropertiesIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = derivedPropertiesIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := derivedPropertiesIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = derivedPropertiesIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = derivedPropertiesIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *derivedPropertiesTrie) lookupUnsafe(s []byte) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return derivedPropertiesValues[c0] + } + i := derivedPropertiesIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = derivedPropertiesIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = derivedPropertiesIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *derivedPropertiesTrie) lookupString(s string) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return derivedPropertiesValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := derivedPropertiesIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := derivedPropertiesIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = derivedPropertiesIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := derivedPropertiesIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = derivedPropertiesIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = derivedPropertiesIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *derivedPropertiesTrie) lookupStringUnsafe(s string) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return derivedPropertiesValues[c0] + } + i := derivedPropertiesIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = derivedPropertiesIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = derivedPropertiesIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// derivedPropertiesTrie. Total size: 25344 bytes (24.75 KiB). Checksum: c5b977d76d42d8a. +type derivedPropertiesTrie struct{} + +func newDerivedPropertiesTrie(i int) *derivedPropertiesTrie { + return &derivedPropertiesTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *derivedPropertiesTrie) lookupValue(n uint32, b byte) uint8 { + switch { + default: + return uint8(derivedPropertiesValues[n<<6+uint32(b)]) + } +} + +// derivedPropertiesValues: 324 blocks, 20736 entries, 20736 bytes +// The third block is the zero block. +var derivedPropertiesValues = [20736]uint8{ + // Block 0x0, offset 0x0 + 0x00: 0x0040, 0x01: 0x0040, 0x02: 0x0040, 0x03: 0x0040, 0x04: 0x0040, 0x05: 0x0040, + 0x06: 0x0040, 0x07: 0x0040, 0x08: 0x0040, 0x09: 0x0040, 0x0a: 0x0040, 0x0b: 0x0040, + 0x0c: 0x0040, 0x0d: 0x0040, 0x0e: 0x0040, 0x0f: 0x0040, 0x10: 0x0040, 0x11: 0x0040, + 0x12: 0x0040, 0x13: 0x0040, 0x14: 0x0040, 0x15: 0x0040, 0x16: 0x0040, 0x17: 0x0040, + 0x18: 0x0040, 0x19: 0x0040, 0x1a: 0x0040, 0x1b: 0x0040, 0x1c: 0x0040, 0x1d: 0x0040, + 0x1e: 0x0040, 0x1f: 0x0040, 0x20: 0x0080, 0x21: 0x00c0, 0x22: 0x00c0, 0x23: 0x00c0, + 0x24: 0x00c0, 0x25: 0x00c0, 0x26: 0x00c0, 0x27: 0x00c0, 0x28: 0x00c0, 0x29: 0x00c0, + 0x2a: 0x00c0, 0x2b: 0x00c0, 0x2c: 0x00c0, 0x2d: 0x00c0, 0x2e: 0x00c0, 0x2f: 0x00c0, + 0x30: 0x00c0, 0x31: 0x00c0, 0x32: 0x00c0, 0x33: 0x00c0, 0x34: 0x00c0, 0x35: 0x00c0, + 0x36: 0x00c0, 0x37: 0x00c0, 0x38: 0x00c0, 0x39: 0x00c0, 0x3a: 0x00c0, 0x3b: 0x00c0, + 0x3c: 0x00c0, 0x3d: 0x00c0, 0x3e: 0x00c0, 0x3f: 0x00c0, + // Block 0x1, offset 0x40 + 0x40: 0x00c0, 0x41: 0x00c0, 0x42: 0x00c0, 0x43: 0x00c0, 0x44: 0x00c0, 0x45: 0x00c0, + 0x46: 0x00c0, 0x47: 0x00c0, 0x48: 0x00c0, 0x49: 0x00c0, 0x4a: 0x00c0, 0x4b: 0x00c0, + 0x4c: 0x00c0, 0x4d: 0x00c0, 0x4e: 0x00c0, 0x4f: 0x00c0, 0x50: 0x00c0, 0x51: 0x00c0, + 0x52: 0x00c0, 0x53: 0x00c0, 0x54: 0x00c0, 0x55: 0x00c0, 0x56: 0x00c0, 0x57: 0x00c0, + 0x58: 0x00c0, 0x59: 0x00c0, 0x5a: 0x00c0, 0x5b: 0x00c0, 0x5c: 0x00c0, 0x5d: 0x00c0, + 0x5e: 0x00c0, 0x5f: 0x00c0, 0x60: 0x00c0, 0x61: 0x00c0, 0x62: 0x00c0, 0x63: 0x00c0, + 0x64: 0x00c0, 0x65: 0x00c0, 0x66: 0x00c0, 0x67: 0x00c0, 0x68: 0x00c0, 0x69: 0x00c0, + 0x6a: 0x00c0, 0x6b: 0x00c0, 0x6c: 0x00c7, 0x6d: 0x00c0, 0x6e: 0x00c0, 0x6f: 0x00c0, + 0x70: 0x00c0, 0x71: 0x00c0, 0x72: 0x00c0, 0x73: 0x00c0, 0x74: 0x00c0, 0x75: 0x00c0, + 0x76: 0x00c0, 0x77: 0x00c0, 0x78: 0x00c0, 0x79: 0x00c0, 0x7a: 0x00c0, 0x7b: 0x00c0, + 0x7c: 0x00c0, 0x7d: 0x00c0, 0x7e: 0x00c0, 0x7f: 0x0040, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0040, 0xc1: 0x0040, 0xc2: 0x0040, 0xc3: 0x0040, 0xc4: 0x0040, 0xc5: 0x0040, + 0xc6: 0x0040, 0xc7: 0x0040, 0xc8: 0x0040, 0xc9: 0x0040, 0xca: 0x0040, 0xcb: 0x0040, + 0xcc: 0x0040, 0xcd: 0x0040, 0xce: 0x0040, 0xcf: 0x0040, 0xd0: 0x0040, 0xd1: 0x0040, + 0xd2: 0x0040, 0xd3: 0x0040, 0xd4: 0x0040, 0xd5: 0x0040, 0xd6: 0x0040, 0xd7: 0x0040, + 0xd8: 0x0040, 0xd9: 0x0040, 0xda: 0x0040, 0xdb: 0x0040, 0xdc: 0x0040, 0xdd: 0x0040, + 0xde: 0x0040, 0xdf: 0x0040, 0xe0: 0x0080, 0xe1: 0x0080, 0xe2: 0x0080, 0xe3: 0x0080, + 0xe4: 0x0080, 0xe5: 0x0080, 0xe6: 0x0080, 0xe7: 0x0080, 0xe8: 0x0080, 0xe9: 0x0080, + 0xea: 0x0080, 0xeb: 0x0080, 0xec: 0x0080, 0xed: 0x0040, 0xee: 0x0080, 0xef: 0x0080, + 0xf0: 0x0080, 0xf1: 0x0080, 0xf2: 0x0080, 0xf3: 0x0080, 0xf4: 0x0080, 0xf5: 0x0080, + 0xf6: 0x0080, 0xf7: 0x004f, 0xf8: 0x0080, 0xf9: 0x0080, 0xfa: 0x0080, 0xfb: 0x0080, + 0xfc: 0x0080, 0xfd: 0x0080, 0xfe: 0x0080, 0xff: 0x0080, + // Block 0x4, offset 0x100 + 0x100: 0x00c0, 0x101: 0x00c0, 0x102: 0x00c0, 0x103: 0x00c0, 0x104: 0x00c0, 0x105: 0x00c0, + 0x106: 0x00c0, 0x107: 0x00c0, 0x108: 0x00c0, 0x109: 0x00c0, 0x10a: 0x00c0, 0x10b: 0x00c0, + 0x10c: 0x00c0, 0x10d: 0x00c0, 0x10e: 0x00c0, 0x10f: 0x00c0, 0x110: 0x00c0, 0x111: 0x00c0, + 0x112: 0x00c0, 0x113: 0x00c0, 0x114: 0x00c0, 0x115: 0x00c0, 0x116: 0x00c0, 0x117: 0x0080, + 0x118: 0x00c0, 0x119: 0x00c0, 0x11a: 0x00c0, 0x11b: 0x00c0, 0x11c: 0x00c0, 0x11d: 0x00c0, + 0x11e: 0x00c0, 0x11f: 0x00c0, 0x120: 0x00c0, 0x121: 0x00c0, 0x122: 0x00c0, 0x123: 0x00c0, + 0x124: 0x00c0, 0x125: 0x00c0, 0x126: 0x00c0, 0x127: 0x00c0, 0x128: 0x00c0, 0x129: 0x00c0, + 0x12a: 0x00c0, 0x12b: 0x00c0, 0x12c: 0x00c0, 0x12d: 0x00c0, 0x12e: 0x00c0, 0x12f: 0x00c0, + 0x130: 0x00c0, 0x131: 0x00c0, 0x132: 0x00c0, 0x133: 0x00c0, 0x134: 0x00c0, 0x135: 0x00c0, + 0x136: 0x00c0, 0x137: 0x0080, 0x138: 0x00c0, 0x139: 0x00c0, 0x13a: 0x00c0, 0x13b: 0x00c0, + 0x13c: 0x00c0, 0x13d: 0x00c0, 0x13e: 0x00c0, 0x13f: 0x00c0, + // Block 0x5, offset 0x140 + 0x140: 0x00c0, 0x141: 0x00c0, 0x142: 0x00c0, 0x143: 0x00c0, 0x144: 0x00c0, 0x145: 0x00c0, + 0x146: 0x00c0, 0x147: 0x00c0, 0x148: 0x00c0, 0x149: 0x00c0, 0x14a: 0x00c0, 0x14b: 0x00c0, + 0x14c: 0x00c0, 0x14d: 0x00c0, 0x14e: 0x00c0, 0x14f: 0x00c0, 0x150: 0x00c0, 0x151: 0x00c0, + 0x152: 0x00c0, 0x153: 0x00c0, 0x154: 0x00c0, 0x155: 0x00c0, 0x156: 0x00c0, 0x157: 0x00c0, + 0x158: 0x00c0, 0x159: 0x00c0, 0x15a: 0x00c0, 0x15b: 0x00c0, 0x15c: 0x00c0, 0x15d: 0x00c0, + 0x15e: 0x00c0, 0x15f: 0x00c0, 0x160: 0x00c0, 0x161: 0x00c0, 0x162: 0x00c0, 0x163: 0x00c0, + 0x164: 0x00c0, 0x165: 0x00c0, 0x166: 0x00c0, 0x167: 0x00c0, 0x168: 0x00c0, 0x169: 0x00c0, + 0x16a: 0x00c0, 0x16b: 0x00c0, 0x16c: 0x00c0, 0x16d: 0x00c0, 0x16e: 0x00c0, 0x16f: 0x00c0, + 0x170: 0x00c0, 0x171: 0x00c0, 0x172: 0x0080, 0x173: 0x0080, 0x174: 0x00c0, 0x175: 0x00c0, + 0x176: 0x00c0, 0x177: 0x00c0, 0x178: 0x00c0, 0x179: 0x00c0, 0x17a: 0x00c0, 0x17b: 0x00c0, + 0x17c: 0x00c0, 0x17d: 0x00c0, 0x17e: 0x00c0, 0x17f: 0x0080, + // Block 0x6, offset 0x180 + 0x180: 0x0080, 0x181: 0x00c0, 0x182: 0x00c0, 0x183: 0x00c0, 0x184: 0x00c0, 0x185: 0x00c0, + 0x186: 0x00c0, 0x187: 0x00c0, 0x188: 0x00c0, 0x189: 0x0080, 0x18a: 0x00c0, 0x18b: 0x00c0, + 0x18c: 0x00c0, 0x18d: 0x00c0, 0x18e: 0x00c0, 0x18f: 0x00c0, 0x190: 0x00c0, 0x191: 0x00c0, + 0x192: 0x00c0, 0x193: 0x00c0, 0x194: 0x00c0, 0x195: 0x00c0, 0x196: 0x00c0, 0x197: 0x00c0, + 0x198: 0x00c0, 0x199: 0x00c0, 0x19a: 0x00c0, 0x19b: 0x00c0, 0x19c: 0x00c0, 0x19d: 0x00c0, + 0x19e: 0x00c0, 0x19f: 0x00c0, 0x1a0: 0x00c0, 0x1a1: 0x00c0, 0x1a2: 0x00c0, 0x1a3: 0x00c0, + 0x1a4: 0x00c0, 0x1a5: 0x00c0, 0x1a6: 0x00c0, 0x1a7: 0x00c0, 0x1a8: 0x00c0, 0x1a9: 0x00c0, + 0x1aa: 0x00c0, 0x1ab: 0x00c0, 0x1ac: 0x00c0, 0x1ad: 0x00c0, 0x1ae: 0x00c0, 0x1af: 0x00c0, + 0x1b0: 0x00c0, 0x1b1: 0x00c0, 0x1b2: 0x00c0, 0x1b3: 0x00c0, 0x1b4: 0x00c0, 0x1b5: 0x00c0, + 0x1b6: 0x00c0, 0x1b7: 0x00c0, 0x1b8: 0x00c0, 0x1b9: 0x00c0, 0x1ba: 0x00c0, 0x1bb: 0x00c0, + 0x1bc: 0x00c0, 0x1bd: 0x00c0, 0x1be: 0x00c0, 0x1bf: 0x0080, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x00c0, 0x1c1: 0x00c0, 0x1c2: 0x00c0, 0x1c3: 0x00c0, 0x1c4: 0x00c0, 0x1c5: 0x00c0, + 0x1c6: 0x00c0, 0x1c7: 0x00c0, 0x1c8: 0x00c0, 0x1c9: 0x00c0, 0x1ca: 0x00c0, 0x1cb: 0x00c0, + 0x1cc: 0x00c0, 0x1cd: 0x00c0, 0x1ce: 0x00c0, 0x1cf: 0x00c0, 0x1d0: 0x00c0, 0x1d1: 0x00c0, + 0x1d2: 0x00c0, 0x1d3: 0x00c0, 0x1d4: 0x00c0, 0x1d5: 0x00c0, 0x1d6: 0x00c0, 0x1d7: 0x00c0, + 0x1d8: 0x00c0, 0x1d9: 0x00c0, 0x1da: 0x00c0, 0x1db: 0x00c0, 0x1dc: 0x00c0, 0x1dd: 0x00c0, + 0x1de: 0x00c0, 0x1df: 0x00c0, 0x1e0: 0x00c0, 0x1e1: 0x00c0, 0x1e2: 0x00c0, 0x1e3: 0x00c0, + 0x1e4: 0x00c0, 0x1e5: 0x00c0, 0x1e6: 0x00c0, 0x1e7: 0x00c0, 0x1e8: 0x00c0, 0x1e9: 0x00c0, + 0x1ea: 0x00c0, 0x1eb: 0x00c0, 0x1ec: 0x00c0, 0x1ed: 0x00c0, 0x1ee: 0x00c0, 0x1ef: 0x00c0, + 0x1f0: 0x00c0, 0x1f1: 0x00c0, 0x1f2: 0x00c0, 0x1f3: 0x00c0, 0x1f4: 0x00c0, 0x1f5: 0x00c0, + 0x1f6: 0x00c0, 0x1f7: 0x00c0, 0x1f8: 0x00c0, 0x1f9: 0x00c0, 0x1fa: 0x00c0, 0x1fb: 0x00c0, + 0x1fc: 0x00c0, 0x1fd: 0x00c0, 0x1fe: 0x00c0, 0x1ff: 0x00c0, + // Block 0x8, offset 0x200 + 0x200: 0x00c0, 0x201: 0x00c0, 0x202: 0x00c0, 0x203: 0x00c0, 0x204: 0x0080, 0x205: 0x0080, + 0x206: 0x0080, 0x207: 0x0080, 0x208: 0x0080, 0x209: 0x0080, 0x20a: 0x0080, 0x20b: 0x0080, + 0x20c: 0x0080, 0x20d: 0x00c0, 0x20e: 0x00c0, 0x20f: 0x00c0, 0x210: 0x00c0, 0x211: 0x00c0, + 0x212: 0x00c0, 0x213: 0x00c0, 0x214: 0x00c0, 0x215: 0x00c0, 0x216: 0x00c0, 0x217: 0x00c0, + 0x218: 0x00c0, 0x219: 0x00c0, 0x21a: 0x00c0, 0x21b: 0x00c0, 0x21c: 0x00c0, 0x21d: 0x00c0, + 0x21e: 0x00c0, 0x21f: 0x00c0, 0x220: 0x00c0, 0x221: 0x00c0, 0x222: 0x00c0, 0x223: 0x00c0, + 0x224: 0x00c0, 0x225: 0x00c0, 0x226: 0x00c0, 0x227: 0x00c0, 0x228: 0x00c0, 0x229: 0x00c0, + 0x22a: 0x00c0, 0x22b: 0x00c0, 0x22c: 0x00c0, 0x22d: 0x00c0, 0x22e: 0x00c0, 0x22f: 0x00c0, + 0x230: 0x00c0, 0x231: 0x0080, 0x232: 0x0080, 0x233: 0x0080, 0x234: 0x00c0, 0x235: 0x00c0, + 0x236: 0x00c0, 0x237: 0x00c0, 0x238: 0x00c0, 0x239: 0x00c0, 0x23a: 0x00c0, 0x23b: 0x00c0, + 0x23c: 0x00c0, 0x23d: 0x00c0, 0x23e: 0x00c0, 0x23f: 0x00c0, + // Block 0x9, offset 0x240 + 0x240: 0x00c0, 0x241: 0x00c0, 0x242: 0x00c0, 0x243: 0x00c0, 0x244: 0x00c0, 0x245: 0x00c0, + 0x246: 0x00c0, 0x247: 0x00c0, 0x248: 0x00c0, 0x249: 0x00c0, 0x24a: 0x00c0, 0x24b: 0x00c0, + 0x24c: 0x00c0, 0x24d: 0x00c0, 0x24e: 0x00c0, 0x24f: 0x00c0, 0x250: 0x00c0, 0x251: 0x00c0, + 0x252: 0x00c0, 0x253: 0x00c0, 0x254: 0x00c0, 0x255: 0x00c0, 0x256: 0x00c0, 0x257: 0x00c0, + 0x258: 0x00c0, 0x259: 0x00c0, 0x25a: 0x00c0, 0x25b: 0x00c0, 0x25c: 0x00c0, 0x25d: 0x00c0, + 0x25e: 0x00c0, 0x25f: 0x00c0, 0x260: 0x00c0, 0x261: 0x00c0, 0x262: 0x00c0, 0x263: 0x00c0, + 0x264: 0x00c0, 0x265: 0x00c0, 0x266: 0x00c0, 0x267: 0x00c0, 0x268: 0x00c0, 0x269: 0x00c0, + 0x26a: 0x00c0, 0x26b: 0x00c0, 0x26c: 0x00c0, 0x26d: 0x00c0, 0x26e: 0x00c0, 0x26f: 0x00c0, + 0x270: 0x0080, 0x271: 0x0080, 0x272: 0x0080, 0x273: 0x0080, 0x274: 0x0080, 0x275: 0x0080, + 0x276: 0x0080, 0x277: 0x0080, 0x278: 0x0080, 0x279: 0x00c0, 0x27a: 0x00c0, 0x27b: 0x00c0, + 0x27c: 0x00c0, 0x27d: 0x00c0, 0x27e: 0x00c0, 0x27f: 0x00c0, + // Block 0xa, offset 0x280 + 0x280: 0x00c0, 0x281: 0x00c0, 0x282: 0x0080, 0x283: 0x0080, 0x284: 0x0080, 0x285: 0x0080, + 0x286: 0x00c0, 0x287: 0x00c0, 0x288: 0x00c0, 0x289: 0x00c0, 0x28a: 0x00c0, 0x28b: 0x00c0, + 0x28c: 0x00c0, 0x28d: 0x00c0, 0x28e: 0x00c0, 0x28f: 0x00c0, 0x290: 0x00c0, 0x291: 0x00c0, + 0x292: 0x0080, 0x293: 0x0080, 0x294: 0x0080, 0x295: 0x0080, 0x296: 0x0080, 0x297: 0x0080, + 0x298: 0x0080, 0x299: 0x0080, 0x29a: 0x0080, 0x29b: 0x0080, 0x29c: 0x0080, 0x29d: 0x0080, + 0x29e: 0x0080, 0x29f: 0x0080, 0x2a0: 0x0080, 0x2a1: 0x0080, 0x2a2: 0x0080, 0x2a3: 0x0080, + 0x2a4: 0x0080, 0x2a5: 0x0080, 0x2a6: 0x0080, 0x2a7: 0x0080, 0x2a8: 0x0080, 0x2a9: 0x0080, + 0x2aa: 0x0080, 0x2ab: 0x0080, 0x2ac: 0x00c0, 0x2ad: 0x0080, 0x2ae: 0x00c0, 0x2af: 0x0080, + 0x2b0: 0x0080, 0x2b1: 0x0080, 0x2b2: 0x0080, 0x2b3: 0x0080, 0x2b4: 0x0080, 0x2b5: 0x0080, + 0x2b6: 0x0080, 0x2b7: 0x0080, 0x2b8: 0x0080, 0x2b9: 0x0080, 0x2ba: 0x0080, 0x2bb: 0x0080, + 0x2bc: 0x0080, 0x2bd: 0x0080, 0x2be: 0x0080, 0x2bf: 0x0080, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x00c3, 0x2c1: 0x00c3, 0x2c2: 0x00c3, 0x2c3: 0x00c3, 0x2c4: 0x00c3, 0x2c5: 0x00c3, + 0x2c6: 0x00c3, 0x2c7: 0x00c3, 0x2c8: 0x00c3, 0x2c9: 0x00c3, 0x2ca: 0x00c3, 0x2cb: 0x00c3, + 0x2cc: 0x00c3, 0x2cd: 0x00c3, 0x2ce: 0x00c3, 0x2cf: 0x00c3, 0x2d0: 0x00c3, 0x2d1: 0x00c3, + 0x2d2: 0x00c3, 0x2d3: 0x00c3, 0x2d4: 0x00c3, 0x2d5: 0x00c3, 0x2d6: 0x00c3, 0x2d7: 0x00c3, + 0x2d8: 0x00c3, 0x2d9: 0x00c3, 0x2da: 0x00c3, 0x2db: 0x00c3, 0x2dc: 0x00c3, 0x2dd: 0x00c3, + 0x2de: 0x00c3, 0x2df: 0x00c3, 0x2e0: 0x00c3, 0x2e1: 0x00c3, 0x2e2: 0x00c3, 0x2e3: 0x00c3, + 0x2e4: 0x00c3, 0x2e5: 0x00c3, 0x2e6: 0x00c3, 0x2e7: 0x00c3, 0x2e8: 0x00c3, 0x2e9: 0x00c3, + 0x2ea: 0x00c3, 0x2eb: 0x00c3, 0x2ec: 0x00c3, 0x2ed: 0x00c3, 0x2ee: 0x00c3, 0x2ef: 0x00c3, + 0x2f0: 0x00c3, 0x2f1: 0x00c3, 0x2f2: 0x00c3, 0x2f3: 0x00c3, 0x2f4: 0x00c3, 0x2f5: 0x00c3, + 0x2f6: 0x00c3, 0x2f7: 0x00c3, 0x2f8: 0x00c3, 0x2f9: 0x00c3, 0x2fa: 0x00c3, 0x2fb: 0x00c3, + 0x2fc: 0x00c3, 0x2fd: 0x00c3, 0x2fe: 0x00c3, 0x2ff: 0x00c3, + // Block 0xc, offset 0x300 + 0x300: 0x0083, 0x301: 0x0083, 0x302: 0x00c3, 0x303: 0x0083, 0x304: 0x0083, 0x305: 0x00c3, + 0x306: 0x00c3, 0x307: 0x00c3, 0x308: 0x00c3, 0x309: 0x00c3, 0x30a: 0x00c3, 0x30b: 0x00c3, + 0x30c: 0x00c3, 0x30d: 0x00c3, 0x30e: 0x00c3, 0x30f: 0x0040, 0x310: 0x00c3, 0x311: 0x00c3, + 0x312: 0x00c3, 0x313: 0x00c3, 0x314: 0x00c3, 0x315: 0x00c3, 0x316: 0x00c3, 0x317: 0x00c3, + 0x318: 0x00c3, 0x319: 0x00c3, 0x31a: 0x00c3, 0x31b: 0x00c3, 0x31c: 0x00c3, 0x31d: 0x00c3, + 0x31e: 0x00c3, 0x31f: 0x00c3, 0x320: 0x00c3, 0x321: 0x00c3, 0x322: 0x00c3, 0x323: 0x00c3, + 0x324: 0x00c3, 0x325: 0x00c3, 0x326: 0x00c3, 0x327: 0x00c3, 0x328: 0x00c3, 0x329: 0x00c3, + 0x32a: 0x00c3, 0x32b: 0x00c3, 0x32c: 0x00c3, 0x32d: 0x00c3, 0x32e: 0x00c3, 0x32f: 0x00c3, + 0x330: 0x00c8, 0x331: 0x00c8, 0x332: 0x00c8, 0x333: 0x00c8, 0x334: 0x0080, 0x335: 0x0050, + 0x336: 0x00c8, 0x337: 0x00c8, 0x33a: 0x0088, 0x33b: 0x00c8, + 0x33c: 0x00c8, 0x33d: 0x00c8, 0x33e: 0x0080, 0x33f: 0x00c8, + // Block 0xd, offset 0x340 + 0x344: 0x0088, 0x345: 0x0080, + 0x346: 0x00c8, 0x347: 0x0080, 0x348: 0x00c8, 0x349: 0x00c8, 0x34a: 0x00c8, + 0x34c: 0x00c8, 0x34e: 0x00c8, 0x34f: 0x00c8, 0x350: 0x00c8, 0x351: 0x00c8, + 0x352: 0x00c8, 0x353: 0x00c8, 0x354: 0x00c8, 0x355: 0x00c8, 0x356: 0x00c8, 0x357: 0x00c8, + 0x358: 0x00c8, 0x359: 0x00c8, 0x35a: 0x00c8, 0x35b: 0x00c8, 0x35c: 0x00c8, 0x35d: 0x00c8, + 0x35e: 0x00c8, 0x35f: 0x00c8, 0x360: 0x00c8, 0x361: 0x00c8, 0x363: 0x00c8, + 0x364: 0x00c8, 0x365: 0x00c8, 0x366: 0x00c8, 0x367: 0x00c8, 0x368: 0x00c8, 0x369: 0x00c8, + 0x36a: 0x00c8, 0x36b: 0x00c8, 0x36c: 0x00c8, 0x36d: 0x00c8, 0x36e: 0x00c8, 0x36f: 0x00c8, + 0x370: 0x00c8, 0x371: 0x00c8, 0x372: 0x00c8, 0x373: 0x00c8, 0x374: 0x00c8, 0x375: 0x00c8, + 0x376: 0x00c8, 0x377: 0x00c8, 0x378: 0x00c8, 0x379: 0x00c8, 0x37a: 0x00c8, 0x37b: 0x00c8, + 0x37c: 0x00c8, 0x37d: 0x00c8, 0x37e: 0x00c8, 0x37f: 0x00c8, + // Block 0xe, offset 0x380 + 0x380: 0x00c8, 0x381: 0x00c8, 0x382: 0x00c8, 0x383: 0x00c8, 0x384: 0x00c8, 0x385: 0x00c8, + 0x386: 0x00c8, 0x387: 0x00c8, 0x388: 0x00c8, 0x389: 0x00c8, 0x38a: 0x00c8, 0x38b: 0x00c8, + 0x38c: 0x00c8, 0x38d: 0x00c8, 0x38e: 0x00c8, 0x38f: 0x00c8, 0x390: 0x0088, 0x391: 0x0088, + 0x392: 0x0088, 0x393: 0x0088, 0x394: 0x0088, 0x395: 0x0088, 0x396: 0x0088, 0x397: 0x00c8, + 0x398: 0x00c8, 0x399: 0x00c8, 0x39a: 0x00c8, 0x39b: 0x00c8, 0x39c: 0x00c8, 0x39d: 0x00c8, + 0x39e: 0x00c8, 0x39f: 0x00c8, 0x3a0: 0x00c8, 0x3a1: 0x00c8, 0x3a2: 0x00c0, 0x3a3: 0x00c0, + 0x3a4: 0x00c0, 0x3a5: 0x00c0, 0x3a6: 0x00c0, 0x3a7: 0x00c0, 0x3a8: 0x00c0, 0x3a9: 0x00c0, + 0x3aa: 0x00c0, 0x3ab: 0x00c0, 0x3ac: 0x00c0, 0x3ad: 0x00c0, 0x3ae: 0x00c0, 0x3af: 0x00c0, + 0x3b0: 0x0088, 0x3b1: 0x0088, 0x3b2: 0x0088, 0x3b3: 0x00c8, 0x3b4: 0x0088, 0x3b5: 0x0088, + 0x3b6: 0x0088, 0x3b7: 0x00c8, 0x3b8: 0x00c8, 0x3b9: 0x0088, 0x3ba: 0x00c8, 0x3bb: 0x00c8, + 0x3bc: 0x00c8, 0x3bd: 0x00c8, 0x3be: 0x00c8, 0x3bf: 0x00c8, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x00c0, 0x3c1: 0x00c0, 0x3c2: 0x0080, 0x3c3: 0x00c3, 0x3c4: 0x00c3, 0x3c5: 0x00c3, + 0x3c6: 0x00c3, 0x3c7: 0x00c3, 0x3c8: 0x0083, 0x3c9: 0x0083, 0x3ca: 0x00c0, 0x3cb: 0x00c0, + 0x3cc: 0x00c0, 0x3cd: 0x00c0, 0x3ce: 0x00c0, 0x3cf: 0x00c0, 0x3d0: 0x00c0, 0x3d1: 0x00c0, + 0x3d2: 0x00c0, 0x3d3: 0x00c0, 0x3d4: 0x00c0, 0x3d5: 0x00c0, 0x3d6: 0x00c0, 0x3d7: 0x00c0, + 0x3d8: 0x00c0, 0x3d9: 0x00c0, 0x3da: 0x00c0, 0x3db: 0x00c0, 0x3dc: 0x00c0, 0x3dd: 0x00c0, + 0x3de: 0x00c0, 0x3df: 0x00c0, 0x3e0: 0x00c0, 0x3e1: 0x00c0, 0x3e2: 0x00c0, 0x3e3: 0x00c0, + 0x3e4: 0x00c0, 0x3e5: 0x00c0, 0x3e6: 0x00c0, 0x3e7: 0x00c0, 0x3e8: 0x00c0, 0x3e9: 0x00c0, + 0x3ea: 0x00c0, 0x3eb: 0x00c0, 0x3ec: 0x00c0, 0x3ed: 0x00c0, 0x3ee: 0x00c0, 0x3ef: 0x00c0, + 0x3f0: 0x00c0, 0x3f1: 0x00c0, 0x3f2: 0x00c0, 0x3f3: 0x00c0, 0x3f4: 0x00c0, 0x3f5: 0x00c0, + 0x3f6: 0x00c0, 0x3f7: 0x00c0, 0x3f8: 0x00c0, 0x3f9: 0x00c0, 0x3fa: 0x00c0, 0x3fb: 0x00c0, + 0x3fc: 0x00c0, 0x3fd: 0x00c0, 0x3fe: 0x00c0, 0x3ff: 0x00c0, + // Block 0x10, offset 0x400 + 0x400: 0x00c0, 0x401: 0x00c0, 0x402: 0x00c0, 0x403: 0x00c0, 0x404: 0x00c0, 0x405: 0x00c0, + 0x406: 0x00c0, 0x407: 0x00c0, 0x408: 0x00c0, 0x409: 0x00c0, 0x40a: 0x00c0, 0x40b: 0x00c0, + 0x40c: 0x00c0, 0x40d: 0x00c0, 0x40e: 0x00c0, 0x40f: 0x00c0, 0x410: 0x00c0, 0x411: 0x00c0, + 0x412: 0x00c0, 0x413: 0x00c0, 0x414: 0x00c0, 0x415: 0x00c0, 0x416: 0x00c0, 0x417: 0x00c0, + 0x418: 0x00c0, 0x419: 0x00c0, 0x41a: 0x00c0, 0x41b: 0x00c0, 0x41c: 0x00c0, 0x41d: 0x00c0, + 0x41e: 0x00c0, 0x41f: 0x00c0, 0x420: 0x00c0, 0x421: 0x00c0, 0x422: 0x00c0, 0x423: 0x00c0, + 0x424: 0x00c0, 0x425: 0x00c0, 0x426: 0x00c0, 0x427: 0x00c0, 0x428: 0x00c0, 0x429: 0x00c0, + 0x42a: 0x00c0, 0x42b: 0x00c0, 0x42c: 0x00c0, 0x42d: 0x00c0, 0x42e: 0x00c0, 0x42f: 0x00c0, + 0x431: 0x00c0, 0x432: 0x00c0, 0x433: 0x00c0, 0x434: 0x00c0, 0x435: 0x00c0, + 0x436: 0x00c0, 0x437: 0x00c0, 0x438: 0x00c0, 0x439: 0x00c0, 0x43a: 0x00c0, 0x43b: 0x00c0, + 0x43c: 0x00c0, 0x43d: 0x00c0, 0x43e: 0x00c0, 0x43f: 0x00c0, + // Block 0x11, offset 0x440 + 0x440: 0x00c0, 0x441: 0x00c0, 0x442: 0x00c0, 0x443: 0x00c0, 0x444: 0x00c0, 0x445: 0x00c0, + 0x446: 0x00c0, 0x447: 0x00c0, 0x448: 0x00c0, 0x449: 0x00c0, 0x44a: 0x00c0, 0x44b: 0x00c0, + 0x44c: 0x00c0, 0x44d: 0x00c0, 0x44e: 0x00c0, 0x44f: 0x00c0, 0x450: 0x00c0, 0x451: 0x00c0, + 0x452: 0x00c0, 0x453: 0x00c0, 0x454: 0x00c0, 0x455: 0x00c0, 0x456: 0x00c0, + 0x459: 0x00c0, 0x45a: 0x0080, 0x45b: 0x0080, 0x45c: 0x0080, 0x45d: 0x0080, + 0x45e: 0x0080, 0x45f: 0x0080, 0x461: 0x00c0, 0x462: 0x00c0, 0x463: 0x00c0, + 0x464: 0x00c0, 0x465: 0x00c0, 0x466: 0x00c0, 0x467: 0x00c0, 0x468: 0x00c0, 0x469: 0x00c0, + 0x46a: 0x00c0, 0x46b: 0x00c0, 0x46c: 0x00c0, 0x46d: 0x00c0, 0x46e: 0x00c0, 0x46f: 0x00c0, + 0x470: 0x00c0, 0x471: 0x00c0, 0x472: 0x00c0, 0x473: 0x00c0, 0x474: 0x00c0, 0x475: 0x00c0, + 0x476: 0x00c0, 0x477: 0x00c0, 0x478: 0x00c0, 0x479: 0x00c0, 0x47a: 0x00c0, 0x47b: 0x00c0, + 0x47c: 0x00c0, 0x47d: 0x00c0, 0x47e: 0x00c0, 0x47f: 0x00c0, + // Block 0x12, offset 0x480 + 0x480: 0x00c0, 0x481: 0x00c0, 0x482: 0x00c0, 0x483: 0x00c0, 0x484: 0x00c0, 0x485: 0x00c0, + 0x486: 0x00c0, 0x487: 0x0080, 0x489: 0x0080, 0x48a: 0x0080, + 0x48d: 0x0080, 0x48e: 0x0080, 0x48f: 0x0080, 0x491: 0x00cb, + 0x492: 0x00cb, 0x493: 0x00cb, 0x494: 0x00cb, 0x495: 0x00cb, 0x496: 0x00cb, 0x497: 0x00cb, + 0x498: 0x00cb, 0x499: 0x00cb, 0x49a: 0x00cb, 0x49b: 0x00cb, 0x49c: 0x00cb, 0x49d: 0x00cb, + 0x49e: 0x00cb, 0x49f: 0x00cb, 0x4a0: 0x00cb, 0x4a1: 0x00cb, 0x4a2: 0x00cb, 0x4a3: 0x00cb, + 0x4a4: 0x00cb, 0x4a5: 0x00cb, 0x4a6: 0x00cb, 0x4a7: 0x00cb, 0x4a8: 0x00cb, 0x4a9: 0x00cb, + 0x4aa: 0x00cb, 0x4ab: 0x00cb, 0x4ac: 0x00cb, 0x4ad: 0x00cb, 0x4ae: 0x00cb, 0x4af: 0x00cb, + 0x4b0: 0x00cb, 0x4b1: 0x00cb, 0x4b2: 0x00cb, 0x4b3: 0x00cb, 0x4b4: 0x00cb, 0x4b5: 0x00cb, + 0x4b6: 0x00cb, 0x4b7: 0x00cb, 0x4b8: 0x00cb, 0x4b9: 0x00cb, 0x4ba: 0x00cb, 0x4bb: 0x00cb, + 0x4bc: 0x00cb, 0x4bd: 0x00cb, 0x4be: 0x008a, 0x4bf: 0x00cb, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x008a, 0x4c1: 0x00cb, 0x4c2: 0x00cb, 0x4c3: 0x008a, 0x4c4: 0x00cb, 0x4c5: 0x00cb, + 0x4c6: 0x008a, 0x4c7: 0x00cb, + 0x4d0: 0x00ca, 0x4d1: 0x00ca, + 0x4d2: 0x00ca, 0x4d3: 0x00ca, 0x4d4: 0x00ca, 0x4d5: 0x00ca, 0x4d6: 0x00ca, 0x4d7: 0x00ca, + 0x4d8: 0x00ca, 0x4d9: 0x00ca, 0x4da: 0x00ca, 0x4db: 0x00ca, 0x4dc: 0x00ca, 0x4dd: 0x00ca, + 0x4de: 0x00ca, 0x4df: 0x00ca, 0x4e0: 0x00ca, 0x4e1: 0x00ca, 0x4e2: 0x00ca, 0x4e3: 0x00ca, + 0x4e4: 0x00ca, 0x4e5: 0x00ca, 0x4e6: 0x00ca, 0x4e7: 0x00ca, 0x4e8: 0x00ca, 0x4e9: 0x00ca, + 0x4ea: 0x00ca, + 0x4f0: 0x00ca, 0x4f1: 0x00ca, 0x4f2: 0x00ca, 0x4f3: 0x0051, 0x4f4: 0x0051, + // Block 0x14, offset 0x500 + 0x500: 0x0040, 0x501: 0x0040, 0x502: 0x0040, 0x503: 0x0040, 0x504: 0x0040, 0x505: 0x0040, + 0x506: 0x0080, 0x507: 0x0080, 0x508: 0x0080, 0x509: 0x0080, 0x50a: 0x0080, 0x50b: 0x0080, + 0x50c: 0x0080, 0x50d: 0x0080, 0x50e: 0x0080, 0x50f: 0x0080, 0x510: 0x00c3, 0x511: 0x00c3, + 0x512: 0x00c3, 0x513: 0x00c3, 0x514: 0x00c3, 0x515: 0x00c3, 0x516: 0x00c3, 0x517: 0x00c3, + 0x518: 0x00c3, 0x519: 0x00c3, 0x51a: 0x00c3, 0x51b: 0x0080, 0x51c: 0x0040, + 0x51e: 0x0080, 0x51f: 0x0080, 0x520: 0x00c2, 0x521: 0x00c0, 0x522: 0x00c4, 0x523: 0x00c4, + 0x524: 0x00c4, 0x525: 0x00c4, 0x526: 0x00c2, 0x527: 0x00c4, 0x528: 0x00c2, 0x529: 0x00c4, + 0x52a: 0x00c2, 0x52b: 0x00c2, 0x52c: 0x00c2, 0x52d: 0x00c2, 0x52e: 0x00c2, 0x52f: 0x00c4, + 0x530: 0x00c4, 0x531: 0x00c4, 0x532: 0x00c4, 0x533: 0x00c2, 0x534: 0x00c2, 0x535: 0x00c2, + 0x536: 0x00c2, 0x537: 0x00c2, 0x538: 0x00c2, 0x539: 0x00c2, 0x53a: 0x00c2, 0x53b: 0x00c2, + 0x53c: 0x00c2, 0x53d: 0x00c2, 0x53e: 0x00c2, 0x53f: 0x00c2, + // Block 0x15, offset 0x540 + 0x540: 0x0040, 0x541: 0x00c2, 0x542: 0x00c2, 0x543: 0x00c2, 0x544: 0x00c2, 0x545: 0x00c2, + 0x546: 0x00c2, 0x547: 0x00c2, 0x548: 0x00c4, 0x549: 0x00c2, 0x54a: 0x00c2, 0x54b: 0x00c3, + 0x54c: 0x00c3, 0x54d: 0x00c3, 0x54e: 0x00c3, 0x54f: 0x00c3, 0x550: 0x00c3, 0x551: 0x00c3, + 0x552: 0x00c3, 0x553: 0x00c3, 0x554: 0x00c3, 0x555: 0x00c3, 0x556: 0x00c3, 0x557: 0x00c3, + 0x558: 0x00c3, 0x559: 0x00c3, 0x55a: 0x00c3, 0x55b: 0x00c3, 0x55c: 0x00c3, 0x55d: 0x00c3, + 0x55e: 0x00c3, 0x55f: 0x00c3, 0x560: 0x0053, 0x561: 0x0053, 0x562: 0x0053, 0x563: 0x0053, + 0x564: 0x0053, 0x565: 0x0053, 0x566: 0x0053, 0x567: 0x0053, 0x568: 0x0053, 0x569: 0x0053, + 0x56a: 0x0080, 0x56b: 0x0080, 0x56c: 0x0080, 0x56d: 0x0080, 0x56e: 0x00c2, 0x56f: 0x00c2, + 0x570: 0x00c3, 0x571: 0x00c4, 0x572: 0x00c4, 0x573: 0x00c4, 0x574: 0x00c0, 0x575: 0x0084, + 0x576: 0x0084, 0x577: 0x0084, 0x578: 0x0082, 0x579: 0x00c2, 0x57a: 0x00c2, 0x57b: 0x00c2, + 0x57c: 0x00c2, 0x57d: 0x00c2, 0x57e: 0x00c2, 0x57f: 0x00c2, + // Block 0x16, offset 0x580 + 0x580: 0x00c2, 0x581: 0x00c2, 0x582: 0x00c2, 0x583: 0x00c2, 0x584: 0x00c2, 0x585: 0x00c2, + 0x586: 0x00c2, 0x587: 0x00c2, 0x588: 0x00c4, 0x589: 0x00c4, 0x58a: 0x00c4, 0x58b: 0x00c4, + 0x58c: 0x00c4, 0x58d: 0x00c4, 0x58e: 0x00c4, 0x58f: 0x00c4, 0x590: 0x00c4, 0x591: 0x00c4, + 0x592: 0x00c4, 0x593: 0x00c4, 0x594: 0x00c4, 0x595: 0x00c4, 0x596: 0x00c4, 0x597: 0x00c4, + 0x598: 0x00c4, 0x599: 0x00c4, 0x59a: 0x00c2, 0x59b: 0x00c2, 0x59c: 0x00c2, 0x59d: 0x00c2, + 0x59e: 0x00c2, 0x59f: 0x00c2, 0x5a0: 0x00c2, 0x5a1: 0x00c2, 0x5a2: 0x00c2, 0x5a3: 0x00c2, + 0x5a4: 0x00c2, 0x5a5: 0x00c2, 0x5a6: 0x00c2, 0x5a7: 0x00c2, 0x5a8: 0x00c2, 0x5a9: 0x00c2, + 0x5aa: 0x00c2, 0x5ab: 0x00c2, 0x5ac: 0x00c2, 0x5ad: 0x00c2, 0x5ae: 0x00c2, 0x5af: 0x00c2, + 0x5b0: 0x00c2, 0x5b1: 0x00c2, 0x5b2: 0x00c2, 0x5b3: 0x00c2, 0x5b4: 0x00c2, 0x5b5: 0x00c2, + 0x5b6: 0x00c2, 0x5b7: 0x00c2, 0x5b8: 0x00c2, 0x5b9: 0x00c2, 0x5ba: 0x00c2, 0x5bb: 0x00c2, + 0x5bc: 0x00c2, 0x5bd: 0x00c2, 0x5be: 0x00c2, 0x5bf: 0x00c2, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x00c4, 0x5c1: 0x00c2, 0x5c2: 0x00c2, 0x5c3: 0x00c4, 0x5c4: 0x00c4, 0x5c5: 0x00c4, + 0x5c6: 0x00c4, 0x5c7: 0x00c4, 0x5c8: 0x00c4, 0x5c9: 0x00c4, 0x5ca: 0x00c4, 0x5cb: 0x00c4, + 0x5cc: 0x00c2, 0x5cd: 0x00c4, 0x5ce: 0x00c2, 0x5cf: 0x00c4, 0x5d0: 0x00c2, 0x5d1: 0x00c2, + 0x5d2: 0x00c4, 0x5d3: 0x00c4, 0x5d4: 0x0080, 0x5d5: 0x00c4, 0x5d6: 0x00c3, 0x5d7: 0x00c3, + 0x5d8: 0x00c3, 0x5d9: 0x00c3, 0x5da: 0x00c3, 0x5db: 0x00c3, 0x5dc: 0x00c3, 0x5dd: 0x0040, + 0x5de: 0x0080, 0x5df: 0x00c3, 0x5e0: 0x00c3, 0x5e1: 0x00c3, 0x5e2: 0x00c3, 0x5e3: 0x00c3, + 0x5e4: 0x00c3, 0x5e5: 0x00c0, 0x5e6: 0x00c0, 0x5e7: 0x00c3, 0x5e8: 0x00c3, 0x5e9: 0x0080, + 0x5ea: 0x00c3, 0x5eb: 0x00c3, 0x5ec: 0x00c3, 0x5ed: 0x00c3, 0x5ee: 0x00c4, 0x5ef: 0x00c4, + 0x5f0: 0x0054, 0x5f1: 0x0054, 0x5f2: 0x0054, 0x5f3: 0x0054, 0x5f4: 0x0054, 0x5f5: 0x0054, + 0x5f6: 0x0054, 0x5f7: 0x0054, 0x5f8: 0x0054, 0x5f9: 0x0054, 0x5fa: 0x00c2, 0x5fb: 0x00c2, + 0x5fc: 0x00c2, 0x5fd: 0x00c0, 0x5fe: 0x00c0, 0x5ff: 0x00c2, + // Block 0x18, offset 0x600 + 0x600: 0x0080, 0x601: 0x0080, 0x602: 0x0080, 0x603: 0x0080, 0x604: 0x0080, 0x605: 0x0080, + 0x606: 0x0080, 0x607: 0x0080, 0x608: 0x0080, 0x609: 0x0080, 0x60a: 0x0080, 0x60b: 0x0080, + 0x60c: 0x0080, 0x60d: 0x0080, 0x60f: 0x0040, 0x610: 0x00c4, 0x611: 0x00c3, + 0x612: 0x00c2, 0x613: 0x00c2, 0x614: 0x00c2, 0x615: 0x00c4, 0x616: 0x00c4, 0x617: 0x00c4, + 0x618: 0x00c4, 0x619: 0x00c4, 0x61a: 0x00c2, 0x61b: 0x00c2, 0x61c: 0x00c2, 0x61d: 0x00c2, + 0x61e: 0x00c4, 0x61f: 0x00c2, 0x620: 0x00c2, 0x621: 0x00c2, 0x622: 0x00c2, 0x623: 0x00c2, + 0x624: 0x00c2, 0x625: 0x00c2, 0x626: 0x00c2, 0x627: 0x00c2, 0x628: 0x00c4, 0x629: 0x00c2, + 0x62a: 0x00c4, 0x62b: 0x00c2, 0x62c: 0x00c4, 0x62d: 0x00c2, 0x62e: 0x00c2, 0x62f: 0x00c4, + 0x630: 0x00c3, 0x631: 0x00c3, 0x632: 0x00c3, 0x633: 0x00c3, 0x634: 0x00c3, 0x635: 0x00c3, + 0x636: 0x00c3, 0x637: 0x00c3, 0x638: 0x00c3, 0x639: 0x00c3, 0x63a: 0x00c3, 0x63b: 0x00c3, + 0x63c: 0x00c3, 0x63d: 0x00c3, 0x63e: 0x00c3, 0x63f: 0x00c3, + // Block 0x19, offset 0x640 + 0x640: 0x00c3, 0x641: 0x00c3, 0x642: 0x00c3, 0x643: 0x00c3, 0x644: 0x00c3, 0x645: 0x00c3, + 0x646: 0x00c3, 0x647: 0x00c3, 0x648: 0x00c3, 0x649: 0x00c3, 0x64a: 0x00c3, + 0x64d: 0x00c4, 0x64e: 0x00c2, 0x64f: 0x00c2, 0x650: 0x00c2, 0x651: 0x00c2, + 0x652: 0x00c2, 0x653: 0x00c2, 0x654: 0x00c2, 0x655: 0x00c2, 0x656: 0x00c2, 0x657: 0x00c2, + 0x658: 0x00c2, 0x659: 0x00c4, 0x65a: 0x00c4, 0x65b: 0x00c4, 0x65c: 0x00c2, 0x65d: 0x00c2, + 0x65e: 0x00c2, 0x65f: 0x00c2, 0x660: 0x00c2, 0x661: 0x00c2, 0x662: 0x00c2, 0x663: 0x00c2, + 0x664: 0x00c2, 0x665: 0x00c2, 0x666: 0x00c2, 0x667: 0x00c2, 0x668: 0x00c2, 0x669: 0x00c2, + 0x66a: 0x00c2, 0x66b: 0x00c4, 0x66c: 0x00c4, 0x66d: 0x00c2, 0x66e: 0x00c2, 0x66f: 0x00c2, + 0x670: 0x00c2, 0x671: 0x00c4, 0x672: 0x00c2, 0x673: 0x00c4, 0x674: 0x00c4, 0x675: 0x00c2, + 0x676: 0x00c2, 0x677: 0x00c2, 0x678: 0x00c4, 0x679: 0x00c4, 0x67a: 0x00c2, 0x67b: 0x00c2, + 0x67c: 0x00c2, 0x67d: 0x00c2, 0x67e: 0x00c2, 0x67f: 0x00c2, + // Block 0x1a, offset 0x680 + 0x680: 0x00c0, 0x681: 0x00c0, 0x682: 0x00c0, 0x683: 0x00c0, 0x684: 0x00c0, 0x685: 0x00c0, + 0x686: 0x00c0, 0x687: 0x00c0, 0x688: 0x00c0, 0x689: 0x00c0, 0x68a: 0x00c0, 0x68b: 0x00c0, + 0x68c: 0x00c0, 0x68d: 0x00c0, 0x68e: 0x00c0, 0x68f: 0x00c0, 0x690: 0x00c0, 0x691: 0x00c0, + 0x692: 0x00c0, 0x693: 0x00c0, 0x694: 0x00c0, 0x695: 0x00c0, 0x696: 0x00c0, 0x697: 0x00c0, + 0x698: 0x00c0, 0x699: 0x00c0, 0x69a: 0x00c0, 0x69b: 0x00c0, 0x69c: 0x00c0, 0x69d: 0x00c0, + 0x69e: 0x00c0, 0x69f: 0x00c0, 0x6a0: 0x00c0, 0x6a1: 0x00c0, 0x6a2: 0x00c0, 0x6a3: 0x00c0, + 0x6a4: 0x00c0, 0x6a5: 0x00c0, 0x6a6: 0x00c3, 0x6a7: 0x00c3, 0x6a8: 0x00c3, 0x6a9: 0x00c3, + 0x6aa: 0x00c3, 0x6ab: 0x00c3, 0x6ac: 0x00c3, 0x6ad: 0x00c3, 0x6ae: 0x00c3, 0x6af: 0x00c3, + 0x6b0: 0x00c3, 0x6b1: 0x00c0, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x00c0, 0x6c1: 0x00c0, 0x6c2: 0x00c0, 0x6c3: 0x00c0, 0x6c4: 0x00c0, 0x6c5: 0x00c0, + 0x6c6: 0x00c0, 0x6c7: 0x00c0, 0x6c8: 0x00c0, 0x6c9: 0x00c0, 0x6ca: 0x00c2, 0x6cb: 0x00c2, + 0x6cc: 0x00c2, 0x6cd: 0x00c2, 0x6ce: 0x00c2, 0x6cf: 0x00c2, 0x6d0: 0x00c2, 0x6d1: 0x00c2, + 0x6d2: 0x00c2, 0x6d3: 0x00c2, 0x6d4: 0x00c2, 0x6d5: 0x00c2, 0x6d6: 0x00c2, 0x6d7: 0x00c2, + 0x6d8: 0x00c2, 0x6d9: 0x00c2, 0x6da: 0x00c2, 0x6db: 0x00c2, 0x6dc: 0x00c2, 0x6dd: 0x00c2, + 0x6de: 0x00c2, 0x6df: 0x00c2, 0x6e0: 0x00c2, 0x6e1: 0x00c2, 0x6e2: 0x00c2, 0x6e3: 0x00c2, + 0x6e4: 0x00c2, 0x6e5: 0x00c2, 0x6e6: 0x00c2, 0x6e7: 0x00c2, 0x6e8: 0x00c2, 0x6e9: 0x00c2, + 0x6ea: 0x00c2, 0x6eb: 0x00c3, 0x6ec: 0x00c3, 0x6ed: 0x00c3, 0x6ee: 0x00c3, 0x6ef: 0x00c3, + 0x6f0: 0x00c3, 0x6f1: 0x00c3, 0x6f2: 0x00c3, 0x6f3: 0x00c3, 0x6f4: 0x00c0, 0x6f5: 0x00c0, + 0x6f6: 0x0080, 0x6f7: 0x0080, 0x6f8: 0x0080, 0x6f9: 0x0080, 0x6fa: 0x0040, + // Block 0x1c, offset 0x700 + 0x700: 0x00c0, 0x701: 0x00c0, 0x702: 0x00c0, 0x703: 0x00c0, 0x704: 0x00c0, 0x705: 0x00c0, + 0x706: 0x00c0, 0x707: 0x00c0, 0x708: 0x00c0, 0x709: 0x00c0, 0x70a: 0x00c0, 0x70b: 0x00c0, + 0x70c: 0x00c0, 0x70d: 0x00c0, 0x70e: 0x00c0, 0x70f: 0x00c0, 0x710: 0x00c0, 0x711: 0x00c0, + 0x712: 0x00c0, 0x713: 0x00c0, 0x714: 0x00c0, 0x715: 0x00c0, 0x716: 0x00c3, 0x717: 0x00c3, + 0x718: 0x00c3, 0x719: 0x00c3, 0x71a: 0x00c0, 0x71b: 0x00c3, 0x71c: 0x00c3, 0x71d: 0x00c3, + 0x71e: 0x00c3, 0x71f: 0x00c3, 0x720: 0x00c3, 0x721: 0x00c3, 0x722: 0x00c3, 0x723: 0x00c3, + 0x724: 0x00c0, 0x725: 0x00c3, 0x726: 0x00c3, 0x727: 0x00c3, 0x728: 0x00c0, 0x729: 0x00c3, + 0x72a: 0x00c3, 0x72b: 0x00c3, 0x72c: 0x00c3, 0x72d: 0x00c3, + 0x730: 0x0080, 0x731: 0x0080, 0x732: 0x0080, 0x733: 0x0080, 0x734: 0x0080, 0x735: 0x0080, + 0x736: 0x0080, 0x737: 0x0080, 0x738: 0x0080, 0x739: 0x0080, 0x73a: 0x0080, 0x73b: 0x0080, + 0x73c: 0x0080, 0x73d: 0x0080, 0x73e: 0x0080, + // Block 0x1d, offset 0x740 + 0x740: 0x00c4, 0x741: 0x00c2, 0x742: 0x00c2, 0x743: 0x00c2, 0x744: 0x00c2, 0x745: 0x00c2, + 0x746: 0x00c4, 0x747: 0x00c4, 0x748: 0x00c2, 0x749: 0x00c4, 0x74a: 0x00c2, 0x74b: 0x00c2, + 0x74c: 0x00c2, 0x74d: 0x00c2, 0x74e: 0x00c2, 0x74f: 0x00c2, 0x750: 0x00c2, 0x751: 0x00c2, + 0x752: 0x00c2, 0x753: 0x00c2, 0x754: 0x00c4, 0x755: 0x00c2, 0x756: 0x00c0, 0x757: 0x00c0, + 0x758: 0x00c0, 0x759: 0x00c3, 0x75a: 0x00c3, 0x75b: 0x00c3, + 0x75e: 0x0080, + // Block 0x1e, offset 0x780 + 0x7a0: 0x00c2, 0x7a1: 0x00c2, 0x7a2: 0x00c2, 0x7a3: 0x00c2, + 0x7a4: 0x00c2, 0x7a5: 0x00c2, 0x7a6: 0x00c2, 0x7a7: 0x00c2, 0x7a8: 0x00c2, 0x7a9: 0x00c2, + 0x7aa: 0x00c4, 0x7ab: 0x00c4, 0x7ac: 0x00c4, 0x7ad: 0x00c0, 0x7ae: 0x00c4, 0x7af: 0x00c2, + 0x7b0: 0x00c2, 0x7b1: 0x00c4, 0x7b2: 0x00c4, 0x7b3: 0x00c2, 0x7b4: 0x00c2, + 0x7b6: 0x00c2, 0x7b7: 0x00c2, 0x7b8: 0x00c2, 0x7b9: 0x00c4, 0x7ba: 0x00c2, 0x7bb: 0x00c2, + 0x7bc: 0x00c2, 0x7bd: 0x00c2, + // Block 0x1f, offset 0x7c0 + 0x7d4: 0x00c3, 0x7d5: 0x00c3, 0x7d6: 0x00c3, 0x7d7: 0x00c3, + 0x7d8: 0x00c3, 0x7d9: 0x00c3, 0x7da: 0x00c3, 0x7db: 0x00c3, 0x7dc: 0x00c3, 0x7dd: 0x00c3, + 0x7de: 0x00c3, 0x7df: 0x00c3, 0x7e0: 0x00c3, 0x7e1: 0x00c3, 0x7e2: 0x0040, 0x7e3: 0x00c3, + 0x7e4: 0x00c3, 0x7e5: 0x00c3, 0x7e6: 0x00c3, 0x7e7: 0x00c3, 0x7e8: 0x00c3, 0x7e9: 0x00c3, + 0x7ea: 0x00c3, 0x7eb: 0x00c3, 0x7ec: 0x00c3, 0x7ed: 0x00c3, 0x7ee: 0x00c3, 0x7ef: 0x00c3, + 0x7f0: 0x00c3, 0x7f1: 0x00c3, 0x7f2: 0x00c3, 0x7f3: 0x00c3, 0x7f4: 0x00c3, 0x7f5: 0x00c3, + 0x7f6: 0x00c3, 0x7f7: 0x00c3, 0x7f8: 0x00c3, 0x7f9: 0x00c3, 0x7fa: 0x00c3, 0x7fb: 0x00c3, + 0x7fc: 0x00c3, 0x7fd: 0x00c3, 0x7fe: 0x00c3, 0x7ff: 0x00c3, + // Block 0x20, offset 0x800 + 0x800: 0x00c3, 0x801: 0x00c3, 0x802: 0x00c3, 0x803: 0x00c0, 0x804: 0x00c0, 0x805: 0x00c0, + 0x806: 0x00c0, 0x807: 0x00c0, 0x808: 0x00c0, 0x809: 0x00c0, 0x80a: 0x00c0, 0x80b: 0x00c0, + 0x80c: 0x00c0, 0x80d: 0x00c0, 0x80e: 0x00c0, 0x80f: 0x00c0, 0x810: 0x00c0, 0x811: 0x00c0, + 0x812: 0x00c0, 0x813: 0x00c0, 0x814: 0x00c0, 0x815: 0x00c0, 0x816: 0x00c0, 0x817: 0x00c0, + 0x818: 0x00c0, 0x819: 0x00c0, 0x81a: 0x00c0, 0x81b: 0x00c0, 0x81c: 0x00c0, 0x81d: 0x00c0, + 0x81e: 0x00c0, 0x81f: 0x00c0, 0x820: 0x00c0, 0x821: 0x00c0, 0x822: 0x00c0, 0x823: 0x00c0, + 0x824: 0x00c0, 0x825: 0x00c0, 0x826: 0x00c0, 0x827: 0x00c0, 0x828: 0x00c0, 0x829: 0x00c0, + 0x82a: 0x00c0, 0x82b: 0x00c0, 0x82c: 0x00c0, 0x82d: 0x00c0, 0x82e: 0x00c0, 0x82f: 0x00c0, + 0x830: 0x00c0, 0x831: 0x00c0, 0x832: 0x00c0, 0x833: 0x00c0, 0x834: 0x00c0, 0x835: 0x00c0, + 0x836: 0x00c0, 0x837: 0x00c0, 0x838: 0x00c0, 0x839: 0x00c0, 0x83a: 0x00c3, 0x83b: 0x00c0, + 0x83c: 0x00c3, 0x83d: 0x00c0, 0x83e: 0x00c0, 0x83f: 0x00c0, + // Block 0x21, offset 0x840 + 0x840: 0x00c0, 0x841: 0x00c3, 0x842: 0x00c3, 0x843: 0x00c3, 0x844: 0x00c3, 0x845: 0x00c3, + 0x846: 0x00c3, 0x847: 0x00c3, 0x848: 0x00c3, 0x849: 0x00c0, 0x84a: 0x00c0, 0x84b: 0x00c0, + 0x84c: 0x00c0, 0x84d: 0x00c6, 0x84e: 0x00c0, 0x84f: 0x00c0, 0x850: 0x00c0, 0x851: 0x00c3, + 0x852: 0x00c3, 0x853: 0x00c3, 0x854: 0x00c3, 0x855: 0x00c3, 0x856: 0x00c3, 0x857: 0x00c3, + 0x858: 0x0080, 0x859: 0x0080, 0x85a: 0x0080, 0x85b: 0x0080, 0x85c: 0x0080, 0x85d: 0x0080, + 0x85e: 0x0080, 0x85f: 0x0080, 0x860: 0x00c0, 0x861: 0x00c0, 0x862: 0x00c3, 0x863: 0x00c3, + 0x864: 0x0080, 0x865: 0x0080, 0x866: 0x00c0, 0x867: 0x00c0, 0x868: 0x00c0, 0x869: 0x00c0, + 0x86a: 0x00c0, 0x86b: 0x00c0, 0x86c: 0x00c0, 0x86d: 0x00c0, 0x86e: 0x00c0, 0x86f: 0x00c0, + 0x870: 0x0080, 0x871: 0x00c0, 0x872: 0x00c0, 0x873: 0x00c0, 0x874: 0x00c0, 0x875: 0x00c0, + 0x876: 0x00c0, 0x877: 0x00c0, 0x878: 0x00c0, 0x879: 0x00c0, 0x87a: 0x00c0, 0x87b: 0x00c0, + 0x87c: 0x00c0, 0x87d: 0x00c0, 0x87e: 0x00c0, 0x87f: 0x00c0, + // Block 0x22, offset 0x880 + 0x880: 0x00c0, 0x881: 0x00c3, 0x882: 0x00c0, 0x883: 0x00c0, 0x885: 0x00c0, + 0x886: 0x00c0, 0x887: 0x00c0, 0x888: 0x00c0, 0x889: 0x00c0, 0x88a: 0x00c0, 0x88b: 0x00c0, + 0x88c: 0x00c0, 0x88f: 0x00c0, 0x890: 0x00c0, + 0x893: 0x00c0, 0x894: 0x00c0, 0x895: 0x00c0, 0x896: 0x00c0, 0x897: 0x00c0, + 0x898: 0x00c0, 0x899: 0x00c0, 0x89a: 0x00c0, 0x89b: 0x00c0, 0x89c: 0x00c0, 0x89d: 0x00c0, + 0x89e: 0x00c0, 0x89f: 0x00c0, 0x8a0: 0x00c0, 0x8a1: 0x00c0, 0x8a2: 0x00c0, 0x8a3: 0x00c0, + 0x8a4: 0x00c0, 0x8a5: 0x00c0, 0x8a6: 0x00c0, 0x8a7: 0x00c0, 0x8a8: 0x00c0, + 0x8aa: 0x00c0, 0x8ab: 0x00c0, 0x8ac: 0x00c0, 0x8ad: 0x00c0, 0x8ae: 0x00c0, 0x8af: 0x00c0, + 0x8b0: 0x00c0, 0x8b2: 0x00c0, + 0x8b6: 0x00c0, 0x8b7: 0x00c0, 0x8b8: 0x00c0, 0x8b9: 0x00c0, + 0x8bc: 0x00c3, 0x8bd: 0x00c0, 0x8be: 0x00c0, 0x8bf: 0x00c0, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x00c0, 0x8c1: 0x00c3, 0x8c2: 0x00c3, 0x8c3: 0x00c3, 0x8c4: 0x00c3, + 0x8c7: 0x00c0, 0x8c8: 0x00c0, 0x8cb: 0x00c0, + 0x8cc: 0x00c0, 0x8cd: 0x00c6, 0x8ce: 0x00c0, + 0x8d7: 0x00c0, + 0x8dc: 0x0080, 0x8dd: 0x0080, + 0x8df: 0x0080, 0x8e0: 0x00c0, 0x8e1: 0x00c0, 0x8e2: 0x00c3, 0x8e3: 0x00c3, + 0x8e6: 0x00c0, 0x8e7: 0x00c0, 0x8e8: 0x00c0, 0x8e9: 0x00c0, + 0x8ea: 0x00c0, 0x8eb: 0x00c0, 0x8ec: 0x00c0, 0x8ed: 0x00c0, 0x8ee: 0x00c0, 0x8ef: 0x00c0, + 0x8f0: 0x00c0, 0x8f1: 0x00c0, 0x8f2: 0x0080, 0x8f3: 0x0080, 0x8f4: 0x0080, 0x8f5: 0x0080, + 0x8f6: 0x0080, 0x8f7: 0x0080, 0x8f8: 0x0080, 0x8f9: 0x0080, 0x8fa: 0x0080, 0x8fb: 0x0080, + // Block 0x24, offset 0x900 + 0x901: 0x00c3, 0x902: 0x00c3, 0x903: 0x00c0, 0x905: 0x00c0, + 0x906: 0x00c0, 0x907: 0x00c0, 0x908: 0x00c0, 0x909: 0x00c0, 0x90a: 0x00c0, + 0x90f: 0x00c0, 0x910: 0x00c0, + 0x913: 0x00c0, 0x914: 0x00c0, 0x915: 0x00c0, 0x916: 0x00c0, 0x917: 0x00c0, + 0x918: 0x00c0, 0x919: 0x00c0, 0x91a: 0x00c0, 0x91b: 0x00c0, 0x91c: 0x00c0, 0x91d: 0x00c0, + 0x91e: 0x00c0, 0x91f: 0x00c0, 0x920: 0x00c0, 0x921: 0x00c0, 0x922: 0x00c0, 0x923: 0x00c0, + 0x924: 0x00c0, 0x925: 0x00c0, 0x926: 0x00c0, 0x927: 0x00c0, 0x928: 0x00c0, + 0x92a: 0x00c0, 0x92b: 0x00c0, 0x92c: 0x00c0, 0x92d: 0x00c0, 0x92e: 0x00c0, 0x92f: 0x00c0, + 0x930: 0x00c0, 0x932: 0x00c0, 0x933: 0x0080, 0x935: 0x00c0, + 0x936: 0x0080, 0x938: 0x00c0, 0x939: 0x00c0, + 0x93c: 0x00c3, 0x93e: 0x00c0, 0x93f: 0x00c0, + // Block 0x25, offset 0x940 + 0x940: 0x00c0, 0x941: 0x00c3, 0x942: 0x00c3, + 0x947: 0x00c3, 0x948: 0x00c3, 0x94b: 0x00c3, + 0x94c: 0x00c3, 0x94d: 0x00c6, 0x951: 0x00c3, + 0x959: 0x0080, 0x95a: 0x0080, 0x95b: 0x0080, 0x95c: 0x00c0, + 0x95e: 0x0080, + 0x966: 0x00c0, 0x967: 0x00c0, 0x968: 0x00c0, 0x969: 0x00c0, + 0x96a: 0x00c0, 0x96b: 0x00c0, 0x96c: 0x00c0, 0x96d: 0x00c0, 0x96e: 0x00c0, 0x96f: 0x00c0, + 0x970: 0x00c3, 0x971: 0x00c3, 0x972: 0x00c0, 0x973: 0x00c0, 0x974: 0x00c0, 0x975: 0x00c3, + // Block 0x26, offset 0x980 + 0x981: 0x00c3, 0x982: 0x00c3, 0x983: 0x00c0, 0x985: 0x00c0, + 0x986: 0x00c0, 0x987: 0x00c0, 0x988: 0x00c0, 0x989: 0x00c0, 0x98a: 0x00c0, 0x98b: 0x00c0, + 0x98c: 0x00c0, 0x98d: 0x00c0, 0x98f: 0x00c0, 0x990: 0x00c0, 0x991: 0x00c0, + 0x993: 0x00c0, 0x994: 0x00c0, 0x995: 0x00c0, 0x996: 0x00c0, 0x997: 0x00c0, + 0x998: 0x00c0, 0x999: 0x00c0, 0x99a: 0x00c0, 0x99b: 0x00c0, 0x99c: 0x00c0, 0x99d: 0x00c0, + 0x99e: 0x00c0, 0x99f: 0x00c0, 0x9a0: 0x00c0, 0x9a1: 0x00c0, 0x9a2: 0x00c0, 0x9a3: 0x00c0, + 0x9a4: 0x00c0, 0x9a5: 0x00c0, 0x9a6: 0x00c0, 0x9a7: 0x00c0, 0x9a8: 0x00c0, + 0x9aa: 0x00c0, 0x9ab: 0x00c0, 0x9ac: 0x00c0, 0x9ad: 0x00c0, 0x9ae: 0x00c0, 0x9af: 0x00c0, + 0x9b0: 0x00c0, 0x9b2: 0x00c0, 0x9b3: 0x00c0, 0x9b5: 0x00c0, + 0x9b6: 0x00c0, 0x9b7: 0x00c0, 0x9b8: 0x00c0, 0x9b9: 0x00c0, + 0x9bc: 0x00c3, 0x9bd: 0x00c0, 0x9be: 0x00c0, 0x9bf: 0x00c0, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x00c0, 0x9c1: 0x00c3, 0x9c2: 0x00c3, 0x9c3: 0x00c3, 0x9c4: 0x00c3, 0x9c5: 0x00c3, + 0x9c7: 0x00c3, 0x9c8: 0x00c3, 0x9c9: 0x00c0, 0x9cb: 0x00c0, + 0x9cc: 0x00c0, 0x9cd: 0x00c6, 0x9d0: 0x00c0, + 0x9e0: 0x00c0, 0x9e1: 0x00c0, 0x9e2: 0x00c3, 0x9e3: 0x00c3, + 0x9e6: 0x00c0, 0x9e7: 0x00c0, 0x9e8: 0x00c0, 0x9e9: 0x00c0, + 0x9ea: 0x00c0, 0x9eb: 0x00c0, 0x9ec: 0x00c0, 0x9ed: 0x00c0, 0x9ee: 0x00c0, 0x9ef: 0x00c0, + 0x9f0: 0x0080, 0x9f1: 0x0080, + 0x9f9: 0x00c0, + // Block 0x28, offset 0xa00 + 0xa01: 0x00c3, 0xa02: 0x00c0, 0xa03: 0x00c0, 0xa05: 0x00c0, + 0xa06: 0x00c0, 0xa07: 0x00c0, 0xa08: 0x00c0, 0xa09: 0x00c0, 0xa0a: 0x00c0, 0xa0b: 0x00c0, + 0xa0c: 0x00c0, 0xa0f: 0x00c0, 0xa10: 0x00c0, + 0xa13: 0x00c0, 0xa14: 0x00c0, 0xa15: 0x00c0, 0xa16: 0x00c0, 0xa17: 0x00c0, + 0xa18: 0x00c0, 0xa19: 0x00c0, 0xa1a: 0x00c0, 0xa1b: 0x00c0, 0xa1c: 0x00c0, 0xa1d: 0x00c0, + 0xa1e: 0x00c0, 0xa1f: 0x00c0, 0xa20: 0x00c0, 0xa21: 0x00c0, 0xa22: 0x00c0, 0xa23: 0x00c0, + 0xa24: 0x00c0, 0xa25: 0x00c0, 0xa26: 0x00c0, 0xa27: 0x00c0, 0xa28: 0x00c0, + 0xa2a: 0x00c0, 0xa2b: 0x00c0, 0xa2c: 0x00c0, 0xa2d: 0x00c0, 0xa2e: 0x00c0, 0xa2f: 0x00c0, + 0xa30: 0x00c0, 0xa32: 0x00c0, 0xa33: 0x00c0, 0xa35: 0x00c0, + 0xa36: 0x00c0, 0xa37: 0x00c0, 0xa38: 0x00c0, 0xa39: 0x00c0, + 0xa3c: 0x00c3, 0xa3d: 0x00c0, 0xa3e: 0x00c0, 0xa3f: 0x00c3, + // Block 0x29, offset 0xa40 + 0xa40: 0x00c0, 0xa41: 0x00c3, 0xa42: 0x00c3, 0xa43: 0x00c3, 0xa44: 0x00c3, + 0xa47: 0x00c0, 0xa48: 0x00c0, 0xa4b: 0x00c0, + 0xa4c: 0x00c0, 0xa4d: 0x00c6, + 0xa56: 0x00c3, 0xa57: 0x00c0, + 0xa5c: 0x0080, 0xa5d: 0x0080, + 0xa5f: 0x00c0, 0xa60: 0x00c0, 0xa61: 0x00c0, 0xa62: 0x00c3, 0xa63: 0x00c3, + 0xa66: 0x00c0, 0xa67: 0x00c0, 0xa68: 0x00c0, 0xa69: 0x00c0, + 0xa6a: 0x00c0, 0xa6b: 0x00c0, 0xa6c: 0x00c0, 0xa6d: 0x00c0, 0xa6e: 0x00c0, 0xa6f: 0x00c0, + 0xa70: 0x0080, 0xa71: 0x00c0, 0xa72: 0x0080, 0xa73: 0x0080, 0xa74: 0x0080, 0xa75: 0x0080, + 0xa76: 0x0080, 0xa77: 0x0080, + // Block 0x2a, offset 0xa80 + 0xa82: 0x00c3, 0xa83: 0x00c0, 0xa85: 0x00c0, + 0xa86: 0x00c0, 0xa87: 0x00c0, 0xa88: 0x00c0, 0xa89: 0x00c0, 0xa8a: 0x00c0, + 0xa8e: 0x00c0, 0xa8f: 0x00c0, 0xa90: 0x00c0, + 0xa92: 0x00c0, 0xa93: 0x00c0, 0xa94: 0x00c0, 0xa95: 0x00c0, + 0xa99: 0x00c0, 0xa9a: 0x00c0, 0xa9c: 0x00c0, + 0xa9e: 0x00c0, 0xa9f: 0x00c0, 0xaa3: 0x00c0, + 0xaa4: 0x00c0, 0xaa8: 0x00c0, 0xaa9: 0x00c0, + 0xaaa: 0x00c0, 0xaae: 0x00c0, 0xaaf: 0x00c0, + 0xab0: 0x00c0, 0xab1: 0x00c0, 0xab2: 0x00c0, 0xab3: 0x00c0, 0xab4: 0x00c0, 0xab5: 0x00c0, + 0xab6: 0x00c0, 0xab7: 0x00c0, 0xab8: 0x00c0, 0xab9: 0x00c0, + 0xabe: 0x00c0, 0xabf: 0x00c0, + // Block 0x2b, offset 0xac0 + 0xac0: 0x00c3, 0xac1: 0x00c0, 0xac2: 0x00c0, + 0xac6: 0x00c0, 0xac7: 0x00c0, 0xac8: 0x00c0, 0xaca: 0x00c0, 0xacb: 0x00c0, + 0xacc: 0x00c0, 0xacd: 0x00c6, 0xad0: 0x00c0, + 0xad7: 0x00c0, + 0xae6: 0x00c0, 0xae7: 0x00c0, 0xae8: 0x00c0, 0xae9: 0x00c0, + 0xaea: 0x00c0, 0xaeb: 0x00c0, 0xaec: 0x00c0, 0xaed: 0x00c0, 0xaee: 0x00c0, 0xaef: 0x00c0, + 0xaf0: 0x0080, 0xaf1: 0x0080, 0xaf2: 0x0080, 0xaf3: 0x0080, 0xaf4: 0x0080, 0xaf5: 0x0080, + 0xaf6: 0x0080, 0xaf7: 0x0080, 0xaf8: 0x0080, 0xaf9: 0x0080, 0xafa: 0x0080, + // Block 0x2c, offset 0xb00 + 0xb00: 0x00c3, 0xb01: 0x00c0, 0xb02: 0x00c0, 0xb03: 0x00c0, 0xb05: 0x00c0, + 0xb06: 0x00c0, 0xb07: 0x00c0, 0xb08: 0x00c0, 0xb09: 0x00c0, 0xb0a: 0x00c0, 0xb0b: 0x00c0, + 0xb0c: 0x00c0, 0xb0e: 0x00c0, 0xb0f: 0x00c0, 0xb10: 0x00c0, + 0xb12: 0x00c0, 0xb13: 0x00c0, 0xb14: 0x00c0, 0xb15: 0x00c0, 0xb16: 0x00c0, 0xb17: 0x00c0, + 0xb18: 0x00c0, 0xb19: 0x00c0, 0xb1a: 0x00c0, 0xb1b: 0x00c0, 0xb1c: 0x00c0, 0xb1d: 0x00c0, + 0xb1e: 0x00c0, 0xb1f: 0x00c0, 0xb20: 0x00c0, 0xb21: 0x00c0, 0xb22: 0x00c0, 0xb23: 0x00c0, + 0xb24: 0x00c0, 0xb25: 0x00c0, 0xb26: 0x00c0, 0xb27: 0x00c0, 0xb28: 0x00c0, + 0xb2a: 0x00c0, 0xb2b: 0x00c0, 0xb2c: 0x00c0, 0xb2d: 0x00c0, 0xb2e: 0x00c0, 0xb2f: 0x00c0, + 0xb30: 0x00c0, 0xb31: 0x00c0, 0xb32: 0x00c0, 0xb33: 0x00c0, 0xb34: 0x00c0, 0xb35: 0x00c0, + 0xb36: 0x00c0, 0xb37: 0x00c0, 0xb38: 0x00c0, 0xb39: 0x00c0, + 0xb3d: 0x00c0, 0xb3e: 0x00c3, 0xb3f: 0x00c3, + // Block 0x2d, offset 0xb40 + 0xb40: 0x00c3, 0xb41: 0x00c0, 0xb42: 0x00c0, 0xb43: 0x00c0, 0xb44: 0x00c0, + 0xb46: 0x00c3, 0xb47: 0x00c3, 0xb48: 0x00c3, 0xb4a: 0x00c3, 0xb4b: 0x00c3, + 0xb4c: 0x00c3, 0xb4d: 0x00c6, + 0xb55: 0x00c3, 0xb56: 0x00c3, + 0xb58: 0x00c0, 0xb59: 0x00c0, 0xb5a: 0x00c0, + 0xb60: 0x00c0, 0xb61: 0x00c0, 0xb62: 0x00c3, 0xb63: 0x00c3, + 0xb66: 0x00c0, 0xb67: 0x00c0, 0xb68: 0x00c0, 0xb69: 0x00c0, + 0xb6a: 0x00c0, 0xb6b: 0x00c0, 0xb6c: 0x00c0, 0xb6d: 0x00c0, 0xb6e: 0x00c0, 0xb6f: 0x00c0, + 0xb78: 0x0080, 0xb79: 0x0080, 0xb7a: 0x0080, 0xb7b: 0x0080, + 0xb7c: 0x0080, 0xb7d: 0x0080, 0xb7e: 0x0080, 0xb7f: 0x0080, + // Block 0x2e, offset 0xb80 + 0xb80: 0x00c0, 0xb81: 0x00c3, 0xb82: 0x00c0, 0xb83: 0x00c0, 0xb85: 0x00c0, + 0xb86: 0x00c0, 0xb87: 0x00c0, 0xb88: 0x00c0, 0xb89: 0x00c0, 0xb8a: 0x00c0, 0xb8b: 0x00c0, + 0xb8c: 0x00c0, 0xb8e: 0x00c0, 0xb8f: 0x00c0, 0xb90: 0x00c0, + 0xb92: 0x00c0, 0xb93: 0x00c0, 0xb94: 0x00c0, 0xb95: 0x00c0, 0xb96: 0x00c0, 0xb97: 0x00c0, + 0xb98: 0x00c0, 0xb99: 0x00c0, 0xb9a: 0x00c0, 0xb9b: 0x00c0, 0xb9c: 0x00c0, 0xb9d: 0x00c0, + 0xb9e: 0x00c0, 0xb9f: 0x00c0, 0xba0: 0x00c0, 0xba1: 0x00c0, 0xba2: 0x00c0, 0xba3: 0x00c0, + 0xba4: 0x00c0, 0xba5: 0x00c0, 0xba6: 0x00c0, 0xba7: 0x00c0, 0xba8: 0x00c0, + 0xbaa: 0x00c0, 0xbab: 0x00c0, 0xbac: 0x00c0, 0xbad: 0x00c0, 0xbae: 0x00c0, 0xbaf: 0x00c0, + 0xbb0: 0x00c0, 0xbb1: 0x00c0, 0xbb2: 0x00c0, 0xbb3: 0x00c0, 0xbb5: 0x00c0, + 0xbb6: 0x00c0, 0xbb7: 0x00c0, 0xbb8: 0x00c0, 0xbb9: 0x00c0, + 0xbbc: 0x00c3, 0xbbd: 0x00c0, 0xbbe: 0x00c0, 0xbbf: 0x00c3, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x00c0, 0xbc1: 0x00c0, 0xbc2: 0x00c0, 0xbc3: 0x00c0, 0xbc4: 0x00c0, + 0xbc6: 0x00c3, 0xbc7: 0x00c0, 0xbc8: 0x00c0, 0xbca: 0x00c0, 0xbcb: 0x00c0, + 0xbcc: 0x00c3, 0xbcd: 0x00c6, + 0xbd5: 0x00c0, 0xbd6: 0x00c0, + 0xbde: 0x00c0, 0xbe0: 0x00c0, 0xbe1: 0x00c0, 0xbe2: 0x00c3, 0xbe3: 0x00c3, + 0xbe6: 0x00c0, 0xbe7: 0x00c0, 0xbe8: 0x00c0, 0xbe9: 0x00c0, + 0xbea: 0x00c0, 0xbeb: 0x00c0, 0xbec: 0x00c0, 0xbed: 0x00c0, 0xbee: 0x00c0, 0xbef: 0x00c0, + 0xbf1: 0x00c0, 0xbf2: 0x00c0, + // Block 0x30, offset 0xc00 + 0xc01: 0x00c3, 0xc02: 0x00c0, 0xc03: 0x00c0, 0xc05: 0x00c0, + 0xc06: 0x00c0, 0xc07: 0x00c0, 0xc08: 0x00c0, 0xc09: 0x00c0, 0xc0a: 0x00c0, 0xc0b: 0x00c0, + 0xc0c: 0x00c0, 0xc0e: 0x00c0, 0xc0f: 0x00c0, 0xc10: 0x00c0, + 0xc12: 0x00c0, 0xc13: 0x00c0, 0xc14: 0x00c0, 0xc15: 0x00c0, 0xc16: 0x00c0, 0xc17: 0x00c0, + 0xc18: 0x00c0, 0xc19: 0x00c0, 0xc1a: 0x00c0, 0xc1b: 0x00c0, 0xc1c: 0x00c0, 0xc1d: 0x00c0, + 0xc1e: 0x00c0, 0xc1f: 0x00c0, 0xc20: 0x00c0, 0xc21: 0x00c0, 0xc22: 0x00c0, 0xc23: 0x00c0, + 0xc24: 0x00c0, 0xc25: 0x00c0, 0xc26: 0x00c0, 0xc27: 0x00c0, 0xc28: 0x00c0, 0xc29: 0x00c0, + 0xc2a: 0x00c0, 0xc2b: 0x00c0, 0xc2c: 0x00c0, 0xc2d: 0x00c0, 0xc2e: 0x00c0, 0xc2f: 0x00c0, + 0xc30: 0x00c0, 0xc31: 0x00c0, 0xc32: 0x00c0, 0xc33: 0x00c0, 0xc34: 0x00c0, 0xc35: 0x00c0, + 0xc36: 0x00c0, 0xc37: 0x00c0, 0xc38: 0x00c0, 0xc39: 0x00c0, 0xc3a: 0x00c0, + 0xc3d: 0x00c0, 0xc3e: 0x00c0, 0xc3f: 0x00c0, + // Block 0x31, offset 0xc40 + 0xc40: 0x00c0, 0xc41: 0x00c3, 0xc42: 0x00c3, 0xc43: 0x00c3, 0xc44: 0x00c3, + 0xc46: 0x00c0, 0xc47: 0x00c0, 0xc48: 0x00c0, 0xc4a: 0x00c0, 0xc4b: 0x00c0, + 0xc4c: 0x00c0, 0xc4d: 0x00c6, 0xc4e: 0x00c0, 0xc4f: 0x0080, + 0xc54: 0x00c0, 0xc55: 0x00c0, 0xc56: 0x00c0, 0xc57: 0x00c0, + 0xc58: 0x0080, 0xc59: 0x0080, 0xc5a: 0x0080, 0xc5b: 0x0080, 0xc5c: 0x0080, 0xc5d: 0x0080, + 0xc5e: 0x0080, 0xc5f: 0x00c0, 0xc60: 0x00c0, 0xc61: 0x00c0, 0xc62: 0x00c3, 0xc63: 0x00c3, + 0xc66: 0x00c0, 0xc67: 0x00c0, 0xc68: 0x00c0, 0xc69: 0x00c0, + 0xc6a: 0x00c0, 0xc6b: 0x00c0, 0xc6c: 0x00c0, 0xc6d: 0x00c0, 0xc6e: 0x00c0, 0xc6f: 0x00c0, + 0xc70: 0x0080, 0xc71: 0x0080, 0xc72: 0x0080, 0xc73: 0x0080, 0xc74: 0x0080, 0xc75: 0x0080, + 0xc76: 0x0080, 0xc77: 0x0080, 0xc78: 0x0080, 0xc79: 0x0080, 0xc7a: 0x00c0, 0xc7b: 0x00c0, + 0xc7c: 0x00c0, 0xc7d: 0x00c0, 0xc7e: 0x00c0, 0xc7f: 0x00c0, + // Block 0x32, offset 0xc80 + 0xc82: 0x00c0, 0xc83: 0x00c0, 0xc85: 0x00c0, + 0xc86: 0x00c0, 0xc87: 0x00c0, 0xc88: 0x00c0, 0xc89: 0x00c0, 0xc8a: 0x00c0, 0xc8b: 0x00c0, + 0xc8c: 0x00c0, 0xc8d: 0x00c0, 0xc8e: 0x00c0, 0xc8f: 0x00c0, 0xc90: 0x00c0, 0xc91: 0x00c0, + 0xc92: 0x00c0, 0xc93: 0x00c0, 0xc94: 0x00c0, 0xc95: 0x00c0, 0xc96: 0x00c0, + 0xc9a: 0x00c0, 0xc9b: 0x00c0, 0xc9c: 0x00c0, 0xc9d: 0x00c0, + 0xc9e: 0x00c0, 0xc9f: 0x00c0, 0xca0: 0x00c0, 0xca1: 0x00c0, 0xca2: 0x00c0, 0xca3: 0x00c0, + 0xca4: 0x00c0, 0xca5: 0x00c0, 0xca6: 0x00c0, 0xca7: 0x00c0, 0xca8: 0x00c0, 0xca9: 0x00c0, + 0xcaa: 0x00c0, 0xcab: 0x00c0, 0xcac: 0x00c0, 0xcad: 0x00c0, 0xcae: 0x00c0, 0xcaf: 0x00c0, + 0xcb0: 0x00c0, 0xcb1: 0x00c0, 0xcb3: 0x00c0, 0xcb4: 0x00c0, 0xcb5: 0x00c0, + 0xcb6: 0x00c0, 0xcb7: 0x00c0, 0xcb8: 0x00c0, 0xcb9: 0x00c0, 0xcba: 0x00c0, 0xcbb: 0x00c0, + 0xcbd: 0x00c0, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x00c0, 0xcc1: 0x00c0, 0xcc2: 0x00c0, 0xcc3: 0x00c0, 0xcc4: 0x00c0, 0xcc5: 0x00c0, + 0xcc6: 0x00c0, 0xcca: 0x00c6, + 0xccf: 0x00c0, 0xcd0: 0x00c0, 0xcd1: 0x00c0, + 0xcd2: 0x00c3, 0xcd3: 0x00c3, 0xcd4: 0x00c3, 0xcd6: 0x00c3, + 0xcd8: 0x00c0, 0xcd9: 0x00c0, 0xcda: 0x00c0, 0xcdb: 0x00c0, 0xcdc: 0x00c0, 0xcdd: 0x00c0, + 0xcde: 0x00c0, 0xcdf: 0x00c0, + 0xce6: 0x00c0, 0xce7: 0x00c0, 0xce8: 0x00c0, 0xce9: 0x00c0, + 0xcea: 0x00c0, 0xceb: 0x00c0, 0xcec: 0x00c0, 0xced: 0x00c0, 0xcee: 0x00c0, 0xcef: 0x00c0, + 0xcf2: 0x00c0, 0xcf3: 0x00c0, 0xcf4: 0x0080, + // Block 0x34, offset 0xd00 + 0xd01: 0x00c0, 0xd02: 0x00c0, 0xd03: 0x00c0, 0xd04: 0x00c0, 0xd05: 0x00c0, + 0xd06: 0x00c0, 0xd07: 0x00c0, 0xd08: 0x00c0, 0xd09: 0x00c0, 0xd0a: 0x00c0, 0xd0b: 0x00c0, + 0xd0c: 0x00c0, 0xd0d: 0x00c0, 0xd0e: 0x00c0, 0xd0f: 0x00c0, 0xd10: 0x00c0, 0xd11: 0x00c0, + 0xd12: 0x00c0, 0xd13: 0x00c0, 0xd14: 0x00c0, 0xd15: 0x00c0, 0xd16: 0x00c0, 0xd17: 0x00c0, + 0xd18: 0x00c0, 0xd19: 0x00c0, 0xd1a: 0x00c0, 0xd1b: 0x00c0, 0xd1c: 0x00c0, 0xd1d: 0x00c0, + 0xd1e: 0x00c0, 0xd1f: 0x00c0, 0xd20: 0x00c0, 0xd21: 0x00c0, 0xd22: 0x00c0, 0xd23: 0x00c0, + 0xd24: 0x00c0, 0xd25: 0x00c0, 0xd26: 0x00c0, 0xd27: 0x00c0, 0xd28: 0x00c0, 0xd29: 0x00c0, + 0xd2a: 0x00c0, 0xd2b: 0x00c0, 0xd2c: 0x00c0, 0xd2d: 0x00c0, 0xd2e: 0x00c0, 0xd2f: 0x00c0, + 0xd30: 0x00c0, 0xd31: 0x00c3, 0xd32: 0x00c0, 0xd33: 0x0080, 0xd34: 0x00c3, 0xd35: 0x00c3, + 0xd36: 0x00c3, 0xd37: 0x00c3, 0xd38: 0x00c3, 0xd39: 0x00c3, 0xd3a: 0x00c6, + 0xd3f: 0x0080, + // Block 0x35, offset 0xd40 + 0xd40: 0x00c0, 0xd41: 0x00c0, 0xd42: 0x00c0, 0xd43: 0x00c0, 0xd44: 0x00c0, 0xd45: 0x00c0, + 0xd46: 0x00c0, 0xd47: 0x00c3, 0xd48: 0x00c3, 0xd49: 0x00c3, 0xd4a: 0x00c3, 0xd4b: 0x00c3, + 0xd4c: 0x00c3, 0xd4d: 0x00c3, 0xd4e: 0x00c3, 0xd4f: 0x0080, 0xd50: 0x00c0, 0xd51: 0x00c0, + 0xd52: 0x00c0, 0xd53: 0x00c0, 0xd54: 0x00c0, 0xd55: 0x00c0, 0xd56: 0x00c0, 0xd57: 0x00c0, + 0xd58: 0x00c0, 0xd59: 0x00c0, 0xd5a: 0x0080, 0xd5b: 0x0080, + // Block 0x36, offset 0xd80 + 0xd81: 0x00c0, 0xd82: 0x00c0, 0xd84: 0x00c0, + 0xd87: 0x00c0, 0xd88: 0x00c0, 0xd8a: 0x00c0, + 0xd8d: 0x00c0, + 0xd94: 0x00c0, 0xd95: 0x00c0, 0xd96: 0x00c0, 0xd97: 0x00c0, + 0xd99: 0x00c0, 0xd9a: 0x00c0, 0xd9b: 0x00c0, 0xd9c: 0x00c0, 0xd9d: 0x00c0, + 0xd9e: 0x00c0, 0xd9f: 0x00c0, 0xda1: 0x00c0, 0xda2: 0x00c0, 0xda3: 0x00c0, + 0xda5: 0x00c0, 0xda7: 0x00c0, + 0xdaa: 0x00c0, 0xdab: 0x00c0, 0xdad: 0x00c0, 0xdae: 0x00c0, 0xdaf: 0x00c0, + 0xdb0: 0x00c0, 0xdb1: 0x00c3, 0xdb2: 0x00c0, 0xdb3: 0x0080, 0xdb4: 0x00c3, 0xdb5: 0x00c3, + 0xdb6: 0x00c3, 0xdb7: 0x00c3, 0xdb8: 0x00c3, 0xdb9: 0x00c3, 0xdbb: 0x00c3, + 0xdbc: 0x00c3, 0xdbd: 0x00c0, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x00c0, 0xdc1: 0x00c0, 0xdc2: 0x00c0, 0xdc3: 0x00c0, 0xdc4: 0x00c0, + 0xdc6: 0x00c0, 0xdc8: 0x00c3, 0xdc9: 0x00c3, 0xdca: 0x00c3, 0xdcb: 0x00c3, + 0xdcc: 0x00c3, 0xdcd: 0x00c3, 0xdd0: 0x00c0, 0xdd1: 0x00c0, + 0xdd2: 0x00c0, 0xdd3: 0x00c0, 0xdd4: 0x00c0, 0xdd5: 0x00c0, 0xdd6: 0x00c0, 0xdd7: 0x00c0, + 0xdd8: 0x00c0, 0xdd9: 0x00c0, 0xddc: 0x0080, 0xddd: 0x0080, + 0xdde: 0x00c0, 0xddf: 0x00c0, + // Block 0x38, offset 0xe00 + 0xe00: 0x00c0, 0xe01: 0x0080, 0xe02: 0x0080, 0xe03: 0x0080, 0xe04: 0x0080, 0xe05: 0x0080, + 0xe06: 0x0080, 0xe07: 0x0080, 0xe08: 0x0080, 0xe09: 0x0080, 0xe0a: 0x0080, 0xe0b: 0x00c0, + 0xe0c: 0x0080, 0xe0d: 0x0080, 0xe0e: 0x0080, 0xe0f: 0x0080, 0xe10: 0x0080, 0xe11: 0x0080, + 0xe12: 0x0080, 0xe13: 0x0080, 0xe14: 0x0080, 0xe15: 0x0080, 0xe16: 0x0080, 0xe17: 0x0080, + 0xe18: 0x00c3, 0xe19: 0x00c3, 0xe1a: 0x0080, 0xe1b: 0x0080, 0xe1c: 0x0080, 0xe1d: 0x0080, + 0xe1e: 0x0080, 0xe1f: 0x0080, 0xe20: 0x00c0, 0xe21: 0x00c0, 0xe22: 0x00c0, 0xe23: 0x00c0, + 0xe24: 0x00c0, 0xe25: 0x00c0, 0xe26: 0x00c0, 0xe27: 0x00c0, 0xe28: 0x00c0, 0xe29: 0x00c0, + 0xe2a: 0x0080, 0xe2b: 0x0080, 0xe2c: 0x0080, 0xe2d: 0x0080, 0xe2e: 0x0080, 0xe2f: 0x0080, + 0xe30: 0x0080, 0xe31: 0x0080, 0xe32: 0x0080, 0xe33: 0x0080, 0xe34: 0x0080, 0xe35: 0x00c3, + 0xe36: 0x0080, 0xe37: 0x00c3, 0xe38: 0x0080, 0xe39: 0x00c3, 0xe3a: 0x0080, 0xe3b: 0x0080, + 0xe3c: 0x0080, 0xe3d: 0x0080, 0xe3e: 0x00c0, 0xe3f: 0x00c0, + // Block 0x39, offset 0xe40 + 0xe40: 0x00c0, 0xe41: 0x00c0, 0xe42: 0x00c0, 0xe43: 0x0080, 0xe44: 0x00c0, 0xe45: 0x00c0, + 0xe46: 0x00c0, 0xe47: 0x00c0, 0xe49: 0x00c0, 0xe4a: 0x00c0, 0xe4b: 0x00c0, + 0xe4c: 0x00c0, 0xe4d: 0x0080, 0xe4e: 0x00c0, 0xe4f: 0x00c0, 0xe50: 0x00c0, 0xe51: 0x00c0, + 0xe52: 0x0080, 0xe53: 0x00c0, 0xe54: 0x00c0, 0xe55: 0x00c0, 0xe56: 0x00c0, 0xe57: 0x0080, + 0xe58: 0x00c0, 0xe59: 0x00c0, 0xe5a: 0x00c0, 0xe5b: 0x00c0, 0xe5c: 0x0080, 0xe5d: 0x00c0, + 0xe5e: 0x00c0, 0xe5f: 0x00c0, 0xe60: 0x00c0, 0xe61: 0x00c0, 0xe62: 0x00c0, 0xe63: 0x00c0, + 0xe64: 0x00c0, 0xe65: 0x00c0, 0xe66: 0x00c0, 0xe67: 0x00c0, 0xe68: 0x00c0, 0xe69: 0x0080, + 0xe6a: 0x00c0, 0xe6b: 0x00c0, 0xe6c: 0x00c0, + 0xe71: 0x00c3, 0xe72: 0x00c3, 0xe73: 0x0083, 0xe74: 0x00c3, 0xe75: 0x0083, + 0xe76: 0x0083, 0xe77: 0x0083, 0xe78: 0x0083, 0xe79: 0x0083, 0xe7a: 0x00c3, 0xe7b: 0x00c3, + 0xe7c: 0x00c3, 0xe7d: 0x00c3, 0xe7e: 0x00c3, 0xe7f: 0x00c0, + // Block 0x3a, offset 0xe80 + 0xe80: 0x00c3, 0xe81: 0x0083, 0xe82: 0x00c3, 0xe83: 0x00c3, 0xe84: 0x00c6, 0xe85: 0x0080, + 0xe86: 0x00c3, 0xe87: 0x00c3, 0xe88: 0x00c0, 0xe89: 0x00c0, 0xe8a: 0x00c0, 0xe8b: 0x00c0, + 0xe8c: 0x00c0, 0xe8d: 0x00c3, 0xe8e: 0x00c3, 0xe8f: 0x00c3, 0xe90: 0x00c3, 0xe91: 0x00c3, + 0xe92: 0x00c3, 0xe93: 0x0083, 0xe94: 0x00c3, 0xe95: 0x00c3, 0xe96: 0x00c3, 0xe97: 0x00c3, + 0xe99: 0x00c3, 0xe9a: 0x00c3, 0xe9b: 0x00c3, 0xe9c: 0x00c3, 0xe9d: 0x0083, + 0xe9e: 0x00c3, 0xe9f: 0x00c3, 0xea0: 0x00c3, 0xea1: 0x00c3, 0xea2: 0x0083, 0xea3: 0x00c3, + 0xea4: 0x00c3, 0xea5: 0x00c3, 0xea6: 0x00c3, 0xea7: 0x0083, 0xea8: 0x00c3, 0xea9: 0x00c3, + 0xeaa: 0x00c3, 0xeab: 0x00c3, 0xeac: 0x0083, 0xead: 0x00c3, 0xeae: 0x00c3, 0xeaf: 0x00c3, + 0xeb0: 0x00c3, 0xeb1: 0x00c3, 0xeb2: 0x00c3, 0xeb3: 0x00c3, 0xeb4: 0x00c3, 0xeb5: 0x00c3, + 0xeb6: 0x00c3, 0xeb7: 0x00c3, 0xeb8: 0x00c3, 0xeb9: 0x0083, 0xeba: 0x00c3, 0xebb: 0x00c3, + 0xebc: 0x00c3, 0xebe: 0x0080, 0xebf: 0x0080, + // Block 0x3b, offset 0xec0 + 0xec0: 0x0080, 0xec1: 0x0080, 0xec2: 0x0080, 0xec3: 0x0080, 0xec4: 0x0080, 0xec5: 0x0080, + 0xec6: 0x00c3, 0xec7: 0x0080, 0xec8: 0x0080, 0xec9: 0x0080, 0xeca: 0x0080, 0xecb: 0x0080, + 0xecc: 0x0080, 0xece: 0x0080, 0xecf: 0x0080, 0xed0: 0x0080, 0xed1: 0x0080, + 0xed2: 0x0080, 0xed3: 0x0080, 0xed4: 0x0080, 0xed5: 0x0080, 0xed6: 0x0080, 0xed7: 0x0080, + 0xed8: 0x0080, 0xed9: 0x0080, 0xeda: 0x0080, + // Block 0x3c, offset 0xf00 + 0xf00: 0x00c0, 0xf01: 0x00c0, 0xf02: 0x00c0, 0xf03: 0x00c0, 0xf04: 0x00c0, 0xf05: 0x00c0, + 0xf06: 0x00c0, 0xf07: 0x00c0, 0xf08: 0x00c0, 0xf09: 0x00c0, 0xf0a: 0x00c0, 0xf0b: 0x00c0, + 0xf0c: 0x00c0, 0xf0d: 0x00c0, 0xf0e: 0x00c0, 0xf0f: 0x00c0, 0xf10: 0x00c0, 0xf11: 0x00c0, + 0xf12: 0x00c0, 0xf13: 0x00c0, 0xf14: 0x00c0, 0xf15: 0x00c0, 0xf16: 0x00c0, 0xf17: 0x00c0, + 0xf18: 0x00c0, 0xf19: 0x00c0, 0xf1a: 0x00c0, 0xf1b: 0x00c0, 0xf1c: 0x00c0, 0xf1d: 0x00c0, + 0xf1e: 0x00c0, 0xf1f: 0x00c0, 0xf20: 0x00c0, 0xf21: 0x00c0, 0xf22: 0x00c0, 0xf23: 0x00c0, + 0xf24: 0x00c0, 0xf25: 0x00c0, 0xf26: 0x00c0, 0xf27: 0x00c0, 0xf28: 0x00c0, 0xf29: 0x00c0, + 0xf2a: 0x00c0, 0xf2b: 0x00c0, 0xf2c: 0x00c0, 0xf2d: 0x00c3, 0xf2e: 0x00c3, 0xf2f: 0x00c3, + 0xf30: 0x00c3, 0xf31: 0x00c0, 0xf32: 0x00c3, 0xf33: 0x00c3, 0xf34: 0x00c3, 0xf35: 0x00c3, + 0xf36: 0x00c3, 0xf37: 0x00c3, 0xf38: 0x00c0, 0xf39: 0x00c6, 0xf3a: 0x00c6, 0xf3b: 0x00c0, + 0xf3c: 0x00c0, 0xf3d: 0x00c3, 0xf3e: 0x00c3, 0xf3f: 0x00c0, + // Block 0x3d, offset 0xf40 + 0xf40: 0x00c0, 0xf41: 0x00c0, 0xf42: 0x00c0, 0xf43: 0x00c0, 0xf44: 0x00c0, 0xf45: 0x00c0, + 0xf46: 0x00c0, 0xf47: 0x00c0, 0xf48: 0x00c0, 0xf49: 0x00c0, 0xf4a: 0x0080, 0xf4b: 0x0080, + 0xf4c: 0x0080, 0xf4d: 0x0080, 0xf4e: 0x0080, 0xf4f: 0x0080, 0xf50: 0x00c0, 0xf51: 0x00c0, + 0xf52: 0x00c0, 0xf53: 0x00c0, 0xf54: 0x00c0, 0xf55: 0x00c0, 0xf56: 0x00c0, 0xf57: 0x00c0, + 0xf58: 0x00c3, 0xf59: 0x00c3, 0xf5a: 0x00c0, 0xf5b: 0x00c0, 0xf5c: 0x00c0, 0xf5d: 0x00c0, + 0xf5e: 0x00c3, 0xf5f: 0x00c3, 0xf60: 0x00c3, 0xf61: 0x00c0, 0xf62: 0x00c0, 0xf63: 0x00c0, + 0xf64: 0x00c0, 0xf65: 0x00c0, 0xf66: 0x00c0, 0xf67: 0x00c0, 0xf68: 0x00c0, 0xf69: 0x00c0, + 0xf6a: 0x00c0, 0xf6b: 0x00c0, 0xf6c: 0x00c0, 0xf6d: 0x00c0, 0xf6e: 0x00c0, 0xf6f: 0x00c0, + 0xf70: 0x00c0, 0xf71: 0x00c3, 0xf72: 0x00c3, 0xf73: 0x00c3, 0xf74: 0x00c3, 0xf75: 0x00c0, + 0xf76: 0x00c0, 0xf77: 0x00c0, 0xf78: 0x00c0, 0xf79: 0x00c0, 0xf7a: 0x00c0, 0xf7b: 0x00c0, + 0xf7c: 0x00c0, 0xf7d: 0x00c0, 0xf7e: 0x00c0, 0xf7f: 0x00c0, + // Block 0x3e, offset 0xf80 + 0xf80: 0x00c0, 0xf81: 0x00c0, 0xf82: 0x00c3, 0xf83: 0x00c0, 0xf84: 0x00c0, 0xf85: 0x00c3, + 0xf86: 0x00c3, 0xf87: 0x00c0, 0xf88: 0x00c0, 0xf89: 0x00c0, 0xf8a: 0x00c0, 0xf8b: 0x00c0, + 0xf8c: 0x00c0, 0xf8d: 0x00c3, 0xf8e: 0x00c0, 0xf8f: 0x00c0, 0xf90: 0x00c0, 0xf91: 0x00c0, + 0xf92: 0x00c0, 0xf93: 0x00c0, 0xf94: 0x00c0, 0xf95: 0x00c0, 0xf96: 0x00c0, 0xf97: 0x00c0, + 0xf98: 0x00c0, 0xf99: 0x00c0, 0xf9a: 0x00c0, 0xf9b: 0x00c0, 0xf9c: 0x00c0, 0xf9d: 0x00c3, + 0xf9e: 0x0080, 0xf9f: 0x0080, 0xfa0: 0x00c0, 0xfa1: 0x00c0, 0xfa2: 0x00c0, 0xfa3: 0x00c0, + 0xfa4: 0x00c0, 0xfa5: 0x00c0, 0xfa6: 0x00c0, 0xfa7: 0x00c0, 0xfa8: 0x00c0, 0xfa9: 0x00c0, + 0xfaa: 0x00c0, 0xfab: 0x00c0, 0xfac: 0x00c0, 0xfad: 0x00c0, 0xfae: 0x00c0, 0xfaf: 0x00c0, + 0xfb0: 0x00c0, 0xfb1: 0x00c0, 0xfb2: 0x00c0, 0xfb3: 0x00c0, 0xfb4: 0x00c0, 0xfb5: 0x00c0, + 0xfb6: 0x00c0, 0xfb7: 0x00c0, 0xfb8: 0x00c0, 0xfb9: 0x00c0, 0xfba: 0x00c0, 0xfbb: 0x00c0, + 0xfbc: 0x00c0, 0xfbd: 0x00c0, 0xfbe: 0x00c0, 0xfbf: 0x00c0, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x00c0, 0xfc1: 0x00c0, 0xfc2: 0x00c0, 0xfc3: 0x00c0, 0xfc4: 0x00c0, 0xfc5: 0x00c0, + 0xfc7: 0x00c0, + 0xfcd: 0x00c0, 0xfd0: 0x00c0, 0xfd1: 0x00c0, + 0xfd2: 0x00c0, 0xfd3: 0x00c0, 0xfd4: 0x00c0, 0xfd5: 0x00c0, 0xfd6: 0x00c0, 0xfd7: 0x00c0, + 0xfd8: 0x00c0, 0xfd9: 0x00c0, 0xfda: 0x00c0, 0xfdb: 0x00c0, 0xfdc: 0x00c0, 0xfdd: 0x00c0, + 0xfde: 0x00c0, 0xfdf: 0x00c0, 0xfe0: 0x00c0, 0xfe1: 0x00c0, 0xfe2: 0x00c0, 0xfe3: 0x00c0, + 0xfe4: 0x00c0, 0xfe5: 0x00c0, 0xfe6: 0x00c0, 0xfe7: 0x00c0, 0xfe8: 0x00c0, 0xfe9: 0x00c0, + 0xfea: 0x00c0, 0xfeb: 0x00c0, 0xfec: 0x00c0, 0xfed: 0x00c0, 0xfee: 0x00c0, 0xfef: 0x00c0, + 0xff0: 0x00c0, 0xff1: 0x00c0, 0xff2: 0x00c0, 0xff3: 0x00c0, 0xff4: 0x00c0, 0xff5: 0x00c0, + 0xff6: 0x00c0, 0xff7: 0x00c0, 0xff8: 0x00c0, 0xff9: 0x00c0, 0xffa: 0x00c0, 0xffb: 0x0080, + 0xffc: 0x0080, 0xffd: 0x00c0, 0xffe: 0x00c0, 0xfff: 0x00c0, + // Block 0x40, offset 0x1000 + 0x1000: 0x0040, 0x1001: 0x0040, 0x1002: 0x0040, 0x1003: 0x0040, 0x1004: 0x0040, 0x1005: 0x0040, + 0x1006: 0x0040, 0x1007: 0x0040, 0x1008: 0x0040, 0x1009: 0x0040, 0x100a: 0x0040, 0x100b: 0x0040, + 0x100c: 0x0040, 0x100d: 0x0040, 0x100e: 0x0040, 0x100f: 0x0040, 0x1010: 0x0040, 0x1011: 0x0040, + 0x1012: 0x0040, 0x1013: 0x0040, 0x1014: 0x0040, 0x1015: 0x0040, 0x1016: 0x0040, 0x1017: 0x0040, + 0x1018: 0x0040, 0x1019: 0x0040, 0x101a: 0x0040, 0x101b: 0x0040, 0x101c: 0x0040, 0x101d: 0x0040, + 0x101e: 0x0040, 0x101f: 0x0040, 0x1020: 0x0040, 0x1021: 0x0040, 0x1022: 0x0040, 0x1023: 0x0040, + 0x1024: 0x0040, 0x1025: 0x0040, 0x1026: 0x0040, 0x1027: 0x0040, 0x1028: 0x0040, 0x1029: 0x0040, + 0x102a: 0x0040, 0x102b: 0x0040, 0x102c: 0x0040, 0x102d: 0x0040, 0x102e: 0x0040, 0x102f: 0x0040, + 0x1030: 0x0040, 0x1031: 0x0040, 0x1032: 0x0040, 0x1033: 0x0040, 0x1034: 0x0040, 0x1035: 0x0040, + 0x1036: 0x0040, 0x1037: 0x0040, 0x1038: 0x0040, 0x1039: 0x0040, 0x103a: 0x0040, 0x103b: 0x0040, + 0x103c: 0x0040, 0x103d: 0x0040, 0x103e: 0x0040, 0x103f: 0x0040, + // Block 0x41, offset 0x1040 + 0x1040: 0x00c0, 0x1041: 0x00c0, 0x1042: 0x00c0, 0x1043: 0x00c0, 0x1044: 0x00c0, 0x1045: 0x00c0, + 0x1046: 0x00c0, 0x1047: 0x00c0, 0x1048: 0x00c0, 0x104a: 0x00c0, 0x104b: 0x00c0, + 0x104c: 0x00c0, 0x104d: 0x00c0, 0x1050: 0x00c0, 0x1051: 0x00c0, + 0x1052: 0x00c0, 0x1053: 0x00c0, 0x1054: 0x00c0, 0x1055: 0x00c0, 0x1056: 0x00c0, + 0x1058: 0x00c0, 0x105a: 0x00c0, 0x105b: 0x00c0, 0x105c: 0x00c0, 0x105d: 0x00c0, + 0x1060: 0x00c0, 0x1061: 0x00c0, 0x1062: 0x00c0, 0x1063: 0x00c0, + 0x1064: 0x00c0, 0x1065: 0x00c0, 0x1066: 0x00c0, 0x1067: 0x00c0, 0x1068: 0x00c0, 0x1069: 0x00c0, + 0x106a: 0x00c0, 0x106b: 0x00c0, 0x106c: 0x00c0, 0x106d: 0x00c0, 0x106e: 0x00c0, 0x106f: 0x00c0, + 0x1070: 0x00c0, 0x1071: 0x00c0, 0x1072: 0x00c0, 0x1073: 0x00c0, 0x1074: 0x00c0, 0x1075: 0x00c0, + 0x1076: 0x00c0, 0x1077: 0x00c0, 0x1078: 0x00c0, 0x1079: 0x00c0, 0x107a: 0x00c0, 0x107b: 0x00c0, + 0x107c: 0x00c0, 0x107d: 0x00c0, 0x107e: 0x00c0, 0x107f: 0x00c0, + // Block 0x42, offset 0x1080 + 0x1080: 0x00c0, 0x1081: 0x00c0, 0x1082: 0x00c0, 0x1083: 0x00c0, 0x1084: 0x00c0, 0x1085: 0x00c0, + 0x1086: 0x00c0, 0x1087: 0x00c0, 0x1088: 0x00c0, 0x108a: 0x00c0, 0x108b: 0x00c0, + 0x108c: 0x00c0, 0x108d: 0x00c0, 0x1090: 0x00c0, 0x1091: 0x00c0, + 0x1092: 0x00c0, 0x1093: 0x00c0, 0x1094: 0x00c0, 0x1095: 0x00c0, 0x1096: 0x00c0, 0x1097: 0x00c0, + 0x1098: 0x00c0, 0x1099: 0x00c0, 0x109a: 0x00c0, 0x109b: 0x00c0, 0x109c: 0x00c0, 0x109d: 0x00c0, + 0x109e: 0x00c0, 0x109f: 0x00c0, 0x10a0: 0x00c0, 0x10a1: 0x00c0, 0x10a2: 0x00c0, 0x10a3: 0x00c0, + 0x10a4: 0x00c0, 0x10a5: 0x00c0, 0x10a6: 0x00c0, 0x10a7: 0x00c0, 0x10a8: 0x00c0, 0x10a9: 0x00c0, + 0x10aa: 0x00c0, 0x10ab: 0x00c0, 0x10ac: 0x00c0, 0x10ad: 0x00c0, 0x10ae: 0x00c0, 0x10af: 0x00c0, + 0x10b0: 0x00c0, 0x10b2: 0x00c0, 0x10b3: 0x00c0, 0x10b4: 0x00c0, 0x10b5: 0x00c0, + 0x10b8: 0x00c0, 0x10b9: 0x00c0, 0x10ba: 0x00c0, 0x10bb: 0x00c0, + 0x10bc: 0x00c0, 0x10bd: 0x00c0, 0x10be: 0x00c0, + // Block 0x43, offset 0x10c0 + 0x10c0: 0x00c0, 0x10c2: 0x00c0, 0x10c3: 0x00c0, 0x10c4: 0x00c0, 0x10c5: 0x00c0, + 0x10c8: 0x00c0, 0x10c9: 0x00c0, 0x10ca: 0x00c0, 0x10cb: 0x00c0, + 0x10cc: 0x00c0, 0x10cd: 0x00c0, 0x10ce: 0x00c0, 0x10cf: 0x00c0, 0x10d0: 0x00c0, 0x10d1: 0x00c0, + 0x10d2: 0x00c0, 0x10d3: 0x00c0, 0x10d4: 0x00c0, 0x10d5: 0x00c0, 0x10d6: 0x00c0, + 0x10d8: 0x00c0, 0x10d9: 0x00c0, 0x10da: 0x00c0, 0x10db: 0x00c0, 0x10dc: 0x00c0, 0x10dd: 0x00c0, + 0x10de: 0x00c0, 0x10df: 0x00c0, 0x10e0: 0x00c0, 0x10e1: 0x00c0, 0x10e2: 0x00c0, 0x10e3: 0x00c0, + 0x10e4: 0x00c0, 0x10e5: 0x00c0, 0x10e6: 0x00c0, 0x10e7: 0x00c0, 0x10e8: 0x00c0, 0x10e9: 0x00c0, + 0x10ea: 0x00c0, 0x10eb: 0x00c0, 0x10ec: 0x00c0, 0x10ed: 0x00c0, 0x10ee: 0x00c0, 0x10ef: 0x00c0, + 0x10f0: 0x00c0, 0x10f1: 0x00c0, 0x10f2: 0x00c0, 0x10f3: 0x00c0, 0x10f4: 0x00c0, 0x10f5: 0x00c0, + 0x10f6: 0x00c0, 0x10f7: 0x00c0, 0x10f8: 0x00c0, 0x10f9: 0x00c0, 0x10fa: 0x00c0, 0x10fb: 0x00c0, + 0x10fc: 0x00c0, 0x10fd: 0x00c0, 0x10fe: 0x00c0, 0x10ff: 0x00c0, + // Block 0x44, offset 0x1100 + 0x1100: 0x00c0, 0x1101: 0x00c0, 0x1102: 0x00c0, 0x1103: 0x00c0, 0x1104: 0x00c0, 0x1105: 0x00c0, + 0x1106: 0x00c0, 0x1107: 0x00c0, 0x1108: 0x00c0, 0x1109: 0x00c0, 0x110a: 0x00c0, 0x110b: 0x00c0, + 0x110c: 0x00c0, 0x110d: 0x00c0, 0x110e: 0x00c0, 0x110f: 0x00c0, 0x1110: 0x00c0, + 0x1112: 0x00c0, 0x1113: 0x00c0, 0x1114: 0x00c0, 0x1115: 0x00c0, + 0x1118: 0x00c0, 0x1119: 0x00c0, 0x111a: 0x00c0, 0x111b: 0x00c0, 0x111c: 0x00c0, 0x111d: 0x00c0, + 0x111e: 0x00c0, 0x111f: 0x00c0, 0x1120: 0x00c0, 0x1121: 0x00c0, 0x1122: 0x00c0, 0x1123: 0x00c0, + 0x1124: 0x00c0, 0x1125: 0x00c0, 0x1126: 0x00c0, 0x1127: 0x00c0, 0x1128: 0x00c0, 0x1129: 0x00c0, + 0x112a: 0x00c0, 0x112b: 0x00c0, 0x112c: 0x00c0, 0x112d: 0x00c0, 0x112e: 0x00c0, 0x112f: 0x00c0, + 0x1130: 0x00c0, 0x1131: 0x00c0, 0x1132: 0x00c0, 0x1133: 0x00c0, 0x1134: 0x00c0, 0x1135: 0x00c0, + 0x1136: 0x00c0, 0x1137: 0x00c0, 0x1138: 0x00c0, 0x1139: 0x00c0, 0x113a: 0x00c0, 0x113b: 0x00c0, + 0x113c: 0x00c0, 0x113d: 0x00c0, 0x113e: 0x00c0, 0x113f: 0x00c0, + // Block 0x45, offset 0x1140 + 0x1140: 0x00c0, 0x1141: 0x00c0, 0x1142: 0x00c0, 0x1143: 0x00c0, 0x1144: 0x00c0, 0x1145: 0x00c0, + 0x1146: 0x00c0, 0x1147: 0x00c0, 0x1148: 0x00c0, 0x1149: 0x00c0, 0x114a: 0x00c0, 0x114b: 0x00c0, + 0x114c: 0x00c0, 0x114d: 0x00c0, 0x114e: 0x00c0, 0x114f: 0x00c0, 0x1150: 0x00c0, 0x1151: 0x00c0, + 0x1152: 0x00c0, 0x1153: 0x00c0, 0x1154: 0x00c0, 0x1155: 0x00c0, 0x1156: 0x00c0, 0x1157: 0x00c0, + 0x1158: 0x00c0, 0x1159: 0x00c0, 0x115a: 0x00c0, 0x115d: 0x00c3, + 0x115e: 0x00c3, 0x115f: 0x00c3, 0x1160: 0x0080, 0x1161: 0x0080, 0x1162: 0x0080, 0x1163: 0x0080, + 0x1164: 0x0080, 0x1165: 0x0080, 0x1166: 0x0080, 0x1167: 0x0080, 0x1168: 0x0080, 0x1169: 0x0080, + 0x116a: 0x0080, 0x116b: 0x0080, 0x116c: 0x0080, 0x116d: 0x0080, 0x116e: 0x0080, 0x116f: 0x0080, + 0x1170: 0x0080, 0x1171: 0x0080, 0x1172: 0x0080, 0x1173: 0x0080, 0x1174: 0x0080, 0x1175: 0x0080, + 0x1176: 0x0080, 0x1177: 0x0080, 0x1178: 0x0080, 0x1179: 0x0080, 0x117a: 0x0080, 0x117b: 0x0080, + 0x117c: 0x0080, + // Block 0x46, offset 0x1180 + 0x1180: 0x00c0, 0x1181: 0x00c0, 0x1182: 0x00c0, 0x1183: 0x00c0, 0x1184: 0x00c0, 0x1185: 0x00c0, + 0x1186: 0x00c0, 0x1187: 0x00c0, 0x1188: 0x00c0, 0x1189: 0x00c0, 0x118a: 0x00c0, 0x118b: 0x00c0, + 0x118c: 0x00c0, 0x118d: 0x00c0, 0x118e: 0x00c0, 0x118f: 0x00c0, 0x1190: 0x0080, 0x1191: 0x0080, + 0x1192: 0x0080, 0x1193: 0x0080, 0x1194: 0x0080, 0x1195: 0x0080, 0x1196: 0x0080, 0x1197: 0x0080, + 0x1198: 0x0080, 0x1199: 0x0080, + 0x11a0: 0x00c0, 0x11a1: 0x00c0, 0x11a2: 0x00c0, 0x11a3: 0x00c0, + 0x11a4: 0x00c0, 0x11a5: 0x00c0, 0x11a6: 0x00c0, 0x11a7: 0x00c0, 0x11a8: 0x00c0, 0x11a9: 0x00c0, + 0x11aa: 0x00c0, 0x11ab: 0x00c0, 0x11ac: 0x00c0, 0x11ad: 0x00c0, 0x11ae: 0x00c0, 0x11af: 0x00c0, + 0x11b0: 0x00c0, 0x11b1: 0x00c0, 0x11b2: 0x00c0, 0x11b3: 0x00c0, 0x11b4: 0x00c0, 0x11b5: 0x00c0, + 0x11b6: 0x00c0, 0x11b7: 0x00c0, 0x11b8: 0x00c0, 0x11b9: 0x00c0, 0x11ba: 0x00c0, 0x11bb: 0x00c0, + 0x11bc: 0x00c0, 0x11bd: 0x00c0, 0x11be: 0x00c0, 0x11bf: 0x00c0, + // Block 0x47, offset 0x11c0 + 0x11c0: 0x00c0, 0x11c1: 0x00c0, 0x11c2: 0x00c0, 0x11c3: 0x00c0, 0x11c4: 0x00c0, 0x11c5: 0x00c0, + 0x11c6: 0x00c0, 0x11c7: 0x00c0, 0x11c8: 0x00c0, 0x11c9: 0x00c0, 0x11ca: 0x00c0, 0x11cb: 0x00c0, + 0x11cc: 0x00c0, 0x11cd: 0x00c0, 0x11ce: 0x00c0, 0x11cf: 0x00c0, 0x11d0: 0x00c0, 0x11d1: 0x00c0, + 0x11d2: 0x00c0, 0x11d3: 0x00c0, 0x11d4: 0x00c0, 0x11d5: 0x00c0, 0x11d6: 0x00c0, 0x11d7: 0x00c0, + 0x11d8: 0x00c0, 0x11d9: 0x00c0, 0x11da: 0x00c0, 0x11db: 0x00c0, 0x11dc: 0x00c0, 0x11dd: 0x00c0, + 0x11de: 0x00c0, 0x11df: 0x00c0, 0x11e0: 0x00c0, 0x11e1: 0x00c0, 0x11e2: 0x00c0, 0x11e3: 0x00c0, + 0x11e4: 0x00c0, 0x11e5: 0x00c0, 0x11e6: 0x00c0, 0x11e7: 0x00c0, 0x11e8: 0x00c0, 0x11e9: 0x00c0, + 0x11ea: 0x00c0, 0x11eb: 0x00c0, 0x11ec: 0x00c0, 0x11ed: 0x00c0, 0x11ee: 0x00c0, 0x11ef: 0x00c0, + 0x11f0: 0x00c0, 0x11f1: 0x00c0, 0x11f2: 0x00c0, 0x11f3: 0x00c0, 0x11f4: 0x00c0, 0x11f5: 0x00c0, + 0x11f8: 0x00c0, 0x11f9: 0x00c0, 0x11fa: 0x00c0, 0x11fb: 0x00c0, + 0x11fc: 0x00c0, 0x11fd: 0x00c0, + // Block 0x48, offset 0x1200 + 0x1200: 0x0080, 0x1201: 0x00c0, 0x1202: 0x00c0, 0x1203: 0x00c0, 0x1204: 0x00c0, 0x1205: 0x00c0, + 0x1206: 0x00c0, 0x1207: 0x00c0, 0x1208: 0x00c0, 0x1209: 0x00c0, 0x120a: 0x00c0, 0x120b: 0x00c0, + 0x120c: 0x00c0, 0x120d: 0x00c0, 0x120e: 0x00c0, 0x120f: 0x00c0, 0x1210: 0x00c0, 0x1211: 0x00c0, + 0x1212: 0x00c0, 0x1213: 0x00c0, 0x1214: 0x00c0, 0x1215: 0x00c0, 0x1216: 0x00c0, 0x1217: 0x00c0, + 0x1218: 0x00c0, 0x1219: 0x00c0, 0x121a: 0x00c0, 0x121b: 0x00c0, 0x121c: 0x00c0, 0x121d: 0x00c0, + 0x121e: 0x00c0, 0x121f: 0x00c0, 0x1220: 0x00c0, 0x1221: 0x00c0, 0x1222: 0x00c0, 0x1223: 0x00c0, + 0x1224: 0x00c0, 0x1225: 0x00c0, 0x1226: 0x00c0, 0x1227: 0x00c0, 0x1228: 0x00c0, 0x1229: 0x00c0, + 0x122a: 0x00c0, 0x122b: 0x00c0, 0x122c: 0x00c0, 0x122d: 0x00c0, 0x122e: 0x00c0, 0x122f: 0x00c0, + 0x1230: 0x00c0, 0x1231: 0x00c0, 0x1232: 0x00c0, 0x1233: 0x00c0, 0x1234: 0x00c0, 0x1235: 0x00c0, + 0x1236: 0x00c0, 0x1237: 0x00c0, 0x1238: 0x00c0, 0x1239: 0x00c0, 0x123a: 0x00c0, 0x123b: 0x00c0, + 0x123c: 0x00c0, 0x123d: 0x00c0, 0x123e: 0x00c0, 0x123f: 0x00c0, + // Block 0x49, offset 0x1240 + 0x1240: 0x00c0, 0x1241: 0x00c0, 0x1242: 0x00c0, 0x1243: 0x00c0, 0x1244: 0x00c0, 0x1245: 0x00c0, + 0x1246: 0x00c0, 0x1247: 0x00c0, 0x1248: 0x00c0, 0x1249: 0x00c0, 0x124a: 0x00c0, 0x124b: 0x00c0, + 0x124c: 0x00c0, 0x124d: 0x00c0, 0x124e: 0x00c0, 0x124f: 0x00c0, 0x1250: 0x00c0, 0x1251: 0x00c0, + 0x1252: 0x00c0, 0x1253: 0x00c0, 0x1254: 0x00c0, 0x1255: 0x00c0, 0x1256: 0x00c0, 0x1257: 0x00c0, + 0x1258: 0x00c0, 0x1259: 0x00c0, 0x125a: 0x00c0, 0x125b: 0x00c0, 0x125c: 0x00c0, 0x125d: 0x00c0, + 0x125e: 0x00c0, 0x125f: 0x00c0, 0x1260: 0x00c0, 0x1261: 0x00c0, 0x1262: 0x00c0, 0x1263: 0x00c0, + 0x1264: 0x00c0, 0x1265: 0x00c0, 0x1266: 0x00c0, 0x1267: 0x00c0, 0x1268: 0x00c0, 0x1269: 0x00c0, + 0x126a: 0x00c0, 0x126b: 0x00c0, 0x126c: 0x00c0, 0x126d: 0x0080, 0x126e: 0x0080, 0x126f: 0x00c0, + 0x1270: 0x00c0, 0x1271: 0x00c0, 0x1272: 0x00c0, 0x1273: 0x00c0, 0x1274: 0x00c0, 0x1275: 0x00c0, + 0x1276: 0x00c0, 0x1277: 0x00c0, 0x1278: 0x00c0, 0x1279: 0x00c0, 0x127a: 0x00c0, 0x127b: 0x00c0, + 0x127c: 0x00c0, 0x127d: 0x00c0, 0x127e: 0x00c0, 0x127f: 0x00c0, + // Block 0x4a, offset 0x1280 + 0x1280: 0x0080, 0x1281: 0x00c0, 0x1282: 0x00c0, 0x1283: 0x00c0, 0x1284: 0x00c0, 0x1285: 0x00c0, + 0x1286: 0x00c0, 0x1287: 0x00c0, 0x1288: 0x00c0, 0x1289: 0x00c0, 0x128a: 0x00c0, 0x128b: 0x00c0, + 0x128c: 0x00c0, 0x128d: 0x00c0, 0x128e: 0x00c0, 0x128f: 0x00c0, 0x1290: 0x00c0, 0x1291: 0x00c0, + 0x1292: 0x00c0, 0x1293: 0x00c0, 0x1294: 0x00c0, 0x1295: 0x00c0, 0x1296: 0x00c0, 0x1297: 0x00c0, + 0x1298: 0x00c0, 0x1299: 0x00c0, 0x129a: 0x00c0, 0x129b: 0x0080, 0x129c: 0x0080, + 0x12a0: 0x00c0, 0x12a1: 0x00c0, 0x12a2: 0x00c0, 0x12a3: 0x00c0, + 0x12a4: 0x00c0, 0x12a5: 0x00c0, 0x12a6: 0x00c0, 0x12a7: 0x00c0, 0x12a8: 0x00c0, 0x12a9: 0x00c0, + 0x12aa: 0x00c0, 0x12ab: 0x00c0, 0x12ac: 0x00c0, 0x12ad: 0x00c0, 0x12ae: 0x00c0, 0x12af: 0x00c0, + 0x12b0: 0x00c0, 0x12b1: 0x00c0, 0x12b2: 0x00c0, 0x12b3: 0x00c0, 0x12b4: 0x00c0, 0x12b5: 0x00c0, + 0x12b6: 0x00c0, 0x12b7: 0x00c0, 0x12b8: 0x00c0, 0x12b9: 0x00c0, 0x12ba: 0x00c0, 0x12bb: 0x00c0, + 0x12bc: 0x00c0, 0x12bd: 0x00c0, 0x12be: 0x00c0, 0x12bf: 0x00c0, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x00c0, 0x12c1: 0x00c0, 0x12c2: 0x00c0, 0x12c3: 0x00c0, 0x12c4: 0x00c0, 0x12c5: 0x00c0, + 0x12c6: 0x00c0, 0x12c7: 0x00c0, 0x12c8: 0x00c0, 0x12c9: 0x00c0, 0x12ca: 0x00c0, 0x12cb: 0x00c0, + 0x12cc: 0x00c0, 0x12cd: 0x00c0, 0x12ce: 0x00c0, 0x12cf: 0x00c0, 0x12d0: 0x00c0, 0x12d1: 0x00c0, + 0x12d2: 0x00c0, 0x12d3: 0x00c0, 0x12d4: 0x00c0, 0x12d5: 0x00c0, 0x12d6: 0x00c0, 0x12d7: 0x00c0, + 0x12d8: 0x00c0, 0x12d9: 0x00c0, 0x12da: 0x00c0, 0x12db: 0x00c0, 0x12dc: 0x00c0, 0x12dd: 0x00c0, + 0x12de: 0x00c0, 0x12df: 0x00c0, 0x12e0: 0x00c0, 0x12e1: 0x00c0, 0x12e2: 0x00c0, 0x12e3: 0x00c0, + 0x12e4: 0x00c0, 0x12e5: 0x00c0, 0x12e6: 0x00c0, 0x12e7: 0x00c0, 0x12e8: 0x00c0, 0x12e9: 0x00c0, + 0x12ea: 0x00c0, 0x12eb: 0x0080, 0x12ec: 0x0080, 0x12ed: 0x0080, 0x12ee: 0x0080, 0x12ef: 0x0080, + 0x12f0: 0x0080, 0x12f1: 0x00c0, 0x12f2: 0x00c0, 0x12f3: 0x00c0, 0x12f4: 0x00c0, 0x12f5: 0x00c0, + 0x12f6: 0x00c0, 0x12f7: 0x00c0, 0x12f8: 0x00c0, + // Block 0x4c, offset 0x1300 + 0x1300: 0x00c0, 0x1301: 0x00c0, 0x1302: 0x00c0, 0x1303: 0x00c0, 0x1304: 0x00c0, 0x1305: 0x00c0, + 0x1306: 0x00c0, 0x1307: 0x00c0, 0x1308: 0x00c0, 0x1309: 0x00c0, 0x130a: 0x00c0, 0x130b: 0x00c0, + 0x130c: 0x00c0, 0x130e: 0x00c0, 0x130f: 0x00c0, 0x1310: 0x00c0, 0x1311: 0x00c0, + 0x1312: 0x00c3, 0x1313: 0x00c3, 0x1314: 0x00c6, + 0x1320: 0x00c0, 0x1321: 0x00c0, 0x1322: 0x00c0, 0x1323: 0x00c0, + 0x1324: 0x00c0, 0x1325: 0x00c0, 0x1326: 0x00c0, 0x1327: 0x00c0, 0x1328: 0x00c0, 0x1329: 0x00c0, + 0x132a: 0x00c0, 0x132b: 0x00c0, 0x132c: 0x00c0, 0x132d: 0x00c0, 0x132e: 0x00c0, 0x132f: 0x00c0, + 0x1330: 0x00c0, 0x1331: 0x00c0, 0x1332: 0x00c3, 0x1333: 0x00c3, 0x1334: 0x00c6, 0x1335: 0x0080, + 0x1336: 0x0080, + // Block 0x4d, offset 0x1340 + 0x1340: 0x00c0, 0x1341: 0x00c0, 0x1342: 0x00c0, 0x1343: 0x00c0, 0x1344: 0x00c0, 0x1345: 0x00c0, + 0x1346: 0x00c0, 0x1347: 0x00c0, 0x1348: 0x00c0, 0x1349: 0x00c0, 0x134a: 0x00c0, 0x134b: 0x00c0, + 0x134c: 0x00c0, 0x134d: 0x00c0, 0x134e: 0x00c0, 0x134f: 0x00c0, 0x1350: 0x00c0, 0x1351: 0x00c0, + 0x1352: 0x00c3, 0x1353: 0x00c3, + 0x1360: 0x00c0, 0x1361: 0x00c0, 0x1362: 0x00c0, 0x1363: 0x00c0, + 0x1364: 0x00c0, 0x1365: 0x00c0, 0x1366: 0x00c0, 0x1367: 0x00c0, 0x1368: 0x00c0, 0x1369: 0x00c0, + 0x136a: 0x00c0, 0x136b: 0x00c0, 0x136c: 0x00c0, 0x136e: 0x00c0, 0x136f: 0x00c0, + 0x1370: 0x00c0, 0x1372: 0x00c3, 0x1373: 0x00c3, + // Block 0x4e, offset 0x1380 + 0x1380: 0x00c0, 0x1381: 0x00c0, 0x1382: 0x00c0, 0x1383: 0x00c0, 0x1384: 0x00c0, 0x1385: 0x00c0, + 0x1386: 0x00c0, 0x1387: 0x00c0, 0x1388: 0x00c0, 0x1389: 0x00c0, 0x138a: 0x00c0, 0x138b: 0x00c0, + 0x138c: 0x00c0, 0x138d: 0x00c0, 0x138e: 0x00c0, 0x138f: 0x00c0, 0x1390: 0x00c0, 0x1391: 0x00c0, + 0x1392: 0x00c0, 0x1393: 0x00c0, 0x1394: 0x00c0, 0x1395: 0x00c0, 0x1396: 0x00c0, 0x1397: 0x00c0, + 0x1398: 0x00c0, 0x1399: 0x00c0, 0x139a: 0x00c0, 0x139b: 0x00c0, 0x139c: 0x00c0, 0x139d: 0x00c0, + 0x139e: 0x00c0, 0x139f: 0x00c0, 0x13a0: 0x00c0, 0x13a1: 0x00c0, 0x13a2: 0x00c0, 0x13a3: 0x00c0, + 0x13a4: 0x00c0, 0x13a5: 0x00c0, 0x13a6: 0x00c0, 0x13a7: 0x00c0, 0x13a8: 0x00c0, 0x13a9: 0x00c0, + 0x13aa: 0x00c0, 0x13ab: 0x00c0, 0x13ac: 0x00c0, 0x13ad: 0x00c0, 0x13ae: 0x00c0, 0x13af: 0x00c0, + 0x13b0: 0x00c0, 0x13b1: 0x00c0, 0x13b2: 0x00c0, 0x13b3: 0x00c0, 0x13b4: 0x0040, 0x13b5: 0x0040, + 0x13b6: 0x00c0, 0x13b7: 0x00c3, 0x13b8: 0x00c3, 0x13b9: 0x00c3, 0x13ba: 0x00c3, 0x13bb: 0x00c3, + 0x13bc: 0x00c3, 0x13bd: 0x00c3, 0x13be: 0x00c0, 0x13bf: 0x00c0, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x00c0, 0x13c1: 0x00c0, 0x13c2: 0x00c0, 0x13c3: 0x00c0, 0x13c4: 0x00c0, 0x13c5: 0x00c0, + 0x13c6: 0x00c3, 0x13c7: 0x00c0, 0x13c8: 0x00c0, 0x13c9: 0x00c3, 0x13ca: 0x00c3, 0x13cb: 0x00c3, + 0x13cc: 0x00c3, 0x13cd: 0x00c3, 0x13ce: 0x00c3, 0x13cf: 0x00c3, 0x13d0: 0x00c3, 0x13d1: 0x00c3, + 0x13d2: 0x00c6, 0x13d3: 0x00c3, 0x13d4: 0x0080, 0x13d5: 0x0080, 0x13d6: 0x0080, 0x13d7: 0x00c0, + 0x13d8: 0x0080, 0x13d9: 0x0080, 0x13da: 0x0080, 0x13db: 0x0080, 0x13dc: 0x00c0, 0x13dd: 0x00c3, + 0x13e0: 0x00c0, 0x13e1: 0x00c0, 0x13e2: 0x00c0, 0x13e3: 0x00c0, + 0x13e4: 0x00c0, 0x13e5: 0x00c0, 0x13e6: 0x00c0, 0x13e7: 0x00c0, 0x13e8: 0x00c0, 0x13e9: 0x00c0, + 0x13f0: 0x0080, 0x13f1: 0x0080, 0x13f2: 0x0080, 0x13f3: 0x0080, 0x13f4: 0x0080, 0x13f5: 0x0080, + 0x13f6: 0x0080, 0x13f7: 0x0080, 0x13f8: 0x0080, 0x13f9: 0x0080, + // Block 0x50, offset 0x1400 + 0x1400: 0x0080, 0x1401: 0x0080, 0x1402: 0x0080, 0x1403: 0x0080, 0x1404: 0x0080, 0x1405: 0x0080, + 0x1406: 0x0080, 0x1407: 0x0082, 0x1408: 0x0080, 0x1409: 0x0080, 0x140a: 0x0080, 0x140b: 0x0040, + 0x140c: 0x0040, 0x140d: 0x0040, 0x140e: 0x0040, 0x1410: 0x00c0, 0x1411: 0x00c0, + 0x1412: 0x00c0, 0x1413: 0x00c0, 0x1414: 0x00c0, 0x1415: 0x00c0, 0x1416: 0x00c0, 0x1417: 0x00c0, + 0x1418: 0x00c0, 0x1419: 0x00c0, + 0x1420: 0x00c2, 0x1421: 0x00c2, 0x1422: 0x00c2, 0x1423: 0x00c2, + 0x1424: 0x00c2, 0x1425: 0x00c2, 0x1426: 0x00c2, 0x1427: 0x00c2, 0x1428: 0x00c2, 0x1429: 0x00c2, + 0x142a: 0x00c2, 0x142b: 0x00c2, 0x142c: 0x00c2, 0x142d: 0x00c2, 0x142e: 0x00c2, 0x142f: 0x00c2, + 0x1430: 0x00c2, 0x1431: 0x00c2, 0x1432: 0x00c2, 0x1433: 0x00c2, 0x1434: 0x00c2, 0x1435: 0x00c2, + 0x1436: 0x00c2, 0x1437: 0x00c2, 0x1438: 0x00c2, 0x1439: 0x00c2, 0x143a: 0x00c2, 0x143b: 0x00c2, + 0x143c: 0x00c2, 0x143d: 0x00c2, 0x143e: 0x00c2, 0x143f: 0x00c2, + // Block 0x51, offset 0x1440 + 0x1440: 0x00c2, 0x1441: 0x00c2, 0x1442: 0x00c2, 0x1443: 0x00c2, 0x1444: 0x00c2, 0x1445: 0x00c2, + 0x1446: 0x00c2, 0x1447: 0x00c2, 0x1448: 0x00c2, 0x1449: 0x00c2, 0x144a: 0x00c2, 0x144b: 0x00c2, + 0x144c: 0x00c2, 0x144d: 0x00c2, 0x144e: 0x00c2, 0x144f: 0x00c2, 0x1450: 0x00c2, 0x1451: 0x00c2, + 0x1452: 0x00c2, 0x1453: 0x00c2, 0x1454: 0x00c2, 0x1455: 0x00c2, 0x1456: 0x00c2, 0x1457: 0x00c2, + 0x1458: 0x00c2, 0x1459: 0x00c2, 0x145a: 0x00c2, 0x145b: 0x00c2, 0x145c: 0x00c2, 0x145d: 0x00c2, + 0x145e: 0x00c2, 0x145f: 0x00c2, 0x1460: 0x00c2, 0x1461: 0x00c2, 0x1462: 0x00c2, 0x1463: 0x00c2, + 0x1464: 0x00c2, 0x1465: 0x00c2, 0x1466: 0x00c2, 0x1467: 0x00c2, 0x1468: 0x00c2, 0x1469: 0x00c2, + 0x146a: 0x00c2, 0x146b: 0x00c2, 0x146c: 0x00c2, 0x146d: 0x00c2, 0x146e: 0x00c2, 0x146f: 0x00c2, + 0x1470: 0x00c2, 0x1471: 0x00c2, 0x1472: 0x00c2, 0x1473: 0x00c2, 0x1474: 0x00c2, 0x1475: 0x00c2, + 0x1476: 0x00c2, 0x1477: 0x00c2, + // Block 0x52, offset 0x1480 + 0x1480: 0x00c0, 0x1481: 0x00c0, 0x1482: 0x00c0, 0x1483: 0x00c0, 0x1484: 0x00c0, 0x1485: 0x00c3, + 0x1486: 0x00c3, 0x1487: 0x00c2, 0x1488: 0x00c2, 0x1489: 0x00c2, 0x148a: 0x00c2, 0x148b: 0x00c2, + 0x148c: 0x00c2, 0x148d: 0x00c2, 0x148e: 0x00c2, 0x148f: 0x00c2, 0x1490: 0x00c2, 0x1491: 0x00c2, + 0x1492: 0x00c2, 0x1493: 0x00c2, 0x1494: 0x00c2, 0x1495: 0x00c2, 0x1496: 0x00c2, 0x1497: 0x00c2, + 0x1498: 0x00c2, 0x1499: 0x00c2, 0x149a: 0x00c2, 0x149b: 0x00c2, 0x149c: 0x00c2, 0x149d: 0x00c2, + 0x149e: 0x00c2, 0x149f: 0x00c2, 0x14a0: 0x00c2, 0x14a1: 0x00c2, 0x14a2: 0x00c2, 0x14a3: 0x00c2, + 0x14a4: 0x00c2, 0x14a5: 0x00c2, 0x14a6: 0x00c2, 0x14a7: 0x00c2, 0x14a8: 0x00c2, 0x14a9: 0x00c3, + 0x14aa: 0x00c2, + 0x14b0: 0x00c0, 0x14b1: 0x00c0, 0x14b2: 0x00c0, 0x14b3: 0x00c0, 0x14b4: 0x00c0, 0x14b5: 0x00c0, + 0x14b6: 0x00c0, 0x14b7: 0x00c0, 0x14b8: 0x00c0, 0x14b9: 0x00c0, 0x14ba: 0x00c0, 0x14bb: 0x00c0, + 0x14bc: 0x00c0, 0x14bd: 0x00c0, 0x14be: 0x00c0, 0x14bf: 0x00c0, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x00c0, 0x14c1: 0x00c0, 0x14c2: 0x00c0, 0x14c3: 0x00c0, 0x14c4: 0x00c0, 0x14c5: 0x00c0, + 0x14c6: 0x00c0, 0x14c7: 0x00c0, 0x14c8: 0x00c0, 0x14c9: 0x00c0, 0x14ca: 0x00c0, 0x14cb: 0x00c0, + 0x14cc: 0x00c0, 0x14cd: 0x00c0, 0x14ce: 0x00c0, 0x14cf: 0x00c0, 0x14d0: 0x00c0, 0x14d1: 0x00c0, + 0x14d2: 0x00c0, 0x14d3: 0x00c0, 0x14d4: 0x00c0, 0x14d5: 0x00c0, 0x14d6: 0x00c0, 0x14d7: 0x00c0, + 0x14d8: 0x00c0, 0x14d9: 0x00c0, 0x14da: 0x00c0, 0x14db: 0x00c0, 0x14dc: 0x00c0, 0x14dd: 0x00c0, + 0x14de: 0x00c0, 0x14df: 0x00c0, 0x14e0: 0x00c0, 0x14e1: 0x00c0, 0x14e2: 0x00c0, 0x14e3: 0x00c0, + 0x14e4: 0x00c0, 0x14e5: 0x00c0, 0x14e6: 0x00c0, 0x14e7: 0x00c0, 0x14e8: 0x00c0, 0x14e9: 0x00c0, + 0x14ea: 0x00c0, 0x14eb: 0x00c0, 0x14ec: 0x00c0, 0x14ed: 0x00c0, 0x14ee: 0x00c0, 0x14ef: 0x00c0, + 0x14f0: 0x00c0, 0x14f1: 0x00c0, 0x14f2: 0x00c0, 0x14f3: 0x00c0, 0x14f4: 0x00c0, 0x14f5: 0x00c0, + // Block 0x54, offset 0x1500 + 0x1500: 0x00c0, 0x1501: 0x00c0, 0x1502: 0x00c0, 0x1503: 0x00c0, 0x1504: 0x00c0, 0x1505: 0x00c0, + 0x1506: 0x00c0, 0x1507: 0x00c0, 0x1508: 0x00c0, 0x1509: 0x00c0, 0x150a: 0x00c0, 0x150b: 0x00c0, + 0x150c: 0x00c0, 0x150d: 0x00c0, 0x150e: 0x00c0, 0x150f: 0x00c0, 0x1510: 0x00c0, 0x1511: 0x00c0, + 0x1512: 0x00c0, 0x1513: 0x00c0, 0x1514: 0x00c0, 0x1515: 0x00c0, 0x1516: 0x00c0, 0x1517: 0x00c0, + 0x1518: 0x00c0, 0x1519: 0x00c0, 0x151a: 0x00c0, 0x151b: 0x00c0, 0x151c: 0x00c0, 0x151d: 0x00c0, + 0x151e: 0x00c0, 0x1520: 0x00c3, 0x1521: 0x00c3, 0x1522: 0x00c3, 0x1523: 0x00c0, + 0x1524: 0x00c0, 0x1525: 0x00c0, 0x1526: 0x00c0, 0x1527: 0x00c3, 0x1528: 0x00c3, 0x1529: 0x00c0, + 0x152a: 0x00c0, 0x152b: 0x00c0, + 0x1530: 0x00c0, 0x1531: 0x00c0, 0x1532: 0x00c3, 0x1533: 0x00c0, 0x1534: 0x00c0, 0x1535: 0x00c0, + 0x1536: 0x00c0, 0x1537: 0x00c0, 0x1538: 0x00c0, 0x1539: 0x00c3, 0x153a: 0x00c3, 0x153b: 0x00c3, + // Block 0x55, offset 0x1540 + 0x1540: 0x0080, 0x1544: 0x0080, 0x1545: 0x0080, + 0x1546: 0x00c0, 0x1547: 0x00c0, 0x1548: 0x00c0, 0x1549: 0x00c0, 0x154a: 0x00c0, 0x154b: 0x00c0, + 0x154c: 0x00c0, 0x154d: 0x00c0, 0x154e: 0x00c0, 0x154f: 0x00c0, 0x1550: 0x00c0, 0x1551: 0x00c0, + 0x1552: 0x00c0, 0x1553: 0x00c0, 0x1554: 0x00c0, 0x1555: 0x00c0, 0x1556: 0x00c0, 0x1557: 0x00c0, + 0x1558: 0x00c0, 0x1559: 0x00c0, 0x155a: 0x00c0, 0x155b: 0x00c0, 0x155c: 0x00c0, 0x155d: 0x00c0, + 0x155e: 0x00c0, 0x155f: 0x00c0, 0x1560: 0x00c0, 0x1561: 0x00c0, 0x1562: 0x00c0, 0x1563: 0x00c0, + 0x1564: 0x00c0, 0x1565: 0x00c0, 0x1566: 0x00c0, 0x1567: 0x00c0, 0x1568: 0x00c0, 0x1569: 0x00c0, + 0x156a: 0x00c0, 0x156b: 0x00c0, 0x156c: 0x00c0, 0x156d: 0x00c0, + 0x1570: 0x00c0, 0x1571: 0x00c0, 0x1572: 0x00c0, 0x1573: 0x00c0, 0x1574: 0x00c0, + // Block 0x56, offset 0x1580 + 0x1580: 0x00c0, 0x1581: 0x00c0, 0x1582: 0x00c0, 0x1583: 0x00c0, 0x1584: 0x00c0, 0x1585: 0x00c0, + 0x1586: 0x00c0, 0x1587: 0x00c0, 0x1588: 0x00c0, 0x1589: 0x00c0, 0x158a: 0x00c0, 0x158b: 0x00c0, + 0x158c: 0x00c0, 0x158d: 0x00c0, 0x158e: 0x00c0, 0x158f: 0x00c0, 0x1590: 0x00c0, 0x1591: 0x00c0, + 0x1592: 0x00c0, 0x1593: 0x00c0, 0x1594: 0x00c0, 0x1595: 0x00c0, 0x1596: 0x00c0, 0x1597: 0x00c0, + 0x1598: 0x00c0, 0x1599: 0x00c0, 0x159a: 0x00c0, 0x159b: 0x00c0, 0x159c: 0x00c0, 0x159d: 0x00c0, + 0x159e: 0x00c0, 0x159f: 0x00c0, 0x15a0: 0x00c0, 0x15a1: 0x00c0, 0x15a2: 0x00c0, 0x15a3: 0x00c0, + 0x15a4: 0x00c0, 0x15a5: 0x00c0, 0x15a6: 0x00c0, 0x15a7: 0x00c0, 0x15a8: 0x00c0, 0x15a9: 0x00c0, + 0x15aa: 0x00c0, 0x15ab: 0x00c0, + 0x15b0: 0x00c0, 0x15b1: 0x00c0, 0x15b2: 0x00c0, 0x15b3: 0x00c0, 0x15b4: 0x00c0, 0x15b5: 0x00c0, + 0x15b6: 0x00c0, 0x15b7: 0x00c0, 0x15b8: 0x00c0, 0x15b9: 0x00c0, 0x15ba: 0x00c0, 0x15bb: 0x00c0, + 0x15bc: 0x00c0, 0x15bd: 0x00c0, 0x15be: 0x00c0, 0x15bf: 0x00c0, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x00c0, 0x15c1: 0x00c0, 0x15c2: 0x00c0, 0x15c3: 0x00c0, 0x15c4: 0x00c0, 0x15c5: 0x00c0, + 0x15c6: 0x00c0, 0x15c7: 0x00c0, 0x15c8: 0x00c0, 0x15c9: 0x00c0, + 0x15d0: 0x00c0, 0x15d1: 0x00c0, + 0x15d2: 0x00c0, 0x15d3: 0x00c0, 0x15d4: 0x00c0, 0x15d5: 0x00c0, 0x15d6: 0x00c0, 0x15d7: 0x00c0, + 0x15d8: 0x00c0, 0x15d9: 0x00c0, 0x15da: 0x0080, + 0x15de: 0x0080, 0x15df: 0x0080, 0x15e0: 0x0080, 0x15e1: 0x0080, 0x15e2: 0x0080, 0x15e3: 0x0080, + 0x15e4: 0x0080, 0x15e5: 0x0080, 0x15e6: 0x0080, 0x15e7: 0x0080, 0x15e8: 0x0080, 0x15e9: 0x0080, + 0x15ea: 0x0080, 0x15eb: 0x0080, 0x15ec: 0x0080, 0x15ed: 0x0080, 0x15ee: 0x0080, 0x15ef: 0x0080, + 0x15f0: 0x0080, 0x15f1: 0x0080, 0x15f2: 0x0080, 0x15f3: 0x0080, 0x15f4: 0x0080, 0x15f5: 0x0080, + 0x15f6: 0x0080, 0x15f7: 0x0080, 0x15f8: 0x0080, 0x15f9: 0x0080, 0x15fa: 0x0080, 0x15fb: 0x0080, + 0x15fc: 0x0080, 0x15fd: 0x0080, 0x15fe: 0x0080, 0x15ff: 0x0080, + // Block 0x58, offset 0x1600 + 0x1600: 0x00c0, 0x1601: 0x00c0, 0x1602: 0x00c0, 0x1603: 0x00c0, 0x1604: 0x00c0, 0x1605: 0x00c0, + 0x1606: 0x00c0, 0x1607: 0x00c0, 0x1608: 0x00c0, 0x1609: 0x00c0, 0x160a: 0x00c0, 0x160b: 0x00c0, + 0x160c: 0x00c0, 0x160d: 0x00c0, 0x160e: 0x00c0, 0x160f: 0x00c0, 0x1610: 0x00c0, 0x1611: 0x00c0, + 0x1612: 0x00c0, 0x1613: 0x00c0, 0x1614: 0x00c0, 0x1615: 0x00c0, 0x1616: 0x00c0, 0x1617: 0x00c3, + 0x1618: 0x00c3, 0x1619: 0x00c0, 0x161a: 0x00c0, 0x161b: 0x00c3, + 0x161e: 0x0080, 0x161f: 0x0080, 0x1620: 0x00c0, 0x1621: 0x00c0, 0x1622: 0x00c0, 0x1623: 0x00c0, + 0x1624: 0x00c0, 0x1625: 0x00c0, 0x1626: 0x00c0, 0x1627: 0x00c0, 0x1628: 0x00c0, 0x1629: 0x00c0, + 0x162a: 0x00c0, 0x162b: 0x00c0, 0x162c: 0x00c0, 0x162d: 0x00c0, 0x162e: 0x00c0, 0x162f: 0x00c0, + 0x1630: 0x00c0, 0x1631: 0x00c0, 0x1632: 0x00c0, 0x1633: 0x00c0, 0x1634: 0x00c0, 0x1635: 0x00c0, + 0x1636: 0x00c0, 0x1637: 0x00c0, 0x1638: 0x00c0, 0x1639: 0x00c0, 0x163a: 0x00c0, 0x163b: 0x00c0, + 0x163c: 0x00c0, 0x163d: 0x00c0, 0x163e: 0x00c0, 0x163f: 0x00c0, + // Block 0x59, offset 0x1640 + 0x1640: 0x00c0, 0x1641: 0x00c0, 0x1642: 0x00c0, 0x1643: 0x00c0, 0x1644: 0x00c0, 0x1645: 0x00c0, + 0x1646: 0x00c0, 0x1647: 0x00c0, 0x1648: 0x00c0, 0x1649: 0x00c0, 0x164a: 0x00c0, 0x164b: 0x00c0, + 0x164c: 0x00c0, 0x164d: 0x00c0, 0x164e: 0x00c0, 0x164f: 0x00c0, 0x1650: 0x00c0, 0x1651: 0x00c0, + 0x1652: 0x00c0, 0x1653: 0x00c0, 0x1654: 0x00c0, 0x1655: 0x00c0, 0x1656: 0x00c3, 0x1657: 0x00c0, + 0x1658: 0x00c3, 0x1659: 0x00c3, 0x165a: 0x00c3, 0x165b: 0x00c3, 0x165c: 0x00c3, 0x165d: 0x00c3, + 0x165e: 0x00c3, 0x1660: 0x00c6, 0x1661: 0x00c0, 0x1662: 0x00c3, 0x1663: 0x00c0, + 0x1664: 0x00c0, 0x1665: 0x00c3, 0x1666: 0x00c3, 0x1667: 0x00c3, 0x1668: 0x00c3, 0x1669: 0x00c3, + 0x166a: 0x00c3, 0x166b: 0x00c3, 0x166c: 0x00c3, 0x166d: 0x00c0, 0x166e: 0x00c0, 0x166f: 0x00c0, + 0x1670: 0x00c0, 0x1671: 0x00c0, 0x1672: 0x00c0, 0x1673: 0x00c3, 0x1674: 0x00c3, 0x1675: 0x00c3, + 0x1676: 0x00c3, 0x1677: 0x00c3, 0x1678: 0x00c3, 0x1679: 0x00c3, 0x167a: 0x00c3, 0x167b: 0x00c3, + 0x167c: 0x00c3, 0x167f: 0x00c3, + // Block 0x5a, offset 0x1680 + 0x1680: 0x00c0, 0x1681: 0x00c0, 0x1682: 0x00c0, 0x1683: 0x00c0, 0x1684: 0x00c0, 0x1685: 0x00c0, + 0x1686: 0x00c0, 0x1687: 0x00c0, 0x1688: 0x00c0, 0x1689: 0x00c0, + 0x1690: 0x00c0, 0x1691: 0x00c0, + 0x1692: 0x00c0, 0x1693: 0x00c0, 0x1694: 0x00c0, 0x1695: 0x00c0, 0x1696: 0x00c0, 0x1697: 0x00c0, + 0x1698: 0x00c0, 0x1699: 0x00c0, + 0x16a0: 0x0080, 0x16a1: 0x0080, 0x16a2: 0x0080, 0x16a3: 0x0080, + 0x16a4: 0x0080, 0x16a5: 0x0080, 0x16a6: 0x0080, 0x16a7: 0x00c0, 0x16a8: 0x0080, 0x16a9: 0x0080, + 0x16aa: 0x0080, 0x16ab: 0x0080, 0x16ac: 0x0080, 0x16ad: 0x0080, + 0x16b0: 0x00c3, 0x16b1: 0x00c3, 0x16b2: 0x00c3, 0x16b3: 0x00c3, 0x16b4: 0x00c3, 0x16b5: 0x00c3, + 0x16b6: 0x00c3, 0x16b7: 0x00c3, 0x16b8: 0x00c3, 0x16b9: 0x00c3, 0x16ba: 0x00c3, 0x16bb: 0x00c3, + 0x16bc: 0x00c3, 0x16bd: 0x00c3, 0x16be: 0x0083, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x00c3, 0x16c1: 0x00c3, 0x16c2: 0x00c3, 0x16c3: 0x00c3, 0x16c4: 0x00c0, 0x16c5: 0x00c0, + 0x16c6: 0x00c0, 0x16c7: 0x00c0, 0x16c8: 0x00c0, 0x16c9: 0x00c0, 0x16ca: 0x00c0, 0x16cb: 0x00c0, + 0x16cc: 0x00c0, 0x16cd: 0x00c0, 0x16ce: 0x00c0, 0x16cf: 0x00c0, 0x16d0: 0x00c0, 0x16d1: 0x00c0, + 0x16d2: 0x00c0, 0x16d3: 0x00c0, 0x16d4: 0x00c0, 0x16d5: 0x00c0, 0x16d6: 0x00c0, 0x16d7: 0x00c0, + 0x16d8: 0x00c0, 0x16d9: 0x00c0, 0x16da: 0x00c0, 0x16db: 0x00c0, 0x16dc: 0x00c0, 0x16dd: 0x00c0, + 0x16de: 0x00c0, 0x16df: 0x00c0, 0x16e0: 0x00c0, 0x16e1: 0x00c0, 0x16e2: 0x00c0, 0x16e3: 0x00c0, + 0x16e4: 0x00c0, 0x16e5: 0x00c0, 0x16e6: 0x00c0, 0x16e7: 0x00c0, 0x16e8: 0x00c0, 0x16e9: 0x00c0, + 0x16ea: 0x00c0, 0x16eb: 0x00c0, 0x16ec: 0x00c0, 0x16ed: 0x00c0, 0x16ee: 0x00c0, 0x16ef: 0x00c0, + 0x16f0: 0x00c0, 0x16f1: 0x00c0, 0x16f2: 0x00c0, 0x16f3: 0x00c0, 0x16f4: 0x00c3, 0x16f5: 0x00c0, + 0x16f6: 0x00c3, 0x16f7: 0x00c3, 0x16f8: 0x00c3, 0x16f9: 0x00c3, 0x16fa: 0x00c3, 0x16fb: 0x00c0, + 0x16fc: 0x00c3, 0x16fd: 0x00c0, 0x16fe: 0x00c0, 0x16ff: 0x00c0, + // Block 0x5c, offset 0x1700 + 0x1700: 0x00c0, 0x1701: 0x00c0, 0x1702: 0x00c3, 0x1703: 0x00c0, 0x1704: 0x00c5, 0x1705: 0x00c0, + 0x1706: 0x00c0, 0x1707: 0x00c0, 0x1708: 0x00c0, 0x1709: 0x00c0, 0x170a: 0x00c0, 0x170b: 0x00c0, + 0x1710: 0x00c0, 0x1711: 0x00c0, + 0x1712: 0x00c0, 0x1713: 0x00c0, 0x1714: 0x00c0, 0x1715: 0x00c0, 0x1716: 0x00c0, 0x1717: 0x00c0, + 0x1718: 0x00c0, 0x1719: 0x00c0, 0x171a: 0x0080, 0x171b: 0x0080, 0x171c: 0x0080, 0x171d: 0x0080, + 0x171e: 0x0080, 0x171f: 0x0080, 0x1720: 0x0080, 0x1721: 0x0080, 0x1722: 0x0080, 0x1723: 0x0080, + 0x1724: 0x0080, 0x1725: 0x0080, 0x1726: 0x0080, 0x1727: 0x0080, 0x1728: 0x0080, 0x1729: 0x0080, + 0x172a: 0x0080, 0x172b: 0x00c3, 0x172c: 0x00c3, 0x172d: 0x00c3, 0x172e: 0x00c3, 0x172f: 0x00c3, + 0x1730: 0x00c3, 0x1731: 0x00c3, 0x1732: 0x00c3, 0x1733: 0x00c3, 0x1734: 0x0080, 0x1735: 0x0080, + 0x1736: 0x0080, 0x1737: 0x0080, 0x1738: 0x0080, 0x1739: 0x0080, 0x173a: 0x0080, 0x173b: 0x0080, + 0x173c: 0x0080, + // Block 0x5d, offset 0x1740 + 0x1740: 0x00c3, 0x1741: 0x00c3, 0x1742: 0x00c0, 0x1743: 0x00c0, 0x1744: 0x00c0, 0x1745: 0x00c0, + 0x1746: 0x00c0, 0x1747: 0x00c0, 0x1748: 0x00c0, 0x1749: 0x00c0, 0x174a: 0x00c0, 0x174b: 0x00c0, + 0x174c: 0x00c0, 0x174d: 0x00c0, 0x174e: 0x00c0, 0x174f: 0x00c0, 0x1750: 0x00c0, 0x1751: 0x00c0, + 0x1752: 0x00c0, 0x1753: 0x00c0, 0x1754: 0x00c0, 0x1755: 0x00c0, 0x1756: 0x00c0, 0x1757: 0x00c0, + 0x1758: 0x00c0, 0x1759: 0x00c0, 0x175a: 0x00c0, 0x175b: 0x00c0, 0x175c: 0x00c0, 0x175d: 0x00c0, + 0x175e: 0x00c0, 0x175f: 0x00c0, 0x1760: 0x00c0, 0x1761: 0x00c0, 0x1762: 0x00c3, 0x1763: 0x00c3, + 0x1764: 0x00c3, 0x1765: 0x00c3, 0x1766: 0x00c0, 0x1767: 0x00c0, 0x1768: 0x00c3, 0x1769: 0x00c3, + 0x176a: 0x00c5, 0x176b: 0x00c6, 0x176c: 0x00c3, 0x176d: 0x00c3, 0x176e: 0x00c0, 0x176f: 0x00c0, + 0x1770: 0x00c0, 0x1771: 0x00c0, 0x1772: 0x00c0, 0x1773: 0x00c0, 0x1774: 0x00c0, 0x1775: 0x00c0, + 0x1776: 0x00c0, 0x1777: 0x00c0, 0x1778: 0x00c0, 0x1779: 0x00c0, 0x177a: 0x00c0, 0x177b: 0x00c0, + 0x177c: 0x00c0, 0x177d: 0x00c0, 0x177e: 0x00c0, 0x177f: 0x00c0, + // Block 0x5e, offset 0x1780 + 0x1780: 0x00c0, 0x1781: 0x00c0, 0x1782: 0x00c0, 0x1783: 0x00c0, 0x1784: 0x00c0, 0x1785: 0x00c0, + 0x1786: 0x00c0, 0x1787: 0x00c0, 0x1788: 0x00c0, 0x1789: 0x00c0, 0x178a: 0x00c0, 0x178b: 0x00c0, + 0x178c: 0x00c0, 0x178d: 0x00c0, 0x178e: 0x00c0, 0x178f: 0x00c0, 0x1790: 0x00c0, 0x1791: 0x00c0, + 0x1792: 0x00c0, 0x1793: 0x00c0, 0x1794: 0x00c0, 0x1795: 0x00c0, 0x1796: 0x00c0, 0x1797: 0x00c0, + 0x1798: 0x00c0, 0x1799: 0x00c0, 0x179a: 0x00c0, 0x179b: 0x00c0, 0x179c: 0x00c0, 0x179d: 0x00c0, + 0x179e: 0x00c0, 0x179f: 0x00c0, 0x17a0: 0x00c0, 0x17a1: 0x00c0, 0x17a2: 0x00c0, 0x17a3: 0x00c0, + 0x17a4: 0x00c0, 0x17a5: 0x00c0, 0x17a6: 0x00c3, 0x17a7: 0x00c0, 0x17a8: 0x00c3, 0x17a9: 0x00c3, + 0x17aa: 0x00c0, 0x17ab: 0x00c0, 0x17ac: 0x00c0, 0x17ad: 0x00c3, 0x17ae: 0x00c0, 0x17af: 0x00c3, + 0x17b0: 0x00c3, 0x17b1: 0x00c3, 0x17b2: 0x00c5, 0x17b3: 0x00c5, + 0x17bc: 0x0080, 0x17bd: 0x0080, 0x17be: 0x0080, 0x17bf: 0x0080, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x00c0, 0x17c1: 0x00c0, 0x17c2: 0x00c0, 0x17c3: 0x00c0, 0x17c4: 0x00c0, 0x17c5: 0x00c0, + 0x17c6: 0x00c0, 0x17c7: 0x00c0, 0x17c8: 0x00c0, 0x17c9: 0x00c0, 0x17ca: 0x00c0, 0x17cb: 0x00c0, + 0x17cc: 0x00c0, 0x17cd: 0x00c0, 0x17ce: 0x00c0, 0x17cf: 0x00c0, 0x17d0: 0x00c0, 0x17d1: 0x00c0, + 0x17d2: 0x00c0, 0x17d3: 0x00c0, 0x17d4: 0x00c0, 0x17d5: 0x00c0, 0x17d6: 0x00c0, 0x17d7: 0x00c0, + 0x17d8: 0x00c0, 0x17d9: 0x00c0, 0x17da: 0x00c0, 0x17db: 0x00c0, 0x17dc: 0x00c0, 0x17dd: 0x00c0, + 0x17de: 0x00c0, 0x17df: 0x00c0, 0x17e0: 0x00c0, 0x17e1: 0x00c0, 0x17e2: 0x00c0, 0x17e3: 0x00c0, + 0x17e4: 0x00c0, 0x17e5: 0x00c0, 0x17e6: 0x00c0, 0x17e7: 0x00c0, 0x17e8: 0x00c0, 0x17e9: 0x00c0, + 0x17ea: 0x00c0, 0x17eb: 0x00c0, 0x17ec: 0x00c3, 0x17ed: 0x00c3, 0x17ee: 0x00c3, 0x17ef: 0x00c3, + 0x17f0: 0x00c3, 0x17f1: 0x00c3, 0x17f2: 0x00c3, 0x17f3: 0x00c3, 0x17f4: 0x00c0, 0x17f5: 0x00c0, + 0x17f6: 0x00c3, 0x17f7: 0x00c3, 0x17fb: 0x0080, + 0x17fc: 0x0080, 0x17fd: 0x0080, 0x17fe: 0x0080, 0x17ff: 0x0080, + // Block 0x60, offset 0x1800 + 0x1800: 0x00c0, 0x1801: 0x00c0, 0x1802: 0x00c0, 0x1803: 0x00c0, 0x1804: 0x00c0, 0x1805: 0x00c0, + 0x1806: 0x00c0, 0x1807: 0x00c0, 0x1808: 0x00c0, 0x1809: 0x00c0, + 0x180d: 0x00c0, 0x180e: 0x00c0, 0x180f: 0x00c0, 0x1810: 0x00c0, 0x1811: 0x00c0, + 0x1812: 0x00c0, 0x1813: 0x00c0, 0x1814: 0x00c0, 0x1815: 0x00c0, 0x1816: 0x00c0, 0x1817: 0x00c0, + 0x1818: 0x00c0, 0x1819: 0x00c0, 0x181a: 0x00c0, 0x181b: 0x00c0, 0x181c: 0x00c0, 0x181d: 0x00c0, + 0x181e: 0x00c0, 0x181f: 0x00c0, 0x1820: 0x00c0, 0x1821: 0x00c0, 0x1822: 0x00c0, 0x1823: 0x00c0, + 0x1824: 0x00c0, 0x1825: 0x00c0, 0x1826: 0x00c0, 0x1827: 0x00c0, 0x1828: 0x00c0, 0x1829: 0x00c0, + 0x182a: 0x00c0, 0x182b: 0x00c0, 0x182c: 0x00c0, 0x182d: 0x00c0, 0x182e: 0x00c0, 0x182f: 0x00c0, + 0x1830: 0x00c0, 0x1831: 0x00c0, 0x1832: 0x00c0, 0x1833: 0x00c0, 0x1834: 0x00c0, 0x1835: 0x00c0, + 0x1836: 0x00c0, 0x1837: 0x00c0, 0x1838: 0x00c0, 0x1839: 0x00c0, 0x183a: 0x00c0, 0x183b: 0x00c0, + 0x183c: 0x00c0, 0x183d: 0x00c0, 0x183e: 0x0080, 0x183f: 0x0080, + // Block 0x61, offset 0x1840 + 0x1840: 0x00c0, 0x1841: 0x00c0, 0x1842: 0x00c0, 0x1843: 0x00c0, 0x1844: 0x00c0, 0x1845: 0x00c0, + 0x1846: 0x00c0, 0x1847: 0x00c0, 0x1848: 0x00c0, + // Block 0x62, offset 0x1880 + 0x1880: 0x0080, 0x1881: 0x0080, 0x1882: 0x0080, 0x1883: 0x0080, 0x1884: 0x0080, 0x1885: 0x0080, + 0x1886: 0x0080, 0x1887: 0x0080, + 0x1890: 0x00c3, 0x1891: 0x00c3, + 0x1892: 0x00c3, 0x1893: 0x0080, 0x1894: 0x00c3, 0x1895: 0x00c3, 0x1896: 0x00c3, 0x1897: 0x00c3, + 0x1898: 0x00c3, 0x1899: 0x00c3, 0x189a: 0x00c3, 0x189b: 0x00c3, 0x189c: 0x00c3, 0x189d: 0x00c3, + 0x189e: 0x00c3, 0x189f: 0x00c3, 0x18a0: 0x00c3, 0x18a1: 0x00c0, 0x18a2: 0x00c3, 0x18a3: 0x00c3, + 0x18a4: 0x00c3, 0x18a5: 0x00c3, 0x18a6: 0x00c3, 0x18a7: 0x00c3, 0x18a8: 0x00c3, 0x18a9: 0x00c0, + 0x18aa: 0x00c0, 0x18ab: 0x00c0, 0x18ac: 0x00c0, 0x18ad: 0x00c3, 0x18ae: 0x00c0, 0x18af: 0x00c0, + 0x18b0: 0x00c0, 0x18b1: 0x00c0, 0x18b2: 0x00c0, 0x18b3: 0x00c0, 0x18b4: 0x00c3, 0x18b5: 0x00c0, + 0x18b6: 0x00c0, 0x18b8: 0x00c3, 0x18b9: 0x00c3, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x00c0, 0x18c1: 0x00c0, 0x18c2: 0x00c0, 0x18c3: 0x00c0, 0x18c4: 0x00c0, 0x18c5: 0x00c0, + 0x18c6: 0x00c0, 0x18c7: 0x00c0, 0x18c8: 0x00c0, 0x18c9: 0x00c0, 0x18ca: 0x00c0, 0x18cb: 0x00c0, + 0x18cc: 0x00c0, 0x18cd: 0x00c0, 0x18ce: 0x00c0, 0x18cf: 0x00c0, 0x18d0: 0x00c0, 0x18d1: 0x00c0, + 0x18d2: 0x00c0, 0x18d3: 0x00c0, 0x18d4: 0x00c0, 0x18d5: 0x00c0, 0x18d6: 0x00c0, 0x18d7: 0x00c0, + 0x18d8: 0x00c0, 0x18d9: 0x00c0, 0x18da: 0x00c0, 0x18db: 0x00c0, 0x18dc: 0x00c0, 0x18dd: 0x00c0, + 0x18de: 0x00c0, 0x18df: 0x00c0, 0x18e0: 0x00c0, 0x18e1: 0x00c0, 0x18e2: 0x00c0, 0x18e3: 0x00c0, + 0x18e4: 0x00c0, 0x18e5: 0x00c0, 0x18e6: 0x00c8, 0x18e7: 0x00c8, 0x18e8: 0x00c8, 0x18e9: 0x00c8, + 0x18ea: 0x00c8, 0x18eb: 0x00c0, 0x18ec: 0x0080, 0x18ed: 0x0080, 0x18ee: 0x0080, 0x18ef: 0x00c0, + 0x18f0: 0x0080, 0x18f1: 0x0080, 0x18f2: 0x0080, 0x18f3: 0x0080, 0x18f4: 0x0080, 0x18f5: 0x0080, + 0x18f6: 0x0080, 0x18f7: 0x0080, 0x18f8: 0x0080, 0x18f9: 0x0080, 0x18fa: 0x0080, 0x18fb: 0x00c0, + 0x18fc: 0x0080, 0x18fd: 0x0080, 0x18fe: 0x0080, 0x18ff: 0x0080, + // Block 0x64, offset 0x1900 + 0x1900: 0x0080, 0x1901: 0x0080, 0x1902: 0x0080, 0x1903: 0x0080, 0x1904: 0x0080, 0x1905: 0x0080, + 0x1906: 0x0080, 0x1907: 0x0080, 0x1908: 0x0080, 0x1909: 0x0080, 0x190a: 0x0080, 0x190b: 0x0080, + 0x190c: 0x0080, 0x190d: 0x0080, 0x190e: 0x00c0, 0x190f: 0x0080, 0x1910: 0x0080, 0x1911: 0x0080, + 0x1912: 0x0080, 0x1913: 0x0080, 0x1914: 0x0080, 0x1915: 0x0080, 0x1916: 0x0080, 0x1917: 0x0080, + 0x1918: 0x0080, 0x1919: 0x0080, 0x191a: 0x0080, 0x191b: 0x0080, 0x191c: 0x0080, 0x191d: 0x0088, + 0x191e: 0x0088, 0x191f: 0x0088, 0x1920: 0x0088, 0x1921: 0x0088, 0x1922: 0x0080, 0x1923: 0x0080, + 0x1924: 0x0080, 0x1925: 0x0080, 0x1926: 0x0088, 0x1927: 0x0088, 0x1928: 0x0088, 0x1929: 0x0088, + 0x192a: 0x0088, 0x192b: 0x00c0, 0x192c: 0x00c0, 0x192d: 0x00c0, 0x192e: 0x00c0, 0x192f: 0x00c0, + 0x1930: 0x00c0, 0x1931: 0x00c0, 0x1932: 0x00c0, 0x1933: 0x00c0, 0x1934: 0x00c0, 0x1935: 0x00c0, + 0x1936: 0x00c0, 0x1937: 0x00c0, 0x1938: 0x0080, 0x1939: 0x00c0, 0x193a: 0x00c0, 0x193b: 0x00c0, + 0x193c: 0x00c0, 0x193d: 0x00c0, 0x193e: 0x00c0, 0x193f: 0x00c0, + // Block 0x65, offset 0x1940 + 0x1940: 0x00c0, 0x1941: 0x00c0, 0x1942: 0x00c0, 0x1943: 0x00c0, 0x1944: 0x00c0, 0x1945: 0x00c0, + 0x1946: 0x00c0, 0x1947: 0x00c0, 0x1948: 0x00c0, 0x1949: 0x00c0, 0x194a: 0x00c0, 0x194b: 0x00c0, + 0x194c: 0x00c0, 0x194d: 0x00c0, 0x194e: 0x00c0, 0x194f: 0x00c0, 0x1950: 0x00c0, 0x1951: 0x00c0, + 0x1952: 0x00c0, 0x1953: 0x00c0, 0x1954: 0x00c0, 0x1955: 0x00c0, 0x1956: 0x00c0, 0x1957: 0x00c0, + 0x1958: 0x00c0, 0x1959: 0x00c0, 0x195a: 0x00c0, 0x195b: 0x0080, 0x195c: 0x0080, 0x195d: 0x0080, + 0x195e: 0x0080, 0x195f: 0x0080, 0x1960: 0x0080, 0x1961: 0x0080, 0x1962: 0x0080, 0x1963: 0x0080, + 0x1964: 0x0080, 0x1965: 0x0080, 0x1966: 0x0080, 0x1967: 0x0080, 0x1968: 0x0080, 0x1969: 0x0080, + 0x196a: 0x0080, 0x196b: 0x0080, 0x196c: 0x0080, 0x196d: 0x0080, 0x196e: 0x0080, 0x196f: 0x0080, + 0x1970: 0x0080, 0x1971: 0x0080, 0x1972: 0x0080, 0x1973: 0x0080, 0x1974: 0x0080, 0x1975: 0x0080, + 0x1976: 0x0080, 0x1977: 0x0080, 0x1978: 0x0080, 0x1979: 0x0080, 0x197a: 0x0080, 0x197b: 0x0080, + 0x197c: 0x0080, 0x197d: 0x0080, 0x197e: 0x0080, 0x197f: 0x0088, + // Block 0x66, offset 0x1980 + 0x1980: 0x00c3, 0x1981: 0x00c3, 0x1982: 0x00c3, 0x1983: 0x00c3, 0x1984: 0x00c3, 0x1985: 0x00c3, + 0x1986: 0x00c3, 0x1987: 0x00c3, 0x1988: 0x00c3, 0x1989: 0x00c3, 0x198a: 0x00c3, 0x198b: 0x00c3, + 0x198c: 0x00c3, 0x198d: 0x00c3, 0x198e: 0x00c3, 0x198f: 0x00c3, 0x1990: 0x00c3, 0x1991: 0x00c3, + 0x1992: 0x00c3, 0x1993: 0x00c3, 0x1994: 0x00c3, 0x1995: 0x00c3, 0x1996: 0x00c3, 0x1997: 0x00c3, + 0x1998: 0x00c3, 0x1999: 0x00c3, 0x199a: 0x00c3, 0x199b: 0x00c3, 0x199c: 0x00c3, 0x199d: 0x00c3, + 0x199e: 0x00c3, 0x199f: 0x00c3, 0x19a0: 0x00c3, 0x19a1: 0x00c3, 0x19a2: 0x00c3, 0x19a3: 0x00c3, + 0x19a4: 0x00c3, 0x19a5: 0x00c3, 0x19a6: 0x00c3, 0x19a7: 0x00c3, 0x19a8: 0x00c3, 0x19a9: 0x00c3, + 0x19aa: 0x00c3, 0x19ab: 0x00c3, 0x19ac: 0x00c3, 0x19ad: 0x00c3, 0x19ae: 0x00c3, 0x19af: 0x00c3, + 0x19b0: 0x00c3, 0x19b1: 0x00c3, 0x19b2: 0x00c3, 0x19b3: 0x00c3, 0x19b4: 0x00c3, 0x19b5: 0x00c3, + 0x19bb: 0x00c3, + 0x19bc: 0x00c3, 0x19bd: 0x00c3, 0x19be: 0x00c3, 0x19bf: 0x00c3, + // Block 0x67, offset 0x19c0 + 0x19c0: 0x00c0, 0x19c1: 0x00c0, 0x19c2: 0x00c0, 0x19c3: 0x00c0, 0x19c4: 0x00c0, 0x19c5: 0x00c0, + 0x19c6: 0x00c0, 0x19c7: 0x00c0, 0x19c8: 0x00c0, 0x19c9: 0x00c0, 0x19ca: 0x00c0, 0x19cb: 0x00c0, + 0x19cc: 0x00c0, 0x19cd: 0x00c0, 0x19ce: 0x00c0, 0x19cf: 0x00c0, 0x19d0: 0x00c0, 0x19d1: 0x00c0, + 0x19d2: 0x00c0, 0x19d3: 0x00c0, 0x19d4: 0x00c0, 0x19d5: 0x00c0, 0x19d6: 0x00c0, 0x19d7: 0x00c0, + 0x19d8: 0x00c0, 0x19d9: 0x00c0, 0x19da: 0x0080, 0x19db: 0x0080, 0x19dc: 0x00c0, 0x19dd: 0x00c0, + 0x19de: 0x00c0, 0x19df: 0x00c0, 0x19e0: 0x00c0, 0x19e1: 0x00c0, 0x19e2: 0x00c0, 0x19e3: 0x00c0, + 0x19e4: 0x00c0, 0x19e5: 0x00c0, 0x19e6: 0x00c0, 0x19e7: 0x00c0, 0x19e8: 0x00c0, 0x19e9: 0x00c0, + 0x19ea: 0x00c0, 0x19eb: 0x00c0, 0x19ec: 0x00c0, 0x19ed: 0x00c0, 0x19ee: 0x00c0, 0x19ef: 0x00c0, + 0x19f0: 0x00c0, 0x19f1: 0x00c0, 0x19f2: 0x00c0, 0x19f3: 0x00c0, 0x19f4: 0x00c0, 0x19f5: 0x00c0, + 0x19f6: 0x00c0, 0x19f7: 0x00c0, 0x19f8: 0x00c0, 0x19f9: 0x00c0, 0x19fa: 0x00c0, 0x19fb: 0x00c0, + 0x19fc: 0x00c0, 0x19fd: 0x00c0, 0x19fe: 0x00c0, 0x19ff: 0x00c0, + // Block 0x68, offset 0x1a00 + 0x1a00: 0x00c8, 0x1a01: 0x00c8, 0x1a02: 0x00c8, 0x1a03: 0x00c8, 0x1a04: 0x00c8, 0x1a05: 0x00c8, + 0x1a06: 0x00c8, 0x1a07: 0x00c8, 0x1a08: 0x00c8, 0x1a09: 0x00c8, 0x1a0a: 0x00c8, 0x1a0b: 0x00c8, + 0x1a0c: 0x00c8, 0x1a0d: 0x00c8, 0x1a0e: 0x00c8, 0x1a0f: 0x00c8, 0x1a10: 0x00c8, 0x1a11: 0x00c8, + 0x1a12: 0x00c8, 0x1a13: 0x00c8, 0x1a14: 0x00c8, 0x1a15: 0x00c8, + 0x1a18: 0x00c8, 0x1a19: 0x00c8, 0x1a1a: 0x00c8, 0x1a1b: 0x00c8, 0x1a1c: 0x00c8, 0x1a1d: 0x00c8, + 0x1a20: 0x00c8, 0x1a21: 0x00c8, 0x1a22: 0x00c8, 0x1a23: 0x00c8, + 0x1a24: 0x00c8, 0x1a25: 0x00c8, 0x1a26: 0x00c8, 0x1a27: 0x00c8, 0x1a28: 0x00c8, 0x1a29: 0x00c8, + 0x1a2a: 0x00c8, 0x1a2b: 0x00c8, 0x1a2c: 0x00c8, 0x1a2d: 0x00c8, 0x1a2e: 0x00c8, 0x1a2f: 0x00c8, + 0x1a30: 0x00c8, 0x1a31: 0x00c8, 0x1a32: 0x00c8, 0x1a33: 0x00c8, 0x1a34: 0x00c8, 0x1a35: 0x00c8, + 0x1a36: 0x00c8, 0x1a37: 0x00c8, 0x1a38: 0x00c8, 0x1a39: 0x00c8, 0x1a3a: 0x00c8, 0x1a3b: 0x00c8, + 0x1a3c: 0x00c8, 0x1a3d: 0x00c8, 0x1a3e: 0x00c8, 0x1a3f: 0x00c8, + // Block 0x69, offset 0x1a40 + 0x1a40: 0x00c8, 0x1a41: 0x00c8, 0x1a42: 0x00c8, 0x1a43: 0x00c8, 0x1a44: 0x00c8, 0x1a45: 0x00c8, + 0x1a48: 0x00c8, 0x1a49: 0x00c8, 0x1a4a: 0x00c8, 0x1a4b: 0x00c8, + 0x1a4c: 0x00c8, 0x1a4d: 0x00c8, 0x1a50: 0x00c8, 0x1a51: 0x00c8, + 0x1a52: 0x00c8, 0x1a53: 0x00c8, 0x1a54: 0x00c8, 0x1a55: 0x00c8, 0x1a56: 0x00c8, 0x1a57: 0x00c8, + 0x1a59: 0x00c8, 0x1a5b: 0x00c8, 0x1a5d: 0x00c8, + 0x1a5f: 0x00c8, 0x1a60: 0x00c8, 0x1a61: 0x00c8, 0x1a62: 0x00c8, 0x1a63: 0x00c8, + 0x1a64: 0x00c8, 0x1a65: 0x00c8, 0x1a66: 0x00c8, 0x1a67: 0x00c8, 0x1a68: 0x00c8, 0x1a69: 0x00c8, + 0x1a6a: 0x00c8, 0x1a6b: 0x00c8, 0x1a6c: 0x00c8, 0x1a6d: 0x00c8, 0x1a6e: 0x00c8, 0x1a6f: 0x00c8, + 0x1a70: 0x00c8, 0x1a71: 0x0088, 0x1a72: 0x00c8, 0x1a73: 0x0088, 0x1a74: 0x00c8, 0x1a75: 0x0088, + 0x1a76: 0x00c8, 0x1a77: 0x0088, 0x1a78: 0x00c8, 0x1a79: 0x0088, 0x1a7a: 0x00c8, 0x1a7b: 0x0088, + 0x1a7c: 0x00c8, 0x1a7d: 0x0088, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x00c8, 0x1a81: 0x00c8, 0x1a82: 0x00c8, 0x1a83: 0x00c8, 0x1a84: 0x00c8, 0x1a85: 0x00c8, + 0x1a86: 0x00c8, 0x1a87: 0x00c8, 0x1a88: 0x0088, 0x1a89: 0x0088, 0x1a8a: 0x0088, 0x1a8b: 0x0088, + 0x1a8c: 0x0088, 0x1a8d: 0x0088, 0x1a8e: 0x0088, 0x1a8f: 0x0088, 0x1a90: 0x00c8, 0x1a91: 0x00c8, + 0x1a92: 0x00c8, 0x1a93: 0x00c8, 0x1a94: 0x00c8, 0x1a95: 0x00c8, 0x1a96: 0x00c8, 0x1a97: 0x00c8, + 0x1a98: 0x0088, 0x1a99: 0x0088, 0x1a9a: 0x0088, 0x1a9b: 0x0088, 0x1a9c: 0x0088, 0x1a9d: 0x0088, + 0x1a9e: 0x0088, 0x1a9f: 0x0088, 0x1aa0: 0x00c8, 0x1aa1: 0x00c8, 0x1aa2: 0x00c8, 0x1aa3: 0x00c8, + 0x1aa4: 0x00c8, 0x1aa5: 0x00c8, 0x1aa6: 0x00c8, 0x1aa7: 0x00c8, 0x1aa8: 0x0088, 0x1aa9: 0x0088, + 0x1aaa: 0x0088, 0x1aab: 0x0088, 0x1aac: 0x0088, 0x1aad: 0x0088, 0x1aae: 0x0088, 0x1aaf: 0x0088, + 0x1ab0: 0x00c8, 0x1ab1: 0x00c8, 0x1ab2: 0x00c8, 0x1ab3: 0x00c8, 0x1ab4: 0x00c8, + 0x1ab6: 0x00c8, 0x1ab7: 0x00c8, 0x1ab8: 0x00c8, 0x1ab9: 0x00c8, 0x1aba: 0x00c8, 0x1abb: 0x0088, + 0x1abc: 0x0088, 0x1abd: 0x0088, 0x1abe: 0x0088, 0x1abf: 0x0088, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x0088, 0x1ac1: 0x0088, 0x1ac2: 0x00c8, 0x1ac3: 0x00c8, 0x1ac4: 0x00c8, + 0x1ac6: 0x00c8, 0x1ac7: 0x00c8, 0x1ac8: 0x00c8, 0x1ac9: 0x0088, 0x1aca: 0x00c8, 0x1acb: 0x0088, + 0x1acc: 0x0088, 0x1acd: 0x0088, 0x1ace: 0x0088, 0x1acf: 0x0088, 0x1ad0: 0x00c8, 0x1ad1: 0x00c8, + 0x1ad2: 0x00c8, 0x1ad3: 0x0088, 0x1ad6: 0x00c8, 0x1ad7: 0x00c8, + 0x1ad8: 0x00c8, 0x1ad9: 0x00c8, 0x1ada: 0x00c8, 0x1adb: 0x0088, 0x1add: 0x0088, + 0x1ade: 0x0088, 0x1adf: 0x0088, 0x1ae0: 0x00c8, 0x1ae1: 0x00c8, 0x1ae2: 0x00c8, 0x1ae3: 0x0088, + 0x1ae4: 0x00c8, 0x1ae5: 0x00c8, 0x1ae6: 0x00c8, 0x1ae7: 0x00c8, 0x1ae8: 0x00c8, 0x1ae9: 0x00c8, + 0x1aea: 0x00c8, 0x1aeb: 0x0088, 0x1aec: 0x00c8, 0x1aed: 0x0088, 0x1aee: 0x0088, 0x1aef: 0x0088, + 0x1af2: 0x00c8, 0x1af3: 0x00c8, 0x1af4: 0x00c8, + 0x1af6: 0x00c8, 0x1af7: 0x00c8, 0x1af8: 0x00c8, 0x1af9: 0x0088, 0x1afa: 0x00c8, 0x1afb: 0x0088, + 0x1afc: 0x0088, 0x1afd: 0x0088, 0x1afe: 0x0088, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x0080, 0x1b01: 0x0080, 0x1b02: 0x0080, 0x1b03: 0x0080, 0x1b04: 0x0080, 0x1b05: 0x0080, + 0x1b06: 0x0080, 0x1b07: 0x0080, 0x1b08: 0x0080, 0x1b09: 0x0080, 0x1b0a: 0x0080, 0x1b0b: 0x0040, + 0x1b0c: 0x004d, 0x1b0d: 0x004e, 0x1b0e: 0x0040, 0x1b0f: 0x0040, 0x1b10: 0x0080, 0x1b11: 0x0080, + 0x1b12: 0x0080, 0x1b13: 0x0080, 0x1b14: 0x0080, 0x1b15: 0x0080, 0x1b16: 0x0080, 0x1b17: 0x0080, + 0x1b18: 0x0080, 0x1b19: 0x0080, 0x1b1a: 0x0080, 0x1b1b: 0x0080, 0x1b1c: 0x0080, 0x1b1d: 0x0080, + 0x1b1e: 0x0080, 0x1b1f: 0x0080, 0x1b20: 0x0080, 0x1b21: 0x0080, 0x1b22: 0x0080, 0x1b23: 0x0080, + 0x1b24: 0x0080, 0x1b25: 0x0080, 0x1b26: 0x0080, 0x1b27: 0x0080, 0x1b28: 0x0040, 0x1b29: 0x0040, + 0x1b2a: 0x0040, 0x1b2b: 0x0040, 0x1b2c: 0x0040, 0x1b2d: 0x0040, 0x1b2e: 0x0040, 0x1b2f: 0x0080, + 0x1b30: 0x0080, 0x1b31: 0x0080, 0x1b32: 0x0080, 0x1b33: 0x0080, 0x1b34: 0x0080, 0x1b35: 0x0080, + 0x1b36: 0x0080, 0x1b37: 0x0080, 0x1b38: 0x0080, 0x1b39: 0x0080, 0x1b3a: 0x0080, 0x1b3b: 0x0080, + 0x1b3c: 0x0080, 0x1b3d: 0x0080, 0x1b3e: 0x0080, 0x1b3f: 0x0080, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x0080, 0x1b41: 0x0080, 0x1b42: 0x0080, 0x1b43: 0x0080, 0x1b44: 0x0080, 0x1b45: 0x0080, + 0x1b46: 0x0080, 0x1b47: 0x0080, 0x1b48: 0x0080, 0x1b49: 0x0080, 0x1b4a: 0x0080, 0x1b4b: 0x0080, + 0x1b4c: 0x0080, 0x1b4d: 0x0080, 0x1b4e: 0x0080, 0x1b4f: 0x0080, 0x1b50: 0x0080, 0x1b51: 0x0080, + 0x1b52: 0x0080, 0x1b53: 0x0080, 0x1b54: 0x0080, 0x1b55: 0x0080, 0x1b56: 0x0080, 0x1b57: 0x0080, + 0x1b58: 0x0080, 0x1b59: 0x0080, 0x1b5a: 0x0080, 0x1b5b: 0x0080, 0x1b5c: 0x0080, 0x1b5d: 0x0080, + 0x1b5e: 0x0080, 0x1b5f: 0x0080, 0x1b60: 0x0040, 0x1b61: 0x0040, 0x1b62: 0x0040, 0x1b63: 0x0040, + 0x1b64: 0x0040, 0x1b66: 0x0040, 0x1b67: 0x0040, 0x1b68: 0x0040, 0x1b69: 0x0040, + 0x1b6a: 0x0040, 0x1b6b: 0x0040, 0x1b6c: 0x0040, 0x1b6d: 0x0040, 0x1b6e: 0x0040, 0x1b6f: 0x0040, + 0x1b70: 0x0080, 0x1b71: 0x0080, 0x1b74: 0x0080, 0x1b75: 0x0080, + 0x1b76: 0x0080, 0x1b77: 0x0080, 0x1b78: 0x0080, 0x1b79: 0x0080, 0x1b7a: 0x0080, 0x1b7b: 0x0080, + 0x1b7c: 0x0080, 0x1b7d: 0x0080, 0x1b7e: 0x0080, 0x1b7f: 0x0080, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x0080, 0x1b81: 0x0080, 0x1b82: 0x0080, 0x1b83: 0x0080, 0x1b84: 0x0080, 0x1b85: 0x0080, + 0x1b86: 0x0080, 0x1b87: 0x0080, 0x1b88: 0x0080, 0x1b89: 0x0080, 0x1b8a: 0x0080, 0x1b8b: 0x0080, + 0x1b8c: 0x0080, 0x1b8d: 0x0080, 0x1b8e: 0x0080, 0x1b90: 0x0080, 0x1b91: 0x0080, + 0x1b92: 0x0080, 0x1b93: 0x0080, 0x1b94: 0x0080, 0x1b95: 0x0080, 0x1b96: 0x0080, 0x1b97: 0x0080, + 0x1b98: 0x0080, 0x1b99: 0x0080, 0x1b9a: 0x0080, 0x1b9b: 0x0080, 0x1b9c: 0x0080, + 0x1ba0: 0x0080, 0x1ba1: 0x0080, 0x1ba2: 0x0080, 0x1ba3: 0x0080, + 0x1ba4: 0x0080, 0x1ba5: 0x0080, 0x1ba6: 0x0080, 0x1ba7: 0x0080, 0x1ba8: 0x0080, 0x1ba9: 0x0080, + 0x1baa: 0x0080, 0x1bab: 0x0080, 0x1bac: 0x0080, 0x1bad: 0x0080, 0x1bae: 0x0080, 0x1baf: 0x0080, + 0x1bb0: 0x0080, 0x1bb1: 0x0080, 0x1bb2: 0x0080, 0x1bb3: 0x0080, 0x1bb4: 0x0080, 0x1bb5: 0x0080, + 0x1bb6: 0x0080, 0x1bb7: 0x0080, 0x1bb8: 0x0080, 0x1bb9: 0x0080, 0x1bba: 0x0080, 0x1bbb: 0x0080, + 0x1bbc: 0x0080, 0x1bbd: 0x0080, 0x1bbe: 0x0080, + // Block 0x6f, offset 0x1bc0 + 0x1bd0: 0x00c3, 0x1bd1: 0x00c3, + 0x1bd2: 0x00c3, 0x1bd3: 0x00c3, 0x1bd4: 0x00c3, 0x1bd5: 0x00c3, 0x1bd6: 0x00c3, 0x1bd7: 0x00c3, + 0x1bd8: 0x00c3, 0x1bd9: 0x00c3, 0x1bda: 0x00c3, 0x1bdb: 0x00c3, 0x1bdc: 0x00c3, 0x1bdd: 0x0083, + 0x1bde: 0x0083, 0x1bdf: 0x0083, 0x1be0: 0x0083, 0x1be1: 0x00c3, 0x1be2: 0x0083, 0x1be3: 0x0083, + 0x1be4: 0x0083, 0x1be5: 0x00c3, 0x1be6: 0x00c3, 0x1be7: 0x00c3, 0x1be8: 0x00c3, 0x1be9: 0x00c3, + 0x1bea: 0x00c3, 0x1beb: 0x00c3, 0x1bec: 0x00c3, 0x1bed: 0x00c3, 0x1bee: 0x00c3, 0x1bef: 0x00c3, + 0x1bf0: 0x00c3, + // Block 0x70, offset 0x1c00 + 0x1c00: 0x0080, 0x1c01: 0x0080, 0x1c02: 0x0080, 0x1c03: 0x0080, 0x1c04: 0x0080, 0x1c05: 0x0080, + 0x1c06: 0x0080, 0x1c07: 0x0080, 0x1c08: 0x0080, 0x1c09: 0x0080, 0x1c0a: 0x0080, 0x1c0b: 0x0080, + 0x1c0c: 0x0080, 0x1c0d: 0x0080, 0x1c0e: 0x0080, 0x1c0f: 0x0080, 0x1c10: 0x0080, 0x1c11: 0x0080, + 0x1c12: 0x0080, 0x1c13: 0x0080, 0x1c14: 0x0080, 0x1c15: 0x0080, 0x1c16: 0x0080, 0x1c17: 0x0080, + 0x1c18: 0x0080, 0x1c19: 0x0080, 0x1c1a: 0x0080, 0x1c1b: 0x0080, 0x1c1c: 0x0080, 0x1c1d: 0x0080, + 0x1c1e: 0x0080, 0x1c1f: 0x0080, 0x1c20: 0x0080, 0x1c21: 0x0080, 0x1c22: 0x0080, 0x1c23: 0x0080, + 0x1c24: 0x0080, 0x1c25: 0x0080, 0x1c26: 0x0088, 0x1c27: 0x0080, 0x1c28: 0x0080, 0x1c29: 0x0080, + 0x1c2a: 0x0080, 0x1c2b: 0x0080, 0x1c2c: 0x0080, 0x1c2d: 0x0080, 0x1c2e: 0x0080, 0x1c2f: 0x0080, + 0x1c30: 0x0080, 0x1c31: 0x0080, 0x1c32: 0x00c0, 0x1c33: 0x0080, 0x1c34: 0x0080, 0x1c35: 0x0080, + 0x1c36: 0x0080, 0x1c37: 0x0080, 0x1c38: 0x0080, 0x1c39: 0x0080, 0x1c3a: 0x0080, 0x1c3b: 0x0080, + 0x1c3c: 0x0080, 0x1c3d: 0x0080, 0x1c3e: 0x0080, 0x1c3f: 0x0080, + // Block 0x71, offset 0x1c40 + 0x1c40: 0x0080, 0x1c41: 0x0080, 0x1c42: 0x0080, 0x1c43: 0x0080, 0x1c44: 0x0080, 0x1c45: 0x0080, + 0x1c46: 0x0080, 0x1c47: 0x0080, 0x1c48: 0x0080, 0x1c49: 0x0080, 0x1c4a: 0x0080, 0x1c4b: 0x0080, + 0x1c4c: 0x0080, 0x1c4d: 0x0080, 0x1c4e: 0x00c0, 0x1c4f: 0x0080, 0x1c50: 0x0080, 0x1c51: 0x0080, + 0x1c52: 0x0080, 0x1c53: 0x0080, 0x1c54: 0x0080, 0x1c55: 0x0080, 0x1c56: 0x0080, 0x1c57: 0x0080, + 0x1c58: 0x0080, 0x1c59: 0x0080, 0x1c5a: 0x0080, 0x1c5b: 0x0080, 0x1c5c: 0x0080, 0x1c5d: 0x0080, + 0x1c5e: 0x0080, 0x1c5f: 0x0080, 0x1c60: 0x0080, 0x1c61: 0x0080, 0x1c62: 0x0080, 0x1c63: 0x0080, + 0x1c64: 0x0080, 0x1c65: 0x0080, 0x1c66: 0x0080, 0x1c67: 0x0080, 0x1c68: 0x0080, 0x1c69: 0x0080, + 0x1c6a: 0x0080, 0x1c6b: 0x0080, 0x1c6c: 0x0080, 0x1c6d: 0x0080, 0x1c6e: 0x0080, 0x1c6f: 0x0080, + 0x1c70: 0x0080, 0x1c71: 0x0080, 0x1c72: 0x0080, 0x1c73: 0x0080, 0x1c74: 0x0080, 0x1c75: 0x0080, + 0x1c76: 0x0080, 0x1c77: 0x0080, 0x1c78: 0x0080, 0x1c79: 0x0080, 0x1c7a: 0x0080, 0x1c7b: 0x0080, + 0x1c7c: 0x0080, 0x1c7d: 0x0080, 0x1c7e: 0x0080, 0x1c7f: 0x0080, + // Block 0x72, offset 0x1c80 + 0x1c80: 0x0080, 0x1c81: 0x0080, 0x1c82: 0x0080, 0x1c83: 0x00c0, 0x1c84: 0x00c0, 0x1c85: 0x0080, + 0x1c86: 0x0080, 0x1c87: 0x0080, 0x1c88: 0x0080, 0x1c89: 0x0080, 0x1c8a: 0x0080, 0x1c8b: 0x0080, + 0x1c90: 0x0080, 0x1c91: 0x0080, + 0x1c92: 0x0080, 0x1c93: 0x0080, 0x1c94: 0x0080, 0x1c95: 0x0080, 0x1c96: 0x0080, 0x1c97: 0x0080, + 0x1c98: 0x0080, 0x1c99: 0x0080, 0x1c9a: 0x0080, 0x1c9b: 0x0080, 0x1c9c: 0x0080, 0x1c9d: 0x0080, + 0x1c9e: 0x0080, 0x1c9f: 0x0080, 0x1ca0: 0x0080, 0x1ca1: 0x0080, 0x1ca2: 0x0080, 0x1ca3: 0x0080, + 0x1ca4: 0x0080, 0x1ca5: 0x0080, 0x1ca6: 0x0080, 0x1ca7: 0x0080, 0x1ca8: 0x0080, 0x1ca9: 0x0080, + 0x1caa: 0x0080, 0x1cab: 0x0080, 0x1cac: 0x0080, 0x1cad: 0x0080, 0x1cae: 0x0080, 0x1caf: 0x0080, + 0x1cb0: 0x0080, 0x1cb1: 0x0080, 0x1cb2: 0x0080, 0x1cb3: 0x0080, 0x1cb4: 0x0080, 0x1cb5: 0x0080, + 0x1cb6: 0x0080, 0x1cb7: 0x0080, 0x1cb8: 0x0080, 0x1cb9: 0x0080, 0x1cba: 0x0080, 0x1cbb: 0x0080, + 0x1cbc: 0x0080, 0x1cbd: 0x0080, 0x1cbe: 0x0080, 0x1cbf: 0x0080, + // Block 0x73, offset 0x1cc0 + 0x1cc0: 0x0080, 0x1cc1: 0x0080, 0x1cc2: 0x0080, 0x1cc3: 0x0080, 0x1cc4: 0x0080, 0x1cc5: 0x0080, + 0x1cc6: 0x0080, 0x1cc7: 0x0080, 0x1cc8: 0x0080, 0x1cc9: 0x0080, 0x1cca: 0x0080, 0x1ccb: 0x0080, + 0x1ccc: 0x0080, 0x1ccd: 0x0080, 0x1cce: 0x0080, 0x1ccf: 0x0080, 0x1cd0: 0x0080, 0x1cd1: 0x0080, + 0x1cd2: 0x0080, 0x1cd3: 0x0080, 0x1cd4: 0x0080, 0x1cd5: 0x0080, 0x1cd6: 0x0080, 0x1cd7: 0x0080, + 0x1cd8: 0x0080, 0x1cd9: 0x0080, 0x1cda: 0x0080, 0x1cdb: 0x0080, 0x1cdc: 0x0080, 0x1cdd: 0x0080, + 0x1cde: 0x0080, 0x1cdf: 0x0080, 0x1ce0: 0x0080, 0x1ce1: 0x0080, 0x1ce2: 0x0080, 0x1ce3: 0x0080, + 0x1ce4: 0x0080, 0x1ce5: 0x0080, 0x1ce6: 0x0080, 0x1ce7: 0x0080, 0x1ce8: 0x0080, 0x1ce9: 0x0080, + 0x1cea: 0x0080, 0x1ceb: 0x0080, 0x1cec: 0x0080, 0x1ced: 0x0080, 0x1cee: 0x0080, 0x1cef: 0x0080, + 0x1cf0: 0x0080, 0x1cf1: 0x0080, 0x1cf2: 0x0080, 0x1cf3: 0x0080, 0x1cf4: 0x0080, 0x1cf5: 0x0080, + 0x1cf6: 0x0080, 0x1cf7: 0x0080, 0x1cf8: 0x0080, 0x1cf9: 0x0080, 0x1cfa: 0x0080, 0x1cfb: 0x0080, + 0x1cfc: 0x0080, 0x1cfd: 0x0080, 0x1cfe: 0x0080, 0x1cff: 0x0080, + // Block 0x74, offset 0x1d00 + 0x1d00: 0x0080, 0x1d01: 0x0080, 0x1d02: 0x0080, 0x1d03: 0x0080, 0x1d04: 0x0080, 0x1d05: 0x0080, + 0x1d06: 0x0080, 0x1d07: 0x0080, 0x1d08: 0x0080, 0x1d09: 0x0080, 0x1d0a: 0x0080, 0x1d0b: 0x0080, + 0x1d0c: 0x0080, 0x1d0d: 0x0080, 0x1d0e: 0x0080, 0x1d0f: 0x0080, 0x1d10: 0x0080, 0x1d11: 0x0080, + 0x1d12: 0x0080, 0x1d13: 0x0080, 0x1d14: 0x0080, 0x1d15: 0x0080, 0x1d16: 0x0080, 0x1d17: 0x0080, + 0x1d18: 0x0080, 0x1d19: 0x0080, 0x1d1a: 0x0080, 0x1d1b: 0x0080, 0x1d1c: 0x0080, 0x1d1d: 0x0080, + 0x1d1e: 0x0080, 0x1d1f: 0x0080, 0x1d20: 0x0080, 0x1d21: 0x0080, 0x1d22: 0x0080, 0x1d23: 0x0080, + 0x1d24: 0x0080, 0x1d25: 0x0080, 0x1d26: 0x0080, 0x1d27: 0x0080, 0x1d28: 0x0080, 0x1d29: 0x0080, + 0x1d2a: 0x0080, 0x1d2b: 0x0080, 0x1d2c: 0x0080, 0x1d2d: 0x0080, 0x1d2e: 0x0080, 0x1d2f: 0x0080, + 0x1d30: 0x0080, 0x1d31: 0x0080, 0x1d32: 0x0080, 0x1d33: 0x0080, 0x1d34: 0x0080, 0x1d35: 0x0080, + 0x1d36: 0x0080, 0x1d37: 0x0080, 0x1d38: 0x0080, 0x1d39: 0x0080, 0x1d3a: 0x0080, 0x1d3b: 0x0080, + 0x1d3c: 0x0080, 0x1d3d: 0x0080, 0x1d3e: 0x0080, + // Block 0x75, offset 0x1d40 + 0x1d40: 0x0080, 0x1d41: 0x0080, 0x1d42: 0x0080, 0x1d43: 0x0080, 0x1d44: 0x0080, 0x1d45: 0x0080, + 0x1d46: 0x0080, 0x1d47: 0x0080, 0x1d48: 0x0080, 0x1d49: 0x0080, 0x1d4a: 0x0080, 0x1d4b: 0x0080, + 0x1d4c: 0x0080, 0x1d4d: 0x0080, 0x1d4e: 0x0080, 0x1d4f: 0x0080, 0x1d50: 0x0080, 0x1d51: 0x0080, + 0x1d52: 0x0080, 0x1d53: 0x0080, 0x1d54: 0x0080, 0x1d55: 0x0080, 0x1d56: 0x0080, 0x1d57: 0x0080, + 0x1d58: 0x0080, 0x1d59: 0x0080, 0x1d5a: 0x0080, 0x1d5b: 0x0080, 0x1d5c: 0x0080, 0x1d5d: 0x0080, + 0x1d5e: 0x0080, 0x1d5f: 0x0080, 0x1d60: 0x0080, 0x1d61: 0x0080, 0x1d62: 0x0080, 0x1d63: 0x0080, + 0x1d64: 0x0080, 0x1d65: 0x0080, 0x1d66: 0x0080, + // Block 0x76, offset 0x1d80 + 0x1d80: 0x0080, 0x1d81: 0x0080, 0x1d82: 0x0080, 0x1d83: 0x0080, 0x1d84: 0x0080, 0x1d85: 0x0080, + 0x1d86: 0x0080, 0x1d87: 0x0080, 0x1d88: 0x0080, 0x1d89: 0x0080, 0x1d8a: 0x0080, + 0x1da0: 0x0080, 0x1da1: 0x0080, 0x1da2: 0x0080, 0x1da3: 0x0080, + 0x1da4: 0x0080, 0x1da5: 0x0080, 0x1da6: 0x0080, 0x1da7: 0x0080, 0x1da8: 0x0080, 0x1da9: 0x0080, + 0x1daa: 0x0080, 0x1dab: 0x0080, 0x1dac: 0x0080, 0x1dad: 0x0080, 0x1dae: 0x0080, 0x1daf: 0x0080, + 0x1db0: 0x0080, 0x1db1: 0x0080, 0x1db2: 0x0080, 0x1db3: 0x0080, 0x1db4: 0x0080, 0x1db5: 0x0080, + 0x1db6: 0x0080, 0x1db7: 0x0080, 0x1db8: 0x0080, 0x1db9: 0x0080, 0x1dba: 0x0080, 0x1dbb: 0x0080, + 0x1dbc: 0x0080, 0x1dbd: 0x0080, 0x1dbe: 0x0080, 0x1dbf: 0x0080, + // Block 0x77, offset 0x1dc0 + 0x1dc0: 0x0080, 0x1dc1: 0x0080, 0x1dc2: 0x0080, 0x1dc3: 0x0080, 0x1dc4: 0x0080, 0x1dc5: 0x0080, + 0x1dc6: 0x0080, 0x1dc7: 0x0080, 0x1dc8: 0x0080, 0x1dc9: 0x0080, 0x1dca: 0x0080, 0x1dcb: 0x0080, + 0x1dcc: 0x0080, 0x1dcd: 0x0080, 0x1dce: 0x0080, 0x1dcf: 0x0080, 0x1dd0: 0x0080, 0x1dd1: 0x0080, + 0x1dd2: 0x0080, 0x1dd3: 0x0080, 0x1dd4: 0x0080, 0x1dd5: 0x0080, 0x1dd6: 0x0080, 0x1dd7: 0x0080, + 0x1dd8: 0x0080, 0x1dd9: 0x0080, 0x1dda: 0x0080, 0x1ddb: 0x0080, 0x1ddc: 0x0080, 0x1ddd: 0x0080, + 0x1dde: 0x0080, 0x1ddf: 0x0080, 0x1de0: 0x0080, 0x1de1: 0x0080, 0x1de2: 0x0080, 0x1de3: 0x0080, + 0x1de4: 0x0080, 0x1de5: 0x0080, 0x1de6: 0x0080, 0x1de7: 0x0080, 0x1de8: 0x0080, 0x1de9: 0x0080, + 0x1dea: 0x0080, 0x1deb: 0x0080, 0x1dec: 0x0080, 0x1ded: 0x0080, 0x1dee: 0x0080, 0x1def: 0x0080, + 0x1df0: 0x0080, 0x1df1: 0x0080, 0x1df2: 0x0080, 0x1df3: 0x0080, + 0x1df6: 0x0080, 0x1df7: 0x0080, 0x1df8: 0x0080, 0x1df9: 0x0080, 0x1dfa: 0x0080, 0x1dfb: 0x0080, + 0x1dfc: 0x0080, 0x1dfd: 0x0080, 0x1dfe: 0x0080, 0x1dff: 0x0080, + // Block 0x78, offset 0x1e00 + 0x1e00: 0x0080, 0x1e01: 0x0080, 0x1e02: 0x0080, 0x1e03: 0x0080, 0x1e04: 0x0080, 0x1e05: 0x0080, + 0x1e06: 0x0080, 0x1e07: 0x0080, 0x1e08: 0x0080, 0x1e09: 0x0080, 0x1e0a: 0x0080, 0x1e0b: 0x0080, + 0x1e0c: 0x0080, 0x1e0d: 0x0080, 0x1e0e: 0x0080, 0x1e0f: 0x0080, 0x1e10: 0x0080, 0x1e11: 0x0080, + 0x1e12: 0x0080, 0x1e13: 0x0080, 0x1e14: 0x0080, 0x1e15: 0x0080, + 0x1e18: 0x0080, 0x1e19: 0x0080, 0x1e1a: 0x0080, 0x1e1b: 0x0080, 0x1e1c: 0x0080, 0x1e1d: 0x0080, + 0x1e1e: 0x0080, 0x1e1f: 0x0080, 0x1e20: 0x0080, 0x1e21: 0x0080, 0x1e22: 0x0080, 0x1e23: 0x0080, + 0x1e24: 0x0080, 0x1e25: 0x0080, 0x1e26: 0x0080, 0x1e27: 0x0080, 0x1e28: 0x0080, 0x1e29: 0x0080, + 0x1e2a: 0x0080, 0x1e2b: 0x0080, 0x1e2c: 0x0080, 0x1e2d: 0x0080, 0x1e2e: 0x0080, 0x1e2f: 0x0080, + 0x1e30: 0x0080, 0x1e31: 0x0080, 0x1e32: 0x0080, 0x1e33: 0x0080, 0x1e34: 0x0080, 0x1e35: 0x0080, + 0x1e36: 0x0080, 0x1e37: 0x0080, 0x1e38: 0x0080, 0x1e39: 0x0080, + 0x1e3d: 0x0080, 0x1e3e: 0x0080, 0x1e3f: 0x0080, + // Block 0x79, offset 0x1e40 + 0x1e40: 0x0080, 0x1e41: 0x0080, 0x1e42: 0x0080, 0x1e43: 0x0080, 0x1e44: 0x0080, 0x1e45: 0x0080, + 0x1e46: 0x0080, 0x1e47: 0x0080, 0x1e48: 0x0080, 0x1e4a: 0x0080, 0x1e4b: 0x0080, + 0x1e4c: 0x0080, 0x1e4d: 0x0080, 0x1e4e: 0x0080, 0x1e4f: 0x0080, 0x1e50: 0x0080, 0x1e51: 0x0080, + 0x1e6c: 0x0080, 0x1e6d: 0x0080, 0x1e6e: 0x0080, 0x1e6f: 0x0080, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0x00c0, 0x1e81: 0x00c0, 0x1e82: 0x00c0, 0x1e83: 0x00c0, 0x1e84: 0x00c0, 0x1e85: 0x00c0, + 0x1e86: 0x00c0, 0x1e87: 0x00c0, 0x1e88: 0x00c0, 0x1e89: 0x00c0, 0x1e8a: 0x00c0, 0x1e8b: 0x00c0, + 0x1e8c: 0x00c0, 0x1e8d: 0x00c0, 0x1e8e: 0x00c0, 0x1e8f: 0x00c0, 0x1e90: 0x00c0, 0x1e91: 0x00c0, + 0x1e92: 0x00c0, 0x1e93: 0x00c0, 0x1e94: 0x00c0, 0x1e95: 0x00c0, 0x1e96: 0x00c0, 0x1e97: 0x00c0, + 0x1e98: 0x00c0, 0x1e99: 0x00c0, 0x1e9a: 0x00c0, 0x1e9b: 0x00c0, 0x1e9c: 0x00c0, 0x1e9d: 0x00c0, + 0x1e9e: 0x00c0, 0x1e9f: 0x00c0, 0x1ea0: 0x00c0, 0x1ea1: 0x00c0, 0x1ea2: 0x00c0, 0x1ea3: 0x00c0, + 0x1ea4: 0x00c0, 0x1ea5: 0x00c0, 0x1ea6: 0x00c0, 0x1ea7: 0x00c0, 0x1ea8: 0x00c0, 0x1ea9: 0x00c0, + 0x1eaa: 0x00c0, 0x1eab: 0x00c0, 0x1eac: 0x00c0, 0x1ead: 0x00c0, 0x1eae: 0x00c0, + 0x1eb0: 0x00c0, 0x1eb1: 0x00c0, 0x1eb2: 0x00c0, 0x1eb3: 0x00c0, 0x1eb4: 0x00c0, 0x1eb5: 0x00c0, + 0x1eb6: 0x00c0, 0x1eb7: 0x00c0, 0x1eb8: 0x00c0, 0x1eb9: 0x00c0, 0x1eba: 0x00c0, 0x1ebb: 0x00c0, + 0x1ebc: 0x00c0, 0x1ebd: 0x00c0, 0x1ebe: 0x00c0, 0x1ebf: 0x00c0, + // Block 0x7b, offset 0x1ec0 + 0x1ec0: 0x00c0, 0x1ec1: 0x00c0, 0x1ec2: 0x00c0, 0x1ec3: 0x00c0, 0x1ec4: 0x00c0, 0x1ec5: 0x00c0, + 0x1ec6: 0x00c0, 0x1ec7: 0x00c0, 0x1ec8: 0x00c0, 0x1ec9: 0x00c0, 0x1eca: 0x00c0, 0x1ecb: 0x00c0, + 0x1ecc: 0x00c0, 0x1ecd: 0x00c0, 0x1ece: 0x00c0, 0x1ecf: 0x00c0, 0x1ed0: 0x00c0, 0x1ed1: 0x00c0, + 0x1ed2: 0x00c0, 0x1ed3: 0x00c0, 0x1ed4: 0x00c0, 0x1ed5: 0x00c0, 0x1ed6: 0x00c0, 0x1ed7: 0x00c0, + 0x1ed8: 0x00c0, 0x1ed9: 0x00c0, 0x1eda: 0x00c0, 0x1edb: 0x00c0, 0x1edc: 0x00c0, 0x1edd: 0x00c0, + 0x1ede: 0x00c0, 0x1ee0: 0x00c0, 0x1ee1: 0x00c0, 0x1ee2: 0x00c0, 0x1ee3: 0x00c0, + 0x1ee4: 0x00c0, 0x1ee5: 0x00c0, 0x1ee6: 0x00c0, 0x1ee7: 0x00c0, 0x1ee8: 0x00c0, 0x1ee9: 0x00c0, + 0x1eea: 0x00c0, 0x1eeb: 0x00c0, 0x1eec: 0x00c0, 0x1eed: 0x00c0, 0x1eee: 0x00c0, 0x1eef: 0x00c0, + 0x1ef0: 0x00c0, 0x1ef1: 0x00c0, 0x1ef2: 0x00c0, 0x1ef3: 0x00c0, 0x1ef4: 0x00c0, 0x1ef5: 0x00c0, + 0x1ef6: 0x00c0, 0x1ef7: 0x00c0, 0x1ef8: 0x00c0, 0x1ef9: 0x00c0, 0x1efa: 0x00c0, 0x1efb: 0x00c0, + 0x1efc: 0x0080, 0x1efd: 0x0080, 0x1efe: 0x00c0, 0x1eff: 0x00c0, + // Block 0x7c, offset 0x1f00 + 0x1f00: 0x00c0, 0x1f01: 0x00c0, 0x1f02: 0x00c0, 0x1f03: 0x00c0, 0x1f04: 0x00c0, 0x1f05: 0x00c0, + 0x1f06: 0x00c0, 0x1f07: 0x00c0, 0x1f08: 0x00c0, 0x1f09: 0x00c0, 0x1f0a: 0x00c0, 0x1f0b: 0x00c0, + 0x1f0c: 0x00c0, 0x1f0d: 0x00c0, 0x1f0e: 0x00c0, 0x1f0f: 0x00c0, 0x1f10: 0x00c0, 0x1f11: 0x00c0, + 0x1f12: 0x00c0, 0x1f13: 0x00c0, 0x1f14: 0x00c0, 0x1f15: 0x00c0, 0x1f16: 0x00c0, 0x1f17: 0x00c0, + 0x1f18: 0x00c0, 0x1f19: 0x00c0, 0x1f1a: 0x00c0, 0x1f1b: 0x00c0, 0x1f1c: 0x00c0, 0x1f1d: 0x00c0, + 0x1f1e: 0x00c0, 0x1f1f: 0x00c0, 0x1f20: 0x00c0, 0x1f21: 0x00c0, 0x1f22: 0x00c0, 0x1f23: 0x00c0, + 0x1f24: 0x00c0, 0x1f25: 0x0080, 0x1f26: 0x0080, 0x1f27: 0x0080, 0x1f28: 0x0080, 0x1f29: 0x0080, + 0x1f2a: 0x0080, 0x1f2b: 0x00c0, 0x1f2c: 0x00c0, 0x1f2d: 0x00c0, 0x1f2e: 0x00c0, 0x1f2f: 0x00c3, + 0x1f30: 0x00c3, 0x1f31: 0x00c3, 0x1f32: 0x00c0, 0x1f33: 0x00c0, + 0x1f39: 0x0080, 0x1f3a: 0x0080, 0x1f3b: 0x0080, + 0x1f3c: 0x0080, 0x1f3d: 0x0080, 0x1f3e: 0x0080, 0x1f3f: 0x0080, + // Block 0x7d, offset 0x1f40 + 0x1f40: 0x00c0, 0x1f41: 0x00c0, 0x1f42: 0x00c0, 0x1f43: 0x00c0, 0x1f44: 0x00c0, 0x1f45: 0x00c0, + 0x1f46: 0x00c0, 0x1f47: 0x00c0, 0x1f48: 0x00c0, 0x1f49: 0x00c0, 0x1f4a: 0x00c0, 0x1f4b: 0x00c0, + 0x1f4c: 0x00c0, 0x1f4d: 0x00c0, 0x1f4e: 0x00c0, 0x1f4f: 0x00c0, 0x1f50: 0x00c0, 0x1f51: 0x00c0, + 0x1f52: 0x00c0, 0x1f53: 0x00c0, 0x1f54: 0x00c0, 0x1f55: 0x00c0, 0x1f56: 0x00c0, 0x1f57: 0x00c0, + 0x1f58: 0x00c0, 0x1f59: 0x00c0, 0x1f5a: 0x00c0, 0x1f5b: 0x00c0, 0x1f5c: 0x00c0, 0x1f5d: 0x00c0, + 0x1f5e: 0x00c0, 0x1f5f: 0x00c0, 0x1f60: 0x00c0, 0x1f61: 0x00c0, 0x1f62: 0x00c0, 0x1f63: 0x00c0, + 0x1f64: 0x00c0, 0x1f65: 0x00c0, 0x1f67: 0x00c0, + 0x1f6d: 0x00c0, + 0x1f70: 0x00c0, 0x1f71: 0x00c0, 0x1f72: 0x00c0, 0x1f73: 0x00c0, 0x1f74: 0x00c0, 0x1f75: 0x00c0, + 0x1f76: 0x00c0, 0x1f77: 0x00c0, 0x1f78: 0x00c0, 0x1f79: 0x00c0, 0x1f7a: 0x00c0, 0x1f7b: 0x00c0, + 0x1f7c: 0x00c0, 0x1f7d: 0x00c0, 0x1f7e: 0x00c0, 0x1f7f: 0x00c0, + // Block 0x7e, offset 0x1f80 + 0x1f80: 0x00c0, 0x1f81: 0x00c0, 0x1f82: 0x00c0, 0x1f83: 0x00c0, 0x1f84: 0x00c0, 0x1f85: 0x00c0, + 0x1f86: 0x00c0, 0x1f87: 0x00c0, 0x1f88: 0x00c0, 0x1f89: 0x00c0, 0x1f8a: 0x00c0, 0x1f8b: 0x00c0, + 0x1f8c: 0x00c0, 0x1f8d: 0x00c0, 0x1f8e: 0x00c0, 0x1f8f: 0x00c0, 0x1f90: 0x00c0, 0x1f91: 0x00c0, + 0x1f92: 0x00c0, 0x1f93: 0x00c0, 0x1f94: 0x00c0, 0x1f95: 0x00c0, 0x1f96: 0x00c0, 0x1f97: 0x00c0, + 0x1f98: 0x00c0, 0x1f99: 0x00c0, 0x1f9a: 0x00c0, 0x1f9b: 0x00c0, 0x1f9c: 0x00c0, 0x1f9d: 0x00c0, + 0x1f9e: 0x00c0, 0x1f9f: 0x00c0, 0x1fa0: 0x00c0, 0x1fa1: 0x00c0, 0x1fa2: 0x00c0, 0x1fa3: 0x00c0, + 0x1fa4: 0x00c0, 0x1fa5: 0x00c0, 0x1fa6: 0x00c0, 0x1fa7: 0x00c0, + 0x1faf: 0x0080, + 0x1fb0: 0x0080, + 0x1fbf: 0x00c6, + // Block 0x7f, offset 0x1fc0 + 0x1fc0: 0x00c0, 0x1fc1: 0x00c0, 0x1fc2: 0x00c0, 0x1fc3: 0x00c0, 0x1fc4: 0x00c0, 0x1fc5: 0x00c0, + 0x1fc6: 0x00c0, 0x1fc7: 0x00c0, 0x1fc8: 0x00c0, 0x1fc9: 0x00c0, 0x1fca: 0x00c0, 0x1fcb: 0x00c0, + 0x1fcc: 0x00c0, 0x1fcd: 0x00c0, 0x1fce: 0x00c0, 0x1fcf: 0x00c0, 0x1fd0: 0x00c0, 0x1fd1: 0x00c0, + 0x1fd2: 0x00c0, 0x1fd3: 0x00c0, 0x1fd4: 0x00c0, 0x1fd5: 0x00c0, 0x1fd6: 0x00c0, + 0x1fe0: 0x00c0, 0x1fe1: 0x00c0, 0x1fe2: 0x00c0, 0x1fe3: 0x00c0, + 0x1fe4: 0x00c0, 0x1fe5: 0x00c0, 0x1fe6: 0x00c0, 0x1fe8: 0x00c0, 0x1fe9: 0x00c0, + 0x1fea: 0x00c0, 0x1feb: 0x00c0, 0x1fec: 0x00c0, 0x1fed: 0x00c0, 0x1fee: 0x00c0, + 0x1ff0: 0x00c0, 0x1ff1: 0x00c0, 0x1ff2: 0x00c0, 0x1ff3: 0x00c0, 0x1ff4: 0x00c0, 0x1ff5: 0x00c0, + 0x1ff6: 0x00c0, 0x1ff8: 0x00c0, 0x1ff9: 0x00c0, 0x1ffa: 0x00c0, 0x1ffb: 0x00c0, + 0x1ffc: 0x00c0, 0x1ffd: 0x00c0, 0x1ffe: 0x00c0, + // Block 0x80, offset 0x2000 + 0x2000: 0x00c0, 0x2001: 0x00c0, 0x2002: 0x00c0, 0x2003: 0x00c0, 0x2004: 0x00c0, 0x2005: 0x00c0, + 0x2006: 0x00c0, 0x2008: 0x00c0, 0x2009: 0x00c0, 0x200a: 0x00c0, 0x200b: 0x00c0, + 0x200c: 0x00c0, 0x200d: 0x00c0, 0x200e: 0x00c0, 0x2010: 0x00c0, 0x2011: 0x00c0, + 0x2012: 0x00c0, 0x2013: 0x00c0, 0x2014: 0x00c0, 0x2015: 0x00c0, 0x2016: 0x00c0, + 0x2018: 0x00c0, 0x2019: 0x00c0, 0x201a: 0x00c0, 0x201b: 0x00c0, 0x201c: 0x00c0, 0x201d: 0x00c0, + 0x201e: 0x00c0, 0x2020: 0x00c3, 0x2021: 0x00c3, 0x2022: 0x00c3, 0x2023: 0x00c3, + 0x2024: 0x00c3, 0x2025: 0x00c3, 0x2026: 0x00c3, 0x2027: 0x00c3, 0x2028: 0x00c3, 0x2029: 0x00c3, + 0x202a: 0x00c3, 0x202b: 0x00c3, 0x202c: 0x00c3, 0x202d: 0x00c3, 0x202e: 0x00c3, 0x202f: 0x00c3, + 0x2030: 0x00c3, 0x2031: 0x00c3, 0x2032: 0x00c3, 0x2033: 0x00c3, 0x2034: 0x00c3, 0x2035: 0x00c3, + 0x2036: 0x00c3, 0x2037: 0x00c3, 0x2038: 0x00c3, 0x2039: 0x00c3, 0x203a: 0x00c3, 0x203b: 0x00c3, + 0x203c: 0x00c3, 0x203d: 0x00c3, 0x203e: 0x00c3, 0x203f: 0x00c3, + // Block 0x81, offset 0x2040 + 0x2040: 0x0080, 0x2041: 0x0080, 0x2042: 0x0080, 0x2043: 0x0080, 0x2044: 0x0080, 0x2045: 0x0080, + 0x2046: 0x0080, 0x2047: 0x0080, 0x2048: 0x0080, 0x2049: 0x0080, 0x204a: 0x0080, 0x204b: 0x0080, + 0x204c: 0x0080, 0x204d: 0x0080, 0x204e: 0x0080, 0x204f: 0x0080, 0x2050: 0x0080, 0x2051: 0x0080, + 0x2052: 0x0080, 0x2053: 0x0080, 0x2054: 0x0080, 0x2055: 0x0080, 0x2056: 0x0080, 0x2057: 0x0080, + 0x2058: 0x0080, 0x2059: 0x0080, 0x205a: 0x0080, 0x205b: 0x0080, 0x205c: 0x0080, 0x205d: 0x0080, + 0x205e: 0x0080, 0x205f: 0x0080, 0x2060: 0x0080, 0x2061: 0x0080, 0x2062: 0x0080, 0x2063: 0x0080, + 0x2064: 0x0080, 0x2065: 0x0080, 0x2066: 0x0080, 0x2067: 0x0080, 0x2068: 0x0080, 0x2069: 0x0080, + 0x206a: 0x0080, 0x206b: 0x0080, 0x206c: 0x0080, 0x206d: 0x0080, 0x206e: 0x0080, 0x206f: 0x00c0, + 0x2070: 0x0080, 0x2071: 0x0080, 0x2072: 0x0080, 0x2073: 0x0080, 0x2074: 0x0080, 0x2075: 0x0080, + 0x2076: 0x0080, 0x2077: 0x0080, 0x2078: 0x0080, 0x2079: 0x0080, 0x207a: 0x0080, 0x207b: 0x0080, + 0x207c: 0x0080, 0x207d: 0x0080, 0x207e: 0x0080, 0x207f: 0x0080, + // Block 0x82, offset 0x2080 + 0x2080: 0x0080, 0x2081: 0x0080, 0x2082: 0x0080, 0x2083: 0x0080, 0x2084: 0x0080, + // Block 0x83, offset 0x20c0 + 0x20c0: 0x008c, 0x20c1: 0x008c, 0x20c2: 0x008c, 0x20c3: 0x008c, 0x20c4: 0x008c, 0x20c5: 0x008c, + 0x20c6: 0x008c, 0x20c7: 0x008c, 0x20c8: 0x008c, 0x20c9: 0x008c, 0x20ca: 0x008c, 0x20cb: 0x008c, + 0x20cc: 0x008c, 0x20cd: 0x008c, 0x20ce: 0x008c, 0x20cf: 0x008c, 0x20d0: 0x008c, 0x20d1: 0x008c, + 0x20d2: 0x008c, 0x20d3: 0x008c, 0x20d4: 0x008c, 0x20d5: 0x008c, 0x20d6: 0x008c, 0x20d7: 0x008c, + 0x20d8: 0x008c, 0x20d9: 0x008c, 0x20db: 0x008c, 0x20dc: 0x008c, 0x20dd: 0x008c, + 0x20de: 0x008c, 0x20df: 0x008c, 0x20e0: 0x008c, 0x20e1: 0x008c, 0x20e2: 0x008c, 0x20e3: 0x008c, + 0x20e4: 0x008c, 0x20e5: 0x008c, 0x20e6: 0x008c, 0x20e7: 0x008c, 0x20e8: 0x008c, 0x20e9: 0x008c, + 0x20ea: 0x008c, 0x20eb: 0x008c, 0x20ec: 0x008c, 0x20ed: 0x008c, 0x20ee: 0x008c, 0x20ef: 0x008c, + 0x20f0: 0x008c, 0x20f1: 0x008c, 0x20f2: 0x008c, 0x20f3: 0x008c, 0x20f4: 0x008c, 0x20f5: 0x008c, + 0x20f6: 0x008c, 0x20f7: 0x008c, 0x20f8: 0x008c, 0x20f9: 0x008c, 0x20fa: 0x008c, 0x20fb: 0x008c, + 0x20fc: 0x008c, 0x20fd: 0x008c, 0x20fe: 0x008c, 0x20ff: 0x008c, + // Block 0x84, offset 0x2100 + 0x2100: 0x008c, 0x2101: 0x008c, 0x2102: 0x008c, 0x2103: 0x008c, 0x2104: 0x008c, 0x2105: 0x008c, + 0x2106: 0x008c, 0x2107: 0x008c, 0x2108: 0x008c, 0x2109: 0x008c, 0x210a: 0x008c, 0x210b: 0x008c, + 0x210c: 0x008c, 0x210d: 0x008c, 0x210e: 0x008c, 0x210f: 0x008c, 0x2110: 0x008c, 0x2111: 0x008c, + 0x2112: 0x008c, 0x2113: 0x008c, 0x2114: 0x008c, 0x2115: 0x008c, 0x2116: 0x008c, 0x2117: 0x008c, + 0x2118: 0x008c, 0x2119: 0x008c, 0x211a: 0x008c, 0x211b: 0x008c, 0x211c: 0x008c, 0x211d: 0x008c, + 0x211e: 0x008c, 0x211f: 0x008c, 0x2120: 0x008c, 0x2121: 0x008c, 0x2122: 0x008c, 0x2123: 0x008c, + 0x2124: 0x008c, 0x2125: 0x008c, 0x2126: 0x008c, 0x2127: 0x008c, 0x2128: 0x008c, 0x2129: 0x008c, + 0x212a: 0x008c, 0x212b: 0x008c, 0x212c: 0x008c, 0x212d: 0x008c, 0x212e: 0x008c, 0x212f: 0x008c, + 0x2130: 0x008c, 0x2131: 0x008c, 0x2132: 0x008c, 0x2133: 0x008c, + // Block 0x85, offset 0x2140 + 0x2140: 0x008c, 0x2141: 0x008c, 0x2142: 0x008c, 0x2143: 0x008c, 0x2144: 0x008c, 0x2145: 0x008c, + 0x2146: 0x008c, 0x2147: 0x008c, 0x2148: 0x008c, 0x2149: 0x008c, 0x214a: 0x008c, 0x214b: 0x008c, + 0x214c: 0x008c, 0x214d: 0x008c, 0x214e: 0x008c, 0x214f: 0x008c, 0x2150: 0x008c, 0x2151: 0x008c, + 0x2152: 0x008c, 0x2153: 0x008c, 0x2154: 0x008c, 0x2155: 0x008c, 0x2156: 0x008c, 0x2157: 0x008c, + 0x2158: 0x008c, 0x2159: 0x008c, 0x215a: 0x008c, 0x215b: 0x008c, 0x215c: 0x008c, 0x215d: 0x008c, + 0x215e: 0x008c, 0x215f: 0x008c, 0x2160: 0x008c, 0x2161: 0x008c, 0x2162: 0x008c, 0x2163: 0x008c, + 0x2164: 0x008c, 0x2165: 0x008c, 0x2166: 0x008c, 0x2167: 0x008c, 0x2168: 0x008c, 0x2169: 0x008c, + 0x216a: 0x008c, 0x216b: 0x008c, 0x216c: 0x008c, 0x216d: 0x008c, 0x216e: 0x008c, 0x216f: 0x008c, + 0x2170: 0x008c, 0x2171: 0x008c, 0x2172: 0x008c, 0x2173: 0x008c, 0x2174: 0x008c, 0x2175: 0x008c, + 0x2176: 0x008c, 0x2177: 0x008c, 0x2178: 0x008c, 0x2179: 0x008c, 0x217a: 0x008c, 0x217b: 0x008c, + 0x217c: 0x008c, 0x217d: 0x008c, 0x217e: 0x008c, 0x217f: 0x008c, + // Block 0x86, offset 0x2180 + 0x2180: 0x008c, 0x2181: 0x008c, 0x2182: 0x008c, 0x2183: 0x008c, 0x2184: 0x008c, 0x2185: 0x008c, + 0x2186: 0x008c, 0x2187: 0x008c, 0x2188: 0x008c, 0x2189: 0x008c, 0x218a: 0x008c, 0x218b: 0x008c, + 0x218c: 0x008c, 0x218d: 0x008c, 0x218e: 0x008c, 0x218f: 0x008c, 0x2190: 0x008c, 0x2191: 0x008c, + 0x2192: 0x008c, 0x2193: 0x008c, 0x2194: 0x008c, 0x2195: 0x008c, + 0x21b0: 0x0080, 0x21b1: 0x0080, 0x21b2: 0x0080, 0x21b3: 0x0080, 0x21b4: 0x0080, 0x21b5: 0x0080, + 0x21b6: 0x0080, 0x21b7: 0x0080, 0x21b8: 0x0080, 0x21b9: 0x0080, 0x21ba: 0x0080, 0x21bb: 0x0080, + // Block 0x87, offset 0x21c0 + 0x21c0: 0x0080, 0x21c1: 0x0080, 0x21c2: 0x0080, 0x21c3: 0x0080, 0x21c4: 0x0080, 0x21c5: 0x00cc, + 0x21c6: 0x00c0, 0x21c7: 0x00cc, 0x21c8: 0x0080, 0x21c9: 0x0080, 0x21ca: 0x0080, 0x21cb: 0x0080, + 0x21cc: 0x0080, 0x21cd: 0x0080, 0x21ce: 0x0080, 0x21cf: 0x0080, 0x21d0: 0x0080, 0x21d1: 0x0080, + 0x21d2: 0x0080, 0x21d3: 0x0080, 0x21d4: 0x0080, 0x21d5: 0x0080, 0x21d6: 0x0080, 0x21d7: 0x0080, + 0x21d8: 0x0080, 0x21d9: 0x0080, 0x21da: 0x0080, 0x21db: 0x0080, 0x21dc: 0x0080, 0x21dd: 0x0080, + 0x21de: 0x0080, 0x21df: 0x0080, 0x21e0: 0x0080, 0x21e1: 0x008c, 0x21e2: 0x008c, 0x21e3: 0x008c, + 0x21e4: 0x008c, 0x21e5: 0x008c, 0x21e6: 0x008c, 0x21e7: 0x008c, 0x21e8: 0x008c, 0x21e9: 0x008c, + 0x21ea: 0x00c3, 0x21eb: 0x00c3, 0x21ec: 0x00c3, 0x21ed: 0x00c3, 0x21ee: 0x0040, 0x21ef: 0x0040, + 0x21f0: 0x0080, 0x21f1: 0x0040, 0x21f2: 0x0040, 0x21f3: 0x0040, 0x21f4: 0x0040, 0x21f5: 0x0040, + 0x21f6: 0x0080, 0x21f7: 0x0080, 0x21f8: 0x008c, 0x21f9: 0x008c, 0x21fa: 0x008c, 0x21fb: 0x0040, + 0x21fc: 0x00c0, 0x21fd: 0x0080, 0x21fe: 0x0080, 0x21ff: 0x0080, + // Block 0x88, offset 0x2200 + 0x2201: 0x00cc, 0x2202: 0x00cc, 0x2203: 0x00cc, 0x2204: 0x00cc, 0x2205: 0x00cc, + 0x2206: 0x00cc, 0x2207: 0x00cc, 0x2208: 0x00cc, 0x2209: 0x00cc, 0x220a: 0x00cc, 0x220b: 0x00cc, + 0x220c: 0x00cc, 0x220d: 0x00cc, 0x220e: 0x00cc, 0x220f: 0x00cc, 0x2210: 0x00cc, 0x2211: 0x00cc, + 0x2212: 0x00cc, 0x2213: 0x00cc, 0x2214: 0x00cc, 0x2215: 0x00cc, 0x2216: 0x00cc, 0x2217: 0x00cc, + 0x2218: 0x00cc, 0x2219: 0x00cc, 0x221a: 0x00cc, 0x221b: 0x00cc, 0x221c: 0x00cc, 0x221d: 0x00cc, + 0x221e: 0x00cc, 0x221f: 0x00cc, 0x2220: 0x00cc, 0x2221: 0x00cc, 0x2222: 0x00cc, 0x2223: 0x00cc, + 0x2224: 0x00cc, 0x2225: 0x00cc, 0x2226: 0x00cc, 0x2227: 0x00cc, 0x2228: 0x00cc, 0x2229: 0x00cc, + 0x222a: 0x00cc, 0x222b: 0x00cc, 0x222c: 0x00cc, 0x222d: 0x00cc, 0x222e: 0x00cc, 0x222f: 0x00cc, + 0x2230: 0x00cc, 0x2231: 0x00cc, 0x2232: 0x00cc, 0x2233: 0x00cc, 0x2234: 0x00cc, 0x2235: 0x00cc, + 0x2236: 0x00cc, 0x2237: 0x00cc, 0x2238: 0x00cc, 0x2239: 0x00cc, 0x223a: 0x00cc, 0x223b: 0x00cc, + 0x223c: 0x00cc, 0x223d: 0x00cc, 0x223e: 0x00cc, 0x223f: 0x00cc, + // Block 0x89, offset 0x2240 + 0x2240: 0x00cc, 0x2241: 0x00cc, 0x2242: 0x00cc, 0x2243: 0x00cc, 0x2244: 0x00cc, 0x2245: 0x00cc, + 0x2246: 0x00cc, 0x2247: 0x00cc, 0x2248: 0x00cc, 0x2249: 0x00cc, 0x224a: 0x00cc, 0x224b: 0x00cc, + 0x224c: 0x00cc, 0x224d: 0x00cc, 0x224e: 0x00cc, 0x224f: 0x00cc, 0x2250: 0x00cc, 0x2251: 0x00cc, + 0x2252: 0x00cc, 0x2253: 0x00cc, 0x2254: 0x00cc, 0x2255: 0x00cc, 0x2256: 0x00cc, + 0x2259: 0x00c3, 0x225a: 0x00c3, 0x225b: 0x0080, 0x225c: 0x0080, 0x225d: 0x00cc, + 0x225e: 0x00cc, 0x225f: 0x008c, 0x2260: 0x0080, 0x2261: 0x00cc, 0x2262: 0x00cc, 0x2263: 0x00cc, + 0x2264: 0x00cc, 0x2265: 0x00cc, 0x2266: 0x00cc, 0x2267: 0x00cc, 0x2268: 0x00cc, 0x2269: 0x00cc, + 0x226a: 0x00cc, 0x226b: 0x00cc, 0x226c: 0x00cc, 0x226d: 0x00cc, 0x226e: 0x00cc, 0x226f: 0x00cc, + 0x2270: 0x00cc, 0x2271: 0x00cc, 0x2272: 0x00cc, 0x2273: 0x00cc, 0x2274: 0x00cc, 0x2275: 0x00cc, + 0x2276: 0x00cc, 0x2277: 0x00cc, 0x2278: 0x00cc, 0x2279: 0x00cc, 0x227a: 0x00cc, 0x227b: 0x00cc, + 0x227c: 0x00cc, 0x227d: 0x00cc, 0x227e: 0x00cc, 0x227f: 0x00cc, + // Block 0x8a, offset 0x2280 + 0x2280: 0x00cc, 0x2281: 0x00cc, 0x2282: 0x00cc, 0x2283: 0x00cc, 0x2284: 0x00cc, 0x2285: 0x00cc, + 0x2286: 0x00cc, 0x2287: 0x00cc, 0x2288: 0x00cc, 0x2289: 0x00cc, 0x228a: 0x00cc, 0x228b: 0x00cc, + 0x228c: 0x00cc, 0x228d: 0x00cc, 0x228e: 0x00cc, 0x228f: 0x00cc, 0x2290: 0x00cc, 0x2291: 0x00cc, + 0x2292: 0x00cc, 0x2293: 0x00cc, 0x2294: 0x00cc, 0x2295: 0x00cc, 0x2296: 0x00cc, 0x2297: 0x00cc, + 0x2298: 0x00cc, 0x2299: 0x00cc, 0x229a: 0x00cc, 0x229b: 0x00cc, 0x229c: 0x00cc, 0x229d: 0x00cc, + 0x229e: 0x00cc, 0x229f: 0x00cc, 0x22a0: 0x00cc, 0x22a1: 0x00cc, 0x22a2: 0x00cc, 0x22a3: 0x00cc, + 0x22a4: 0x00cc, 0x22a5: 0x00cc, 0x22a6: 0x00cc, 0x22a7: 0x00cc, 0x22a8: 0x00cc, 0x22a9: 0x00cc, + 0x22aa: 0x00cc, 0x22ab: 0x00cc, 0x22ac: 0x00cc, 0x22ad: 0x00cc, 0x22ae: 0x00cc, 0x22af: 0x00cc, + 0x22b0: 0x00cc, 0x22b1: 0x00cc, 0x22b2: 0x00cc, 0x22b3: 0x00cc, 0x22b4: 0x00cc, 0x22b5: 0x00cc, + 0x22b6: 0x00cc, 0x22b7: 0x00cc, 0x22b8: 0x00cc, 0x22b9: 0x00cc, 0x22ba: 0x00cc, 0x22bb: 0x00d2, + 0x22bc: 0x00c0, 0x22bd: 0x00cc, 0x22be: 0x00cc, 0x22bf: 0x008c, + // Block 0x8b, offset 0x22c0 + 0x22c5: 0x00c0, + 0x22c6: 0x00c0, 0x22c7: 0x00c0, 0x22c8: 0x00c0, 0x22c9: 0x00c0, 0x22ca: 0x00c0, 0x22cb: 0x00c0, + 0x22cc: 0x00c0, 0x22cd: 0x00c0, 0x22ce: 0x00c0, 0x22cf: 0x00c0, 0x22d0: 0x00c0, 0x22d1: 0x00c0, + 0x22d2: 0x00c0, 0x22d3: 0x00c0, 0x22d4: 0x00c0, 0x22d5: 0x00c0, 0x22d6: 0x00c0, 0x22d7: 0x00c0, + 0x22d8: 0x00c0, 0x22d9: 0x00c0, 0x22da: 0x00c0, 0x22db: 0x00c0, 0x22dc: 0x00c0, 0x22dd: 0x00c0, + 0x22de: 0x00c0, 0x22df: 0x00c0, 0x22e0: 0x00c0, 0x22e1: 0x00c0, 0x22e2: 0x00c0, 0x22e3: 0x00c0, + 0x22e4: 0x00c0, 0x22e5: 0x00c0, 0x22e6: 0x00c0, 0x22e7: 0x00c0, 0x22e8: 0x00c0, 0x22e9: 0x00c0, + 0x22ea: 0x00c0, 0x22eb: 0x00c0, 0x22ec: 0x00c0, 0x22ed: 0x00c0, + 0x22f1: 0x0080, 0x22f2: 0x0080, 0x22f3: 0x0080, 0x22f4: 0x0080, 0x22f5: 0x0080, + 0x22f6: 0x0080, 0x22f7: 0x0080, 0x22f8: 0x0080, 0x22f9: 0x0080, 0x22fa: 0x0080, 0x22fb: 0x0080, + 0x22fc: 0x0080, 0x22fd: 0x0080, 0x22fe: 0x0080, 0x22ff: 0x0080, + // Block 0x8c, offset 0x2300 + 0x2300: 0x0080, 0x2301: 0x0080, 0x2302: 0x0080, 0x2303: 0x0080, 0x2304: 0x0080, 0x2305: 0x0080, + 0x2306: 0x0080, 0x2307: 0x0080, 0x2308: 0x0080, 0x2309: 0x0080, 0x230a: 0x0080, 0x230b: 0x0080, + 0x230c: 0x0080, 0x230d: 0x0080, 0x230e: 0x0080, 0x230f: 0x0080, 0x2310: 0x0080, 0x2311: 0x0080, + 0x2312: 0x0080, 0x2313: 0x0080, 0x2314: 0x0080, 0x2315: 0x0080, 0x2316: 0x0080, 0x2317: 0x0080, + 0x2318: 0x0080, 0x2319: 0x0080, 0x231a: 0x0080, 0x231b: 0x0080, 0x231c: 0x0080, 0x231d: 0x0080, + 0x231e: 0x0080, 0x231f: 0x0080, 0x2320: 0x0080, 0x2321: 0x0080, 0x2322: 0x0080, 0x2323: 0x0080, + 0x2324: 0x0040, 0x2325: 0x0080, 0x2326: 0x0080, 0x2327: 0x0080, 0x2328: 0x0080, 0x2329: 0x0080, + 0x232a: 0x0080, 0x232b: 0x0080, 0x232c: 0x0080, 0x232d: 0x0080, 0x232e: 0x0080, 0x232f: 0x0080, + 0x2330: 0x0080, 0x2331: 0x0080, 0x2332: 0x0080, 0x2333: 0x0080, 0x2334: 0x0080, 0x2335: 0x0080, + 0x2336: 0x0080, 0x2337: 0x0080, 0x2338: 0x0080, 0x2339: 0x0080, 0x233a: 0x0080, 0x233b: 0x0080, + 0x233c: 0x0080, 0x233d: 0x0080, 0x233e: 0x0080, 0x233f: 0x0080, + // Block 0x8d, offset 0x2340 + 0x2340: 0x0080, 0x2341: 0x0080, 0x2342: 0x0080, 0x2343: 0x0080, 0x2344: 0x0080, 0x2345: 0x0080, + 0x2346: 0x0080, 0x2347: 0x0080, 0x2348: 0x0080, 0x2349: 0x0080, 0x234a: 0x0080, 0x234b: 0x0080, + 0x234c: 0x0080, 0x234d: 0x0080, 0x234e: 0x0080, 0x2350: 0x0080, 0x2351: 0x0080, + 0x2352: 0x0080, 0x2353: 0x0080, 0x2354: 0x0080, 0x2355: 0x0080, 0x2356: 0x0080, 0x2357: 0x0080, + 0x2358: 0x0080, 0x2359: 0x0080, 0x235a: 0x0080, 0x235b: 0x0080, 0x235c: 0x0080, 0x235d: 0x0080, + 0x235e: 0x0080, 0x235f: 0x0080, 0x2360: 0x00c0, 0x2361: 0x00c0, 0x2362: 0x00c0, 0x2363: 0x00c0, + 0x2364: 0x00c0, 0x2365: 0x00c0, 0x2366: 0x00c0, 0x2367: 0x00c0, 0x2368: 0x00c0, 0x2369: 0x00c0, + 0x236a: 0x00c0, 0x236b: 0x00c0, 0x236c: 0x00c0, 0x236d: 0x00c0, 0x236e: 0x00c0, 0x236f: 0x00c0, + 0x2370: 0x00c0, 0x2371: 0x00c0, 0x2372: 0x00c0, 0x2373: 0x00c0, 0x2374: 0x00c0, 0x2375: 0x00c0, + 0x2376: 0x00c0, 0x2377: 0x00c0, 0x2378: 0x00c0, 0x2379: 0x00c0, 0x237a: 0x00c0, + // Block 0x8e, offset 0x2380 + 0x2380: 0x0080, 0x2381: 0x0080, 0x2382: 0x0080, 0x2383: 0x0080, 0x2384: 0x0080, 0x2385: 0x0080, + 0x2386: 0x0080, 0x2387: 0x0080, 0x2388: 0x0080, 0x2389: 0x0080, 0x238a: 0x0080, 0x238b: 0x0080, + 0x238c: 0x0080, 0x238d: 0x0080, 0x238e: 0x0080, 0x238f: 0x0080, 0x2390: 0x0080, 0x2391: 0x0080, + 0x2392: 0x0080, 0x2393: 0x0080, 0x2394: 0x0080, 0x2395: 0x0080, 0x2396: 0x0080, 0x2397: 0x0080, + 0x2398: 0x0080, 0x2399: 0x0080, 0x239a: 0x0080, 0x239b: 0x0080, 0x239c: 0x0080, 0x239d: 0x0080, + 0x239e: 0x0080, 0x239f: 0x0080, 0x23a0: 0x0080, 0x23a1: 0x0080, 0x23a2: 0x0080, 0x23a3: 0x0080, + 0x23b0: 0x00cc, 0x23b1: 0x00cc, 0x23b2: 0x00cc, 0x23b3: 0x00cc, 0x23b4: 0x00cc, 0x23b5: 0x00cc, + 0x23b6: 0x00cc, 0x23b7: 0x00cc, 0x23b8: 0x00cc, 0x23b9: 0x00cc, 0x23ba: 0x00cc, 0x23bb: 0x00cc, + 0x23bc: 0x00cc, 0x23bd: 0x00cc, 0x23be: 0x00cc, 0x23bf: 0x00cc, + // Block 0x8f, offset 0x23c0 + 0x23c0: 0x0080, 0x23c1: 0x0080, 0x23c2: 0x0080, 0x23c3: 0x0080, 0x23c4: 0x0080, 0x23c5: 0x0080, + 0x23c6: 0x0080, 0x23c7: 0x0080, 0x23c8: 0x0080, 0x23c9: 0x0080, 0x23ca: 0x0080, 0x23cb: 0x0080, + 0x23cc: 0x0080, 0x23cd: 0x0080, 0x23ce: 0x0080, 0x23cf: 0x0080, 0x23d0: 0x0080, 0x23d1: 0x0080, + 0x23d2: 0x0080, 0x23d3: 0x0080, 0x23d4: 0x0080, 0x23d5: 0x0080, 0x23d6: 0x0080, 0x23d7: 0x0080, + 0x23d8: 0x0080, 0x23d9: 0x0080, 0x23da: 0x0080, 0x23db: 0x0080, 0x23dc: 0x0080, 0x23dd: 0x0080, + 0x23de: 0x0080, 0x23e0: 0x0080, 0x23e1: 0x0080, 0x23e2: 0x0080, 0x23e3: 0x0080, + 0x23e4: 0x0080, 0x23e5: 0x0080, 0x23e6: 0x0080, 0x23e7: 0x0080, 0x23e8: 0x0080, 0x23e9: 0x0080, + 0x23ea: 0x0080, 0x23eb: 0x0080, 0x23ec: 0x0080, 0x23ed: 0x0080, 0x23ee: 0x0080, 0x23ef: 0x0080, + 0x23f0: 0x0080, 0x23f1: 0x0080, 0x23f2: 0x0080, 0x23f3: 0x0080, 0x23f4: 0x0080, 0x23f5: 0x0080, + 0x23f6: 0x0080, 0x23f7: 0x0080, 0x23f8: 0x0080, 0x23f9: 0x0080, 0x23fa: 0x0080, 0x23fb: 0x0080, + 0x23fc: 0x0080, 0x23fd: 0x0080, 0x23fe: 0x0080, 0x23ff: 0x0080, + // Block 0x90, offset 0x2400 + 0x2400: 0x0080, 0x2401: 0x0080, 0x2402: 0x0080, 0x2403: 0x0080, 0x2404: 0x0080, 0x2405: 0x0080, + 0x2406: 0x0080, 0x2407: 0x0080, 0x2408: 0x0080, 0x2409: 0x0080, 0x240a: 0x0080, 0x240b: 0x0080, + 0x240c: 0x0080, 0x240d: 0x0080, 0x240e: 0x0080, 0x240f: 0x0080, 0x2410: 0x008c, 0x2411: 0x008c, + 0x2412: 0x008c, 0x2413: 0x008c, 0x2414: 0x008c, 0x2415: 0x008c, 0x2416: 0x008c, 0x2417: 0x008c, + 0x2418: 0x008c, 0x2419: 0x008c, 0x241a: 0x008c, 0x241b: 0x008c, 0x241c: 0x008c, 0x241d: 0x008c, + 0x241e: 0x008c, 0x241f: 0x008c, 0x2420: 0x008c, 0x2421: 0x008c, 0x2422: 0x008c, 0x2423: 0x008c, + 0x2424: 0x008c, 0x2425: 0x008c, 0x2426: 0x008c, 0x2427: 0x008c, 0x2428: 0x008c, 0x2429: 0x008c, + 0x242a: 0x008c, 0x242b: 0x008c, 0x242c: 0x008c, 0x242d: 0x008c, 0x242e: 0x008c, 0x242f: 0x008c, + 0x2430: 0x008c, 0x2431: 0x008c, 0x2432: 0x008c, 0x2433: 0x008c, 0x2434: 0x008c, 0x2435: 0x008c, + 0x2436: 0x008c, 0x2437: 0x008c, 0x2438: 0x008c, 0x2439: 0x008c, 0x243a: 0x008c, 0x243b: 0x008c, + 0x243c: 0x008c, 0x243d: 0x008c, 0x243e: 0x008c, + // Block 0x91, offset 0x2440 + 0x2440: 0x008c, 0x2441: 0x008c, 0x2442: 0x008c, 0x2443: 0x008c, 0x2444: 0x008c, 0x2445: 0x008c, + 0x2446: 0x008c, 0x2447: 0x008c, 0x2448: 0x008c, 0x2449: 0x008c, 0x244a: 0x008c, 0x244b: 0x008c, + 0x244c: 0x008c, 0x244d: 0x008c, 0x244e: 0x008c, 0x244f: 0x008c, 0x2450: 0x008c, 0x2451: 0x008c, + 0x2452: 0x008c, 0x2453: 0x008c, 0x2454: 0x008c, 0x2455: 0x008c, 0x2456: 0x008c, 0x2457: 0x008c, + 0x2458: 0x0080, 0x2459: 0x0080, 0x245a: 0x0080, 0x245b: 0x0080, 0x245c: 0x0080, 0x245d: 0x0080, + 0x245e: 0x0080, 0x245f: 0x0080, 0x2460: 0x0080, 0x2461: 0x0080, 0x2462: 0x0080, 0x2463: 0x0080, + 0x2464: 0x0080, 0x2465: 0x0080, 0x2466: 0x0080, 0x2467: 0x0080, 0x2468: 0x0080, 0x2469: 0x0080, + 0x246a: 0x0080, 0x246b: 0x0080, 0x246c: 0x0080, 0x246d: 0x0080, 0x246e: 0x0080, 0x246f: 0x0080, + 0x2470: 0x0080, 0x2471: 0x0080, 0x2472: 0x0080, 0x2473: 0x0080, 0x2474: 0x0080, 0x2475: 0x0080, + 0x2476: 0x0080, 0x2477: 0x0080, 0x2478: 0x0080, 0x2479: 0x0080, 0x247a: 0x0080, 0x247b: 0x0080, + 0x247c: 0x0080, 0x247d: 0x0080, 0x247e: 0x0080, 0x247f: 0x0080, + // Block 0x92, offset 0x2480 + 0x2480: 0x00cc, 0x2481: 0x00cc, 0x2482: 0x00cc, 0x2483: 0x00cc, 0x2484: 0x00cc, 0x2485: 0x00cc, + 0x2486: 0x00cc, 0x2487: 0x00cc, 0x2488: 0x00cc, 0x2489: 0x00cc, 0x248a: 0x00cc, 0x248b: 0x00cc, + 0x248c: 0x00cc, 0x248d: 0x00cc, 0x248e: 0x00cc, 0x248f: 0x00cc, 0x2490: 0x00cc, 0x2491: 0x00cc, + 0x2492: 0x00cc, 0x2493: 0x00cc, 0x2494: 0x00cc, 0x2495: 0x00cc, 0x2496: 0x00cc, 0x2497: 0x00cc, + 0x2498: 0x00cc, 0x2499: 0x00cc, 0x249a: 0x00cc, 0x249b: 0x00cc, 0x249c: 0x00cc, 0x249d: 0x00cc, + 0x249e: 0x00cc, 0x249f: 0x00cc, 0x24a0: 0x00cc, 0x24a1: 0x00cc, 0x24a2: 0x00cc, 0x24a3: 0x00cc, + 0x24a4: 0x00cc, 0x24a5: 0x00cc, 0x24a6: 0x00cc, 0x24a7: 0x00cc, 0x24a8: 0x00cc, 0x24a9: 0x00cc, + 0x24aa: 0x00cc, 0x24ab: 0x00cc, 0x24ac: 0x00cc, 0x24ad: 0x00cc, 0x24ae: 0x00cc, 0x24af: 0x00cc, + 0x24b0: 0x00cc, 0x24b1: 0x00cc, 0x24b2: 0x00cc, 0x24b3: 0x00cc, 0x24b4: 0x00cc, 0x24b5: 0x00cc, + 0x24b6: 0x00cc, 0x24b7: 0x00cc, 0x24b8: 0x00cc, 0x24b9: 0x00cc, 0x24ba: 0x00cc, 0x24bb: 0x00cc, + 0x24bc: 0x00cc, 0x24bd: 0x00cc, 0x24be: 0x00cc, 0x24bf: 0x00cc, + // Block 0x93, offset 0x24c0 + 0x24c0: 0x00cc, 0x24c1: 0x00cc, 0x24c2: 0x00cc, 0x24c3: 0x00cc, 0x24c4: 0x00cc, 0x24c5: 0x00cc, + 0x24c6: 0x00cc, 0x24c7: 0x00cc, 0x24c8: 0x00cc, 0x24c9: 0x00cc, 0x24ca: 0x00cc, 0x24cb: 0x00cc, + 0x24cc: 0x00cc, 0x24cd: 0x00cc, 0x24ce: 0x00cc, 0x24cf: 0x00cc, 0x24d0: 0x00cc, 0x24d1: 0x00cc, + 0x24d2: 0x00cc, 0x24d3: 0x00cc, 0x24d4: 0x00cc, 0x24d5: 0x00cc, 0x24d6: 0x00cc, 0x24d7: 0x00cc, + 0x24d8: 0x00cc, 0x24d9: 0x00cc, 0x24da: 0x00cc, 0x24db: 0x00cc, 0x24dc: 0x00cc, 0x24dd: 0x00cc, + 0x24de: 0x00cc, 0x24df: 0x00cc, 0x24e0: 0x00cc, 0x24e1: 0x00cc, 0x24e2: 0x00cc, 0x24e3: 0x00cc, + 0x24e4: 0x00cc, 0x24e5: 0x00cc, 0x24e6: 0x00cc, 0x24e7: 0x00cc, 0x24e8: 0x00cc, 0x24e9: 0x00cc, + 0x24ea: 0x00cc, 0x24eb: 0x00cc, 0x24ec: 0x00cc, 0x24ed: 0x00cc, 0x24ee: 0x00cc, 0x24ef: 0x00cc, + 0x24f0: 0x00cc, 0x24f1: 0x00cc, 0x24f2: 0x00cc, 0x24f3: 0x00cc, 0x24f4: 0x00cc, 0x24f5: 0x00cc, + // Block 0x94, offset 0x2500 + 0x2500: 0x00cc, 0x2501: 0x00cc, 0x2502: 0x00cc, 0x2503: 0x00cc, 0x2504: 0x00cc, 0x2505: 0x00cc, + 0x2506: 0x00cc, 0x2507: 0x00cc, 0x2508: 0x00cc, 0x2509: 0x00cc, 0x250a: 0x00cc, 0x250b: 0x00cc, + 0x250c: 0x00cc, 0x250d: 0x00cc, 0x250e: 0x00cc, 0x250f: 0x00cc, 0x2510: 0x00cc, 0x2511: 0x00cc, + 0x2512: 0x00cc, 0x2513: 0x00cc, 0x2514: 0x00cc, 0x2515: 0x00cc, + // Block 0x95, offset 0x2540 + 0x2540: 0x00c0, 0x2541: 0x00c0, 0x2542: 0x00c0, 0x2543: 0x00c0, 0x2544: 0x00c0, 0x2545: 0x00c0, + 0x2546: 0x00c0, 0x2547: 0x00c0, 0x2548: 0x00c0, 0x2549: 0x00c0, 0x254a: 0x00c0, 0x254b: 0x00c0, + 0x254c: 0x00c0, 0x2550: 0x0080, 0x2551: 0x0080, + 0x2552: 0x0080, 0x2553: 0x0080, 0x2554: 0x0080, 0x2555: 0x0080, 0x2556: 0x0080, 0x2557: 0x0080, + 0x2558: 0x0080, 0x2559: 0x0080, 0x255a: 0x0080, 0x255b: 0x0080, 0x255c: 0x0080, 0x255d: 0x0080, + 0x255e: 0x0080, 0x255f: 0x0080, 0x2560: 0x0080, 0x2561: 0x0080, 0x2562: 0x0080, 0x2563: 0x0080, + 0x2564: 0x0080, 0x2565: 0x0080, 0x2566: 0x0080, 0x2567: 0x0080, 0x2568: 0x0080, 0x2569: 0x0080, + 0x256a: 0x0080, 0x256b: 0x0080, 0x256c: 0x0080, 0x256d: 0x0080, 0x256e: 0x0080, 0x256f: 0x0080, + 0x2570: 0x0080, 0x2571: 0x0080, 0x2572: 0x0080, 0x2573: 0x0080, 0x2574: 0x0080, 0x2575: 0x0080, + 0x2576: 0x0080, 0x2577: 0x0080, 0x2578: 0x0080, 0x2579: 0x0080, 0x257a: 0x0080, 0x257b: 0x0080, + 0x257c: 0x0080, 0x257d: 0x0080, 0x257e: 0x0080, 0x257f: 0x0080, + // Block 0x96, offset 0x2580 + 0x2580: 0x0080, 0x2581: 0x0080, 0x2582: 0x0080, 0x2583: 0x0080, 0x2584: 0x0080, 0x2585: 0x0080, + 0x2586: 0x0080, + 0x2590: 0x00c0, 0x2591: 0x00c0, + 0x2592: 0x00c0, 0x2593: 0x00c0, 0x2594: 0x00c0, 0x2595: 0x00c0, 0x2596: 0x00c0, 0x2597: 0x00c0, + 0x2598: 0x00c0, 0x2599: 0x00c0, 0x259a: 0x00c0, 0x259b: 0x00c0, 0x259c: 0x00c0, 0x259d: 0x00c0, + 0x259e: 0x00c0, 0x259f: 0x00c0, 0x25a0: 0x00c0, 0x25a1: 0x00c0, 0x25a2: 0x00c0, 0x25a3: 0x00c0, + 0x25a4: 0x00c0, 0x25a5: 0x00c0, 0x25a6: 0x00c0, 0x25a7: 0x00c0, 0x25a8: 0x00c0, 0x25a9: 0x00c0, + 0x25aa: 0x00c0, 0x25ab: 0x00c0, 0x25ac: 0x00c0, 0x25ad: 0x00c0, 0x25ae: 0x00c0, 0x25af: 0x00c0, + 0x25b0: 0x00c0, 0x25b1: 0x00c0, 0x25b2: 0x00c0, 0x25b3: 0x00c0, 0x25b4: 0x00c0, 0x25b5: 0x00c0, + 0x25b6: 0x00c0, 0x25b7: 0x00c0, 0x25b8: 0x00c0, 0x25b9: 0x00c0, 0x25ba: 0x00c0, 0x25bb: 0x00c0, + 0x25bc: 0x00c0, 0x25bd: 0x00c0, 0x25be: 0x0080, 0x25bf: 0x0080, + // Block 0x97, offset 0x25c0 + 0x25c0: 0x00c0, 0x25c1: 0x00c0, 0x25c2: 0x00c0, 0x25c3: 0x00c0, 0x25c4: 0x00c0, 0x25c5: 0x00c0, + 0x25c6: 0x00c0, 0x25c7: 0x00c0, 0x25c8: 0x00c0, 0x25c9: 0x00c0, 0x25ca: 0x00c0, 0x25cb: 0x00c0, + 0x25cc: 0x00c0, 0x25cd: 0x0080, 0x25ce: 0x0080, 0x25cf: 0x0080, 0x25d0: 0x00c0, 0x25d1: 0x00c0, + 0x25d2: 0x00c0, 0x25d3: 0x00c0, 0x25d4: 0x00c0, 0x25d5: 0x00c0, 0x25d6: 0x00c0, 0x25d7: 0x00c0, + 0x25d8: 0x00c0, 0x25d9: 0x00c0, 0x25da: 0x00c0, 0x25db: 0x00c0, 0x25dc: 0x00c0, 0x25dd: 0x00c0, + 0x25de: 0x00c0, 0x25df: 0x00c0, 0x25e0: 0x00c0, 0x25e1: 0x00c0, 0x25e2: 0x00c0, 0x25e3: 0x00c0, + 0x25e4: 0x00c0, 0x25e5: 0x00c0, 0x25e6: 0x00c0, 0x25e7: 0x00c0, 0x25e8: 0x00c0, 0x25e9: 0x00c0, + 0x25ea: 0x00c0, 0x25eb: 0x00c0, + // Block 0x98, offset 0x2600 + 0x2600: 0x00c0, 0x2601: 0x00c0, 0x2602: 0x00c0, 0x2603: 0x00c0, 0x2604: 0x00c0, 0x2605: 0x00c0, + 0x2606: 0x00c0, 0x2607: 0x00c0, 0x2608: 0x00c0, 0x2609: 0x00c0, 0x260a: 0x00c0, 0x260b: 0x00c0, + 0x260c: 0x00c0, 0x260d: 0x00c0, 0x260e: 0x00c0, 0x260f: 0x00c0, 0x2610: 0x00c0, 0x2611: 0x00c0, + 0x2612: 0x00c0, 0x2613: 0x00c0, 0x2614: 0x00c0, 0x2615: 0x00c0, 0x2616: 0x00c0, 0x2617: 0x00c0, + 0x2618: 0x00c0, 0x2619: 0x00c0, 0x261a: 0x00c0, 0x261b: 0x00c0, 0x261c: 0x00c0, 0x261d: 0x00c0, + 0x261e: 0x00c0, 0x261f: 0x00c0, 0x2620: 0x00c0, 0x2621: 0x00c0, 0x2622: 0x00c0, 0x2623: 0x00c0, + 0x2624: 0x00c0, 0x2625: 0x00c0, 0x2626: 0x00c0, 0x2627: 0x00c0, 0x2628: 0x00c0, 0x2629: 0x00c0, + 0x262a: 0x00c0, 0x262b: 0x00c0, 0x262c: 0x00c0, 0x262d: 0x00c0, 0x262e: 0x00c0, 0x262f: 0x00c3, + 0x2630: 0x0083, 0x2631: 0x0083, 0x2632: 0x0083, 0x2633: 0x0080, 0x2634: 0x00c3, 0x2635: 0x00c3, + 0x2636: 0x00c3, 0x2637: 0x00c3, 0x2638: 0x00c3, 0x2639: 0x00c3, 0x263a: 0x00c3, 0x263b: 0x00c3, + 0x263c: 0x00c3, 0x263d: 0x00c3, 0x263e: 0x0080, 0x263f: 0x00c0, + // Block 0x99, offset 0x2640 + 0x2640: 0x00c0, 0x2641: 0x00c0, 0x2642: 0x00c0, 0x2643: 0x00c0, 0x2644: 0x00c0, 0x2645: 0x00c0, + 0x2646: 0x00c0, 0x2647: 0x00c0, 0x2648: 0x00c0, 0x2649: 0x00c0, 0x264a: 0x00c0, 0x264b: 0x00c0, + 0x264c: 0x00c0, 0x264d: 0x00c0, 0x264e: 0x00c0, 0x264f: 0x00c0, 0x2650: 0x00c0, 0x2651: 0x00c0, + 0x2652: 0x00c0, 0x2653: 0x00c0, 0x2654: 0x00c0, 0x2655: 0x00c0, 0x2656: 0x00c0, 0x2657: 0x00c0, + 0x2658: 0x00c0, 0x2659: 0x00c0, 0x265a: 0x00c0, 0x265b: 0x00c0, 0x265c: 0x0080, 0x265d: 0x0080, + 0x265e: 0x00c3, 0x265f: 0x00c3, 0x2660: 0x00c0, 0x2661: 0x00c0, 0x2662: 0x00c0, 0x2663: 0x00c0, + 0x2664: 0x00c0, 0x2665: 0x00c0, 0x2666: 0x00c0, 0x2667: 0x00c0, 0x2668: 0x00c0, 0x2669: 0x00c0, + 0x266a: 0x00c0, 0x266b: 0x00c0, 0x266c: 0x00c0, 0x266d: 0x00c0, 0x266e: 0x00c0, 0x266f: 0x00c0, + 0x2670: 0x00c0, 0x2671: 0x00c0, 0x2672: 0x00c0, 0x2673: 0x00c0, 0x2674: 0x00c0, 0x2675: 0x00c0, + 0x2676: 0x00c0, 0x2677: 0x00c0, 0x2678: 0x00c0, 0x2679: 0x00c0, 0x267a: 0x00c0, 0x267b: 0x00c0, + 0x267c: 0x00c0, 0x267d: 0x00c0, 0x267e: 0x00c0, 0x267f: 0x00c0, + // Block 0x9a, offset 0x2680 + 0x2680: 0x00c0, 0x2681: 0x00c0, 0x2682: 0x00c0, 0x2683: 0x00c0, 0x2684: 0x00c0, 0x2685: 0x00c0, + 0x2686: 0x00c0, 0x2687: 0x00c0, 0x2688: 0x00c0, 0x2689: 0x00c0, 0x268a: 0x00c0, 0x268b: 0x00c0, + 0x268c: 0x00c0, 0x268d: 0x00c0, 0x268e: 0x00c0, 0x268f: 0x00c0, 0x2690: 0x00c0, 0x2691: 0x00c0, + 0x2692: 0x00c0, 0x2693: 0x00c0, 0x2694: 0x00c0, 0x2695: 0x00c0, 0x2696: 0x00c0, 0x2697: 0x00c0, + 0x2698: 0x00c0, 0x2699: 0x00c0, 0x269a: 0x00c0, 0x269b: 0x00c0, 0x269c: 0x00c0, 0x269d: 0x00c0, + 0x269e: 0x00c0, 0x269f: 0x00c0, 0x26a0: 0x00c0, 0x26a1: 0x00c0, 0x26a2: 0x00c0, 0x26a3: 0x00c0, + 0x26a4: 0x00c0, 0x26a5: 0x00c0, 0x26a6: 0x0080, 0x26a7: 0x0080, 0x26a8: 0x0080, 0x26a9: 0x0080, + 0x26aa: 0x0080, 0x26ab: 0x0080, 0x26ac: 0x0080, 0x26ad: 0x0080, 0x26ae: 0x0080, 0x26af: 0x0080, + 0x26b0: 0x00c3, 0x26b1: 0x00c3, 0x26b2: 0x0080, 0x26b3: 0x0080, 0x26b4: 0x0080, 0x26b5: 0x0080, + 0x26b6: 0x0080, 0x26b7: 0x0080, + // Block 0x9b, offset 0x26c0 + 0x26c0: 0x0080, 0x26c1: 0x0080, 0x26c2: 0x0080, 0x26c3: 0x0080, 0x26c4: 0x0080, 0x26c5: 0x0080, + 0x26c6: 0x0080, 0x26c7: 0x0080, 0x26c8: 0x0080, 0x26c9: 0x0080, 0x26ca: 0x0080, 0x26cb: 0x0080, + 0x26cc: 0x0080, 0x26cd: 0x0080, 0x26ce: 0x0080, 0x26cf: 0x0080, 0x26d0: 0x0080, 0x26d1: 0x0080, + 0x26d2: 0x0080, 0x26d3: 0x0080, 0x26d4: 0x0080, 0x26d5: 0x0080, 0x26d6: 0x0080, 0x26d7: 0x00c0, + 0x26d8: 0x00c0, 0x26d9: 0x00c0, 0x26da: 0x00c0, 0x26db: 0x00c0, 0x26dc: 0x00c0, 0x26dd: 0x00c0, + 0x26de: 0x00c0, 0x26df: 0x00c0, 0x26e0: 0x0080, 0x26e1: 0x0080, 0x26e2: 0x00c0, 0x26e3: 0x00c0, + 0x26e4: 0x00c0, 0x26e5: 0x00c0, 0x26e6: 0x00c0, 0x26e7: 0x00c0, 0x26e8: 0x00c0, 0x26e9: 0x00c0, + 0x26ea: 0x00c0, 0x26eb: 0x00c0, 0x26ec: 0x00c0, 0x26ed: 0x00c0, 0x26ee: 0x00c0, 0x26ef: 0x00c0, + 0x26f0: 0x00c0, 0x26f1: 0x00c0, 0x26f2: 0x00c0, 0x26f3: 0x00c0, 0x26f4: 0x00c0, 0x26f5: 0x00c0, + 0x26f6: 0x00c0, 0x26f7: 0x00c0, 0x26f8: 0x00c0, 0x26f9: 0x00c0, 0x26fa: 0x00c0, 0x26fb: 0x00c0, + 0x26fc: 0x00c0, 0x26fd: 0x00c0, 0x26fe: 0x00c0, 0x26ff: 0x00c0, + // Block 0x9c, offset 0x2700 + 0x2700: 0x00c0, 0x2701: 0x00c0, 0x2702: 0x00c0, 0x2703: 0x00c0, 0x2704: 0x00c0, 0x2705: 0x00c0, + 0x2706: 0x00c0, 0x2707: 0x00c0, 0x2708: 0x00c0, 0x2709: 0x00c0, 0x270a: 0x00c0, 0x270b: 0x00c0, + 0x270c: 0x00c0, 0x270d: 0x00c0, 0x270e: 0x00c0, 0x270f: 0x00c0, 0x2710: 0x00c0, 0x2711: 0x00c0, + 0x2712: 0x00c0, 0x2713: 0x00c0, 0x2714: 0x00c0, 0x2715: 0x00c0, 0x2716: 0x00c0, 0x2717: 0x00c0, + 0x2718: 0x00c0, 0x2719: 0x00c0, 0x271a: 0x00c0, 0x271b: 0x00c0, 0x271c: 0x00c0, 0x271d: 0x00c0, + 0x271e: 0x00c0, 0x271f: 0x00c0, 0x2720: 0x00c0, 0x2721: 0x00c0, 0x2722: 0x00c0, 0x2723: 0x00c0, + 0x2724: 0x00c0, 0x2725: 0x00c0, 0x2726: 0x00c0, 0x2727: 0x00c0, 0x2728: 0x00c0, 0x2729: 0x00c0, + 0x272a: 0x00c0, 0x272b: 0x00c0, 0x272c: 0x00c0, 0x272d: 0x00c0, 0x272e: 0x00c0, 0x272f: 0x00c0, + 0x2730: 0x0080, 0x2731: 0x00c0, 0x2732: 0x00c0, 0x2733: 0x00c0, 0x2734: 0x00c0, 0x2735: 0x00c0, + 0x2736: 0x00c0, 0x2737: 0x00c0, 0x2738: 0x00c0, 0x2739: 0x00c0, 0x273a: 0x00c0, 0x273b: 0x00c0, + 0x273c: 0x00c0, 0x273d: 0x00c0, 0x273e: 0x00c0, 0x273f: 0x00c0, + // Block 0x9d, offset 0x2740 + 0x2740: 0x00c0, 0x2741: 0x00c0, 0x2742: 0x00c0, 0x2743: 0x00c0, 0x2744: 0x00c0, 0x2745: 0x00c0, + 0x2746: 0x00c0, 0x2747: 0x00c0, 0x2748: 0x00c0, 0x2749: 0x0080, 0x274a: 0x0080, 0x274b: 0x00c0, + 0x274c: 0x00c0, 0x274d: 0x00c0, 0x274e: 0x00c0, 0x274f: 0x00c0, 0x2750: 0x00c0, 0x2751: 0x00c0, + 0x2752: 0x00c0, 0x2753: 0x00c0, 0x2754: 0x00c0, 0x2755: 0x00c0, 0x2756: 0x00c0, 0x2757: 0x00c0, + 0x2758: 0x00c0, 0x2759: 0x00c0, 0x275a: 0x00c0, 0x275b: 0x00c0, 0x275c: 0x00c0, 0x275d: 0x00c0, + 0x275e: 0x00c0, 0x275f: 0x00c0, 0x2760: 0x00c0, 0x2761: 0x00c0, 0x2762: 0x00c0, 0x2763: 0x00c0, + 0x2764: 0x00c0, 0x2765: 0x00c0, 0x2766: 0x00c0, 0x2767: 0x00c0, 0x2768: 0x00c0, 0x2769: 0x00c0, + 0x276a: 0x00c0, 0x276b: 0x00c0, 0x276c: 0x00c0, 0x276d: 0x00c0, 0x276e: 0x00c0, + 0x2770: 0x00c0, 0x2771: 0x00c0, 0x2772: 0x00c0, 0x2773: 0x00c0, 0x2774: 0x00c0, 0x2775: 0x00c0, + 0x2776: 0x00c0, 0x2777: 0x00c0, + // Block 0x9e, offset 0x2780 + 0x27b7: 0x00c0, 0x27b8: 0x0080, 0x27b9: 0x0080, 0x27ba: 0x00c0, 0x27bb: 0x00c0, + 0x27bc: 0x00c0, 0x27bd: 0x00c0, 0x27be: 0x00c0, 0x27bf: 0x00c0, + // Block 0x9f, offset 0x27c0 + 0x27c0: 0x00c0, 0x27c1: 0x00c0, 0x27c2: 0x00c3, 0x27c3: 0x00c0, 0x27c4: 0x00c0, 0x27c5: 0x00c0, + 0x27c6: 0x00c6, 0x27c7: 0x00c0, 0x27c8: 0x00c0, 0x27c9: 0x00c0, 0x27ca: 0x00c0, 0x27cb: 0x00c3, + 0x27cc: 0x00c0, 0x27cd: 0x00c0, 0x27ce: 0x00c0, 0x27cf: 0x00c0, 0x27d0: 0x00c0, 0x27d1: 0x00c0, + 0x27d2: 0x00c0, 0x27d3: 0x00c0, 0x27d4: 0x00c0, 0x27d5: 0x00c0, 0x27d6: 0x00c0, 0x27d7: 0x00c0, + 0x27d8: 0x00c0, 0x27d9: 0x00c0, 0x27da: 0x00c0, 0x27db: 0x00c0, 0x27dc: 0x00c0, 0x27dd: 0x00c0, + 0x27de: 0x00c0, 0x27df: 0x00c0, 0x27e0: 0x00c0, 0x27e1: 0x00c0, 0x27e2: 0x00c0, 0x27e3: 0x00c0, + 0x27e4: 0x00c0, 0x27e5: 0x00c3, 0x27e6: 0x00c3, 0x27e7: 0x00c0, 0x27e8: 0x0080, 0x27e9: 0x0080, + 0x27ea: 0x0080, 0x27eb: 0x0080, + 0x27f0: 0x0080, 0x27f1: 0x0080, 0x27f2: 0x0080, 0x27f3: 0x0080, 0x27f4: 0x0080, 0x27f5: 0x0080, + 0x27f6: 0x0080, 0x27f7: 0x0080, 0x27f8: 0x0080, 0x27f9: 0x0080, + // Block 0xa0, offset 0x2800 + 0x2800: 0x00c2, 0x2801: 0x00c2, 0x2802: 0x00c2, 0x2803: 0x00c2, 0x2804: 0x00c2, 0x2805: 0x00c2, + 0x2806: 0x00c2, 0x2807: 0x00c2, 0x2808: 0x00c2, 0x2809: 0x00c2, 0x280a: 0x00c2, 0x280b: 0x00c2, + 0x280c: 0x00c2, 0x280d: 0x00c2, 0x280e: 0x00c2, 0x280f: 0x00c2, 0x2810: 0x00c2, 0x2811: 0x00c2, + 0x2812: 0x00c2, 0x2813: 0x00c2, 0x2814: 0x00c2, 0x2815: 0x00c2, 0x2816: 0x00c2, 0x2817: 0x00c2, + 0x2818: 0x00c2, 0x2819: 0x00c2, 0x281a: 0x00c2, 0x281b: 0x00c2, 0x281c: 0x00c2, 0x281d: 0x00c2, + 0x281e: 0x00c2, 0x281f: 0x00c2, 0x2820: 0x00c2, 0x2821: 0x00c2, 0x2822: 0x00c2, 0x2823: 0x00c2, + 0x2824: 0x00c2, 0x2825: 0x00c2, 0x2826: 0x00c2, 0x2827: 0x00c2, 0x2828: 0x00c2, 0x2829: 0x00c2, + 0x282a: 0x00c2, 0x282b: 0x00c2, 0x282c: 0x00c2, 0x282d: 0x00c2, 0x282e: 0x00c2, 0x282f: 0x00c2, + 0x2830: 0x00c2, 0x2831: 0x00c2, 0x2832: 0x00c1, 0x2833: 0x00c0, 0x2834: 0x0080, 0x2835: 0x0080, + 0x2836: 0x0080, 0x2837: 0x0080, + // Block 0xa1, offset 0x2840 + 0x2840: 0x00c0, 0x2841: 0x00c0, 0x2842: 0x00c0, 0x2843: 0x00c0, 0x2844: 0x00c6, 0x2845: 0x00c3, + 0x284e: 0x0080, 0x284f: 0x0080, 0x2850: 0x00c0, 0x2851: 0x00c0, + 0x2852: 0x00c0, 0x2853: 0x00c0, 0x2854: 0x00c0, 0x2855: 0x00c0, 0x2856: 0x00c0, 0x2857: 0x00c0, + 0x2858: 0x00c0, 0x2859: 0x00c0, + 0x2860: 0x00c3, 0x2861: 0x00c3, 0x2862: 0x00c3, 0x2863: 0x00c3, + 0x2864: 0x00c3, 0x2865: 0x00c3, 0x2866: 0x00c3, 0x2867: 0x00c3, 0x2868: 0x00c3, 0x2869: 0x00c3, + 0x286a: 0x00c3, 0x286b: 0x00c3, 0x286c: 0x00c3, 0x286d: 0x00c3, 0x286e: 0x00c3, 0x286f: 0x00c3, + 0x2870: 0x00c3, 0x2871: 0x00c3, 0x2872: 0x00c0, 0x2873: 0x00c0, 0x2874: 0x00c0, 0x2875: 0x00c0, + 0x2876: 0x00c0, 0x2877: 0x00c0, 0x2878: 0x0080, 0x2879: 0x0080, 0x287a: 0x0080, 0x287b: 0x00c0, + 0x287c: 0x0080, 0x287d: 0x00c0, + // Block 0xa2, offset 0x2880 + 0x2880: 0x00c0, 0x2881: 0x00c0, 0x2882: 0x00c0, 0x2883: 0x00c0, 0x2884: 0x00c0, 0x2885: 0x00c0, + 0x2886: 0x00c0, 0x2887: 0x00c0, 0x2888: 0x00c0, 0x2889: 0x00c0, 0x288a: 0x00c0, 0x288b: 0x00c0, + 0x288c: 0x00c0, 0x288d: 0x00c0, 0x288e: 0x00c0, 0x288f: 0x00c0, 0x2890: 0x00c0, 0x2891: 0x00c0, + 0x2892: 0x00c0, 0x2893: 0x00c0, 0x2894: 0x00c0, 0x2895: 0x00c0, 0x2896: 0x00c0, 0x2897: 0x00c0, + 0x2898: 0x00c0, 0x2899: 0x00c0, 0x289a: 0x00c0, 0x289b: 0x00c0, 0x289c: 0x00c0, 0x289d: 0x00c0, + 0x289e: 0x00c0, 0x289f: 0x00c0, 0x28a0: 0x00c0, 0x28a1: 0x00c0, 0x28a2: 0x00c0, 0x28a3: 0x00c0, + 0x28a4: 0x00c0, 0x28a5: 0x00c0, 0x28a6: 0x00c3, 0x28a7: 0x00c3, 0x28a8: 0x00c3, 0x28a9: 0x00c3, + 0x28aa: 0x00c3, 0x28ab: 0x00c3, 0x28ac: 0x00c3, 0x28ad: 0x00c3, 0x28ae: 0x0080, 0x28af: 0x0080, + 0x28b0: 0x00c0, 0x28b1: 0x00c0, 0x28b2: 0x00c0, 0x28b3: 0x00c0, 0x28b4: 0x00c0, 0x28b5: 0x00c0, + 0x28b6: 0x00c0, 0x28b7: 0x00c0, 0x28b8: 0x00c0, 0x28b9: 0x00c0, 0x28ba: 0x00c0, 0x28bb: 0x00c0, + 0x28bc: 0x00c0, 0x28bd: 0x00c0, 0x28be: 0x00c0, 0x28bf: 0x00c0, + // Block 0xa3, offset 0x28c0 + 0x28c0: 0x00c0, 0x28c1: 0x00c0, 0x28c2: 0x00c0, 0x28c3: 0x00c0, 0x28c4: 0x00c0, 0x28c5: 0x00c0, + 0x28c6: 0x00c0, 0x28c7: 0x00c3, 0x28c8: 0x00c3, 0x28c9: 0x00c3, 0x28ca: 0x00c3, 0x28cb: 0x00c3, + 0x28cc: 0x00c3, 0x28cd: 0x00c3, 0x28ce: 0x00c3, 0x28cf: 0x00c3, 0x28d0: 0x00c3, 0x28d1: 0x00c3, + 0x28d2: 0x00c0, 0x28d3: 0x00c5, + 0x28df: 0x0080, 0x28e0: 0x0040, 0x28e1: 0x0040, 0x28e2: 0x0040, 0x28e3: 0x0040, + 0x28e4: 0x0040, 0x28e5: 0x0040, 0x28e6: 0x0040, 0x28e7: 0x0040, 0x28e8: 0x0040, 0x28e9: 0x0040, + 0x28ea: 0x0040, 0x28eb: 0x0040, 0x28ec: 0x0040, 0x28ed: 0x0040, 0x28ee: 0x0040, 0x28ef: 0x0040, + 0x28f0: 0x0040, 0x28f1: 0x0040, 0x28f2: 0x0040, 0x28f3: 0x0040, 0x28f4: 0x0040, 0x28f5: 0x0040, + 0x28f6: 0x0040, 0x28f7: 0x0040, 0x28f8: 0x0040, 0x28f9: 0x0040, 0x28fa: 0x0040, 0x28fb: 0x0040, + 0x28fc: 0x0040, + // Block 0xa4, offset 0x2900 + 0x2900: 0x00c3, 0x2901: 0x00c3, 0x2902: 0x00c3, 0x2903: 0x00c0, 0x2904: 0x00c0, 0x2905: 0x00c0, + 0x2906: 0x00c0, 0x2907: 0x00c0, 0x2908: 0x00c0, 0x2909: 0x00c0, 0x290a: 0x00c0, 0x290b: 0x00c0, + 0x290c: 0x00c0, 0x290d: 0x00c0, 0x290e: 0x00c0, 0x290f: 0x00c0, 0x2910: 0x00c0, 0x2911: 0x00c0, + 0x2912: 0x00c0, 0x2913: 0x00c0, 0x2914: 0x00c0, 0x2915: 0x00c0, 0x2916: 0x00c0, 0x2917: 0x00c0, + 0x2918: 0x00c0, 0x2919: 0x00c0, 0x291a: 0x00c0, 0x291b: 0x00c0, 0x291c: 0x00c0, 0x291d: 0x00c0, + 0x291e: 0x00c0, 0x291f: 0x00c0, 0x2920: 0x00c0, 0x2921: 0x00c0, 0x2922: 0x00c0, 0x2923: 0x00c0, + 0x2924: 0x00c0, 0x2925: 0x00c0, 0x2926: 0x00c0, 0x2927: 0x00c0, 0x2928: 0x00c0, 0x2929: 0x00c0, + 0x292a: 0x00c0, 0x292b: 0x00c0, 0x292c: 0x00c0, 0x292d: 0x00c0, 0x292e: 0x00c0, 0x292f: 0x00c0, + 0x2930: 0x00c0, 0x2931: 0x00c0, 0x2932: 0x00c0, 0x2933: 0x00c3, 0x2934: 0x00c0, 0x2935: 0x00c0, + 0x2936: 0x00c3, 0x2937: 0x00c3, 0x2938: 0x00c3, 0x2939: 0x00c3, 0x293a: 0x00c0, 0x293b: 0x00c0, + 0x293c: 0x00c3, 0x293d: 0x00c0, 0x293e: 0x00c0, 0x293f: 0x00c0, + // Block 0xa5, offset 0x2940 + 0x2940: 0x00c5, 0x2941: 0x0080, 0x2942: 0x0080, 0x2943: 0x0080, 0x2944: 0x0080, 0x2945: 0x0080, + 0x2946: 0x0080, 0x2947: 0x0080, 0x2948: 0x0080, 0x2949: 0x0080, 0x294a: 0x0080, 0x294b: 0x0080, + 0x294c: 0x0080, 0x294d: 0x0080, 0x294f: 0x00c0, 0x2950: 0x00c0, 0x2951: 0x00c0, + 0x2952: 0x00c0, 0x2953: 0x00c0, 0x2954: 0x00c0, 0x2955: 0x00c0, 0x2956: 0x00c0, 0x2957: 0x00c0, + 0x2958: 0x00c0, 0x2959: 0x00c0, + 0x295e: 0x0080, 0x295f: 0x0080, 0x2960: 0x00c0, 0x2961: 0x00c0, 0x2962: 0x00c0, 0x2963: 0x00c0, + 0x2964: 0x00c0, 0x2965: 0x00c3, 0x2966: 0x00c0, 0x2967: 0x00c0, 0x2968: 0x00c0, 0x2969: 0x00c0, + 0x296a: 0x00c0, 0x296b: 0x00c0, 0x296c: 0x00c0, 0x296d: 0x00c0, 0x296e: 0x00c0, 0x296f: 0x00c0, + 0x2970: 0x00c0, 0x2971: 0x00c0, 0x2972: 0x00c0, 0x2973: 0x00c0, 0x2974: 0x00c0, 0x2975: 0x00c0, + 0x2976: 0x00c0, 0x2977: 0x00c0, 0x2978: 0x00c0, 0x2979: 0x00c0, 0x297a: 0x00c0, 0x297b: 0x00c0, + 0x297c: 0x00c0, 0x297d: 0x00c0, 0x297e: 0x00c0, + // Block 0xa6, offset 0x2980 + 0x2980: 0x00c0, 0x2981: 0x00c0, 0x2982: 0x00c0, 0x2983: 0x00c0, 0x2984: 0x00c0, 0x2985: 0x00c0, + 0x2986: 0x00c0, 0x2987: 0x00c0, 0x2988: 0x00c0, 0x2989: 0x00c0, 0x298a: 0x00c0, 0x298b: 0x00c0, + 0x298c: 0x00c0, 0x298d: 0x00c0, 0x298e: 0x00c0, 0x298f: 0x00c0, 0x2990: 0x00c0, 0x2991: 0x00c0, + 0x2992: 0x00c0, 0x2993: 0x00c0, 0x2994: 0x00c0, 0x2995: 0x00c0, 0x2996: 0x00c0, 0x2997: 0x00c0, + 0x2998: 0x00c0, 0x2999: 0x00c0, 0x299a: 0x00c0, 0x299b: 0x00c0, 0x299c: 0x00c0, 0x299d: 0x00c0, + 0x299e: 0x00c0, 0x299f: 0x00c0, 0x29a0: 0x00c0, 0x29a1: 0x00c0, 0x29a2: 0x00c0, 0x29a3: 0x00c0, + 0x29a4: 0x00c0, 0x29a5: 0x00c0, 0x29a6: 0x00c0, 0x29a7: 0x00c0, 0x29a8: 0x00c0, 0x29a9: 0x00c3, + 0x29aa: 0x00c3, 0x29ab: 0x00c3, 0x29ac: 0x00c3, 0x29ad: 0x00c3, 0x29ae: 0x00c3, 0x29af: 0x00c0, + 0x29b0: 0x00c0, 0x29b1: 0x00c3, 0x29b2: 0x00c3, 0x29b3: 0x00c0, 0x29b4: 0x00c0, 0x29b5: 0x00c3, + 0x29b6: 0x00c3, + // Block 0xa7, offset 0x29c0 + 0x29c0: 0x00c0, 0x29c1: 0x00c0, 0x29c2: 0x00c0, 0x29c3: 0x00c3, 0x29c4: 0x00c0, 0x29c5: 0x00c0, + 0x29c6: 0x00c0, 0x29c7: 0x00c0, 0x29c8: 0x00c0, 0x29c9: 0x00c0, 0x29ca: 0x00c0, 0x29cb: 0x00c0, + 0x29cc: 0x00c3, 0x29cd: 0x00c0, 0x29d0: 0x00c0, 0x29d1: 0x00c0, + 0x29d2: 0x00c0, 0x29d3: 0x00c0, 0x29d4: 0x00c0, 0x29d5: 0x00c0, 0x29d6: 0x00c0, 0x29d7: 0x00c0, + 0x29d8: 0x00c0, 0x29d9: 0x00c0, 0x29dc: 0x0080, 0x29dd: 0x0080, + 0x29de: 0x0080, 0x29df: 0x0080, 0x29e0: 0x00c0, 0x29e1: 0x00c0, 0x29e2: 0x00c0, 0x29e3: 0x00c0, + 0x29e4: 0x00c0, 0x29e5: 0x00c0, 0x29e6: 0x00c0, 0x29e7: 0x00c0, 0x29e8: 0x00c0, 0x29e9: 0x00c0, + 0x29ea: 0x00c0, 0x29eb: 0x00c0, 0x29ec: 0x00c0, 0x29ed: 0x00c0, 0x29ee: 0x00c0, 0x29ef: 0x00c0, + 0x29f0: 0x00c0, 0x29f1: 0x00c0, 0x29f2: 0x00c0, 0x29f3: 0x00c0, 0x29f4: 0x00c0, 0x29f5: 0x00c0, + 0x29f6: 0x00c0, 0x29f7: 0x0080, 0x29f8: 0x0080, 0x29f9: 0x0080, 0x29fa: 0x00c0, 0x29fb: 0x00c0, + 0x29fc: 0x00c3, 0x29fd: 0x00c0, 0x29fe: 0x00c0, 0x29ff: 0x00c0, + // Block 0xa8, offset 0x2a00 + 0x2a00: 0x00c0, 0x2a01: 0x00c0, 0x2a02: 0x00c0, 0x2a03: 0x00c0, 0x2a04: 0x00c0, 0x2a05: 0x00c0, + 0x2a06: 0x00c0, 0x2a07: 0x00c0, 0x2a08: 0x00c0, 0x2a09: 0x00c0, 0x2a0a: 0x00c0, 0x2a0b: 0x00c0, + 0x2a0c: 0x00c0, 0x2a0d: 0x00c0, 0x2a0e: 0x00c0, 0x2a0f: 0x00c0, 0x2a10: 0x00c0, 0x2a11: 0x00c0, + 0x2a12: 0x00c0, 0x2a13: 0x00c0, 0x2a14: 0x00c0, 0x2a15: 0x00c0, 0x2a16: 0x00c0, 0x2a17: 0x00c0, + 0x2a18: 0x00c0, 0x2a19: 0x00c0, 0x2a1a: 0x00c0, 0x2a1b: 0x00c0, 0x2a1c: 0x00c0, 0x2a1d: 0x00c0, + 0x2a1e: 0x00c0, 0x2a1f: 0x00c0, 0x2a20: 0x00c0, 0x2a21: 0x00c0, 0x2a22: 0x00c0, 0x2a23: 0x00c0, + 0x2a24: 0x00c0, 0x2a25: 0x00c0, 0x2a26: 0x00c0, 0x2a27: 0x00c0, 0x2a28: 0x00c0, 0x2a29: 0x00c0, + 0x2a2a: 0x00c0, 0x2a2b: 0x00c0, 0x2a2c: 0x00c0, 0x2a2d: 0x00c0, 0x2a2e: 0x00c0, 0x2a2f: 0x00c0, + 0x2a30: 0x00c3, 0x2a31: 0x00c0, 0x2a32: 0x00c3, 0x2a33: 0x00c3, 0x2a34: 0x00c3, 0x2a35: 0x00c0, + 0x2a36: 0x00c0, 0x2a37: 0x00c3, 0x2a38: 0x00c3, 0x2a39: 0x00c0, 0x2a3a: 0x00c0, 0x2a3b: 0x00c0, + 0x2a3c: 0x00c0, 0x2a3d: 0x00c0, 0x2a3e: 0x00c3, 0x2a3f: 0x00c3, + // Block 0xa9, offset 0x2a40 + 0x2a40: 0x00c0, 0x2a41: 0x00c3, 0x2a42: 0x00c0, + 0x2a5b: 0x00c0, 0x2a5c: 0x00c0, 0x2a5d: 0x00c0, + 0x2a5e: 0x0080, 0x2a5f: 0x0080, 0x2a60: 0x00c0, 0x2a61: 0x00c0, 0x2a62: 0x00c0, 0x2a63: 0x00c0, + 0x2a64: 0x00c0, 0x2a65: 0x00c0, 0x2a66: 0x00c0, 0x2a67: 0x00c0, 0x2a68: 0x00c0, 0x2a69: 0x00c0, + 0x2a6a: 0x00c0, 0x2a6b: 0x00c0, 0x2a6c: 0x00c3, 0x2a6d: 0x00c3, 0x2a6e: 0x00c0, 0x2a6f: 0x00c0, + 0x2a70: 0x0080, 0x2a71: 0x0080, 0x2a72: 0x00c0, 0x2a73: 0x00c0, 0x2a74: 0x00c0, 0x2a75: 0x00c0, + 0x2a76: 0x00c6, + // Block 0xaa, offset 0x2a80 + 0x2a81: 0x00c0, 0x2a82: 0x00c0, 0x2a83: 0x00c0, 0x2a84: 0x00c0, 0x2a85: 0x00c0, + 0x2a86: 0x00c0, 0x2a89: 0x00c0, 0x2a8a: 0x00c0, 0x2a8b: 0x00c0, + 0x2a8c: 0x00c0, 0x2a8d: 0x00c0, 0x2a8e: 0x00c0, 0x2a91: 0x00c0, + 0x2a92: 0x00c0, 0x2a93: 0x00c0, 0x2a94: 0x00c0, 0x2a95: 0x00c0, 0x2a96: 0x00c0, + 0x2aa0: 0x00c0, 0x2aa1: 0x00c0, 0x2aa2: 0x00c0, 0x2aa3: 0x00c0, + 0x2aa4: 0x00c0, 0x2aa5: 0x00c0, 0x2aa6: 0x00c0, 0x2aa8: 0x00c0, 0x2aa9: 0x00c0, + 0x2aaa: 0x00c0, 0x2aab: 0x00c0, 0x2aac: 0x00c0, 0x2aad: 0x00c0, 0x2aae: 0x00c0, + 0x2ab0: 0x00c0, 0x2ab1: 0x00c0, 0x2ab2: 0x00c0, 0x2ab3: 0x00c0, 0x2ab4: 0x00c0, 0x2ab5: 0x00c0, + 0x2ab6: 0x00c0, 0x2ab7: 0x00c0, 0x2ab8: 0x00c0, 0x2ab9: 0x00c0, 0x2aba: 0x00c0, 0x2abb: 0x00c0, + 0x2abc: 0x00c0, 0x2abd: 0x00c0, 0x2abe: 0x00c0, 0x2abf: 0x00c0, + // Block 0xab, offset 0x2ac0 + 0x2ac0: 0x00c0, 0x2ac1: 0x00c0, 0x2ac2: 0x00c0, 0x2ac3: 0x00c0, 0x2ac4: 0x00c0, 0x2ac5: 0x00c0, + 0x2ac6: 0x00c0, 0x2ac7: 0x00c0, 0x2ac8: 0x00c0, 0x2ac9: 0x00c0, 0x2aca: 0x00c0, 0x2acb: 0x00c0, + 0x2acc: 0x00c0, 0x2acd: 0x00c0, 0x2ace: 0x00c0, 0x2acf: 0x00c0, 0x2ad0: 0x00c0, 0x2ad1: 0x00c0, + 0x2ad2: 0x00c0, 0x2ad3: 0x00c0, 0x2ad4: 0x00c0, 0x2ad5: 0x00c0, 0x2ad6: 0x00c0, 0x2ad7: 0x00c0, + 0x2ad8: 0x00c0, 0x2ad9: 0x00c0, 0x2ada: 0x00c0, 0x2adb: 0x0080, 0x2adc: 0x0080, 0x2add: 0x0080, + 0x2ade: 0x0080, 0x2adf: 0x0080, 0x2ae0: 0x00c0, 0x2ae1: 0x00c0, 0x2ae2: 0x00c0, 0x2ae3: 0x00c0, + 0x2ae4: 0x00c0, 0x2ae5: 0x00c8, + 0x2af0: 0x00c0, 0x2af1: 0x00c0, 0x2af2: 0x00c0, 0x2af3: 0x00c0, 0x2af4: 0x00c0, 0x2af5: 0x00c0, + 0x2af6: 0x00c0, 0x2af7: 0x00c0, 0x2af8: 0x00c0, 0x2af9: 0x00c0, 0x2afa: 0x00c0, 0x2afb: 0x00c0, + 0x2afc: 0x00c0, 0x2afd: 0x00c0, 0x2afe: 0x00c0, 0x2aff: 0x00c0, + // Block 0xac, offset 0x2b00 + 0x2b00: 0x00c0, 0x2b01: 0x00c0, 0x2b02: 0x00c0, 0x2b03: 0x00c0, 0x2b04: 0x00c0, 0x2b05: 0x00c0, + 0x2b06: 0x00c0, 0x2b07: 0x00c0, 0x2b08: 0x00c0, 0x2b09: 0x00c0, 0x2b0a: 0x00c0, 0x2b0b: 0x00c0, + 0x2b0c: 0x00c0, 0x2b0d: 0x00c0, 0x2b0e: 0x00c0, 0x2b0f: 0x00c0, 0x2b10: 0x00c0, 0x2b11: 0x00c0, + 0x2b12: 0x00c0, 0x2b13: 0x00c0, 0x2b14: 0x00c0, 0x2b15: 0x00c0, 0x2b16: 0x00c0, 0x2b17: 0x00c0, + 0x2b18: 0x00c0, 0x2b19: 0x00c0, 0x2b1a: 0x00c0, 0x2b1b: 0x00c0, 0x2b1c: 0x00c0, 0x2b1d: 0x00c0, + 0x2b1e: 0x00c0, 0x2b1f: 0x00c0, 0x2b20: 0x00c0, 0x2b21: 0x00c0, 0x2b22: 0x00c0, 0x2b23: 0x00c0, + 0x2b24: 0x00c0, 0x2b25: 0x00c3, 0x2b26: 0x00c0, 0x2b27: 0x00c0, 0x2b28: 0x00c3, 0x2b29: 0x00c0, + 0x2b2a: 0x00c0, 0x2b2b: 0x0080, 0x2b2c: 0x00c0, 0x2b2d: 0x00c6, + 0x2b30: 0x00c0, 0x2b31: 0x00c0, 0x2b32: 0x00c0, 0x2b33: 0x00c0, 0x2b34: 0x00c0, 0x2b35: 0x00c0, + 0x2b36: 0x00c0, 0x2b37: 0x00c0, 0x2b38: 0x00c0, 0x2b39: 0x00c0, + // Block 0xad, offset 0x2b40 + 0x2b40: 0x00c0, 0x2b41: 0x00c0, 0x2b42: 0x00c0, 0x2b43: 0x00c0, 0x2b44: 0x00c0, 0x2b45: 0x00c0, + 0x2b46: 0x00c0, 0x2b47: 0x00c0, 0x2b48: 0x00c0, 0x2b49: 0x00c0, 0x2b4a: 0x00c0, 0x2b4b: 0x00c0, + 0x2b4c: 0x00c0, 0x2b4d: 0x00c0, 0x2b4e: 0x00c0, 0x2b4f: 0x00c0, 0x2b50: 0x00c0, 0x2b51: 0x00c0, + 0x2b52: 0x00c0, 0x2b53: 0x00c0, 0x2b54: 0x00c0, 0x2b55: 0x00c0, 0x2b56: 0x00c0, 0x2b57: 0x00c0, + 0x2b58: 0x00c0, 0x2b59: 0x00c0, 0x2b5a: 0x00c0, 0x2b5b: 0x00c0, 0x2b5c: 0x00c0, 0x2b5d: 0x00c0, + 0x2b5e: 0x00c0, 0x2b5f: 0x00c0, 0x2b60: 0x00c0, 0x2b61: 0x00c0, 0x2b62: 0x00c0, 0x2b63: 0x00c0, + 0x2b70: 0x0040, 0x2b71: 0x0040, 0x2b72: 0x0040, 0x2b73: 0x0040, 0x2b74: 0x0040, 0x2b75: 0x0040, + 0x2b76: 0x0040, 0x2b77: 0x0040, 0x2b78: 0x0040, 0x2b79: 0x0040, 0x2b7a: 0x0040, 0x2b7b: 0x0040, + 0x2b7c: 0x0040, 0x2b7d: 0x0040, 0x2b7e: 0x0040, 0x2b7f: 0x0040, + // Block 0xae, offset 0x2b80 + 0x2b80: 0x0040, 0x2b81: 0x0040, 0x2b82: 0x0040, 0x2b83: 0x0040, 0x2b84: 0x0040, 0x2b85: 0x0040, + 0x2b86: 0x0040, 0x2b8b: 0x0040, + 0x2b8c: 0x0040, 0x2b8d: 0x0040, 0x2b8e: 0x0040, 0x2b8f: 0x0040, 0x2b90: 0x0040, 0x2b91: 0x0040, + 0x2b92: 0x0040, 0x2b93: 0x0040, 0x2b94: 0x0040, 0x2b95: 0x0040, 0x2b96: 0x0040, 0x2b97: 0x0040, + 0x2b98: 0x0040, 0x2b99: 0x0040, 0x2b9a: 0x0040, 0x2b9b: 0x0040, 0x2b9c: 0x0040, 0x2b9d: 0x0040, + 0x2b9e: 0x0040, 0x2b9f: 0x0040, 0x2ba0: 0x0040, 0x2ba1: 0x0040, 0x2ba2: 0x0040, 0x2ba3: 0x0040, + 0x2ba4: 0x0040, 0x2ba5: 0x0040, 0x2ba6: 0x0040, 0x2ba7: 0x0040, 0x2ba8: 0x0040, 0x2ba9: 0x0040, + 0x2baa: 0x0040, 0x2bab: 0x0040, 0x2bac: 0x0040, 0x2bad: 0x0040, 0x2bae: 0x0040, 0x2baf: 0x0040, + 0x2bb0: 0x0040, 0x2bb1: 0x0040, 0x2bb2: 0x0040, 0x2bb3: 0x0040, 0x2bb4: 0x0040, 0x2bb5: 0x0040, + 0x2bb6: 0x0040, 0x2bb7: 0x0040, 0x2bb8: 0x0040, 0x2bb9: 0x0040, 0x2bba: 0x0040, 0x2bbb: 0x0040, + // Block 0xaf, offset 0x2bc0 + 0x2bc0: 0x008c, 0x2bc1: 0x008c, 0x2bc2: 0x008c, 0x2bc3: 0x008c, 0x2bc4: 0x008c, 0x2bc5: 0x008c, + 0x2bc6: 0x008c, 0x2bc7: 0x008c, 0x2bc8: 0x008c, 0x2bc9: 0x008c, 0x2bca: 0x008c, 0x2bcb: 0x008c, + 0x2bcc: 0x008c, 0x2bcd: 0x008c, 0x2bce: 0x00cc, 0x2bcf: 0x00cc, 0x2bd0: 0x008c, 0x2bd1: 0x00cc, + 0x2bd2: 0x008c, 0x2bd3: 0x00cc, 0x2bd4: 0x00cc, 0x2bd5: 0x008c, 0x2bd6: 0x008c, 0x2bd7: 0x008c, + 0x2bd8: 0x008c, 0x2bd9: 0x008c, 0x2bda: 0x008c, 0x2bdb: 0x008c, 0x2bdc: 0x008c, 0x2bdd: 0x008c, + 0x2bde: 0x008c, 0x2bdf: 0x00cc, 0x2be0: 0x008c, 0x2be1: 0x00cc, 0x2be2: 0x008c, 0x2be3: 0x00cc, + 0x2be4: 0x00cc, 0x2be5: 0x008c, 0x2be6: 0x008c, 0x2be7: 0x00cc, 0x2be8: 0x00cc, 0x2be9: 0x00cc, + 0x2bea: 0x008c, 0x2beb: 0x008c, 0x2bec: 0x008c, 0x2bed: 0x008c, 0x2bee: 0x008c, 0x2bef: 0x008c, + 0x2bf0: 0x008c, 0x2bf1: 0x008c, 0x2bf2: 0x008c, 0x2bf3: 0x008c, 0x2bf4: 0x008c, 0x2bf5: 0x008c, + 0x2bf6: 0x008c, 0x2bf7: 0x008c, 0x2bf8: 0x008c, 0x2bf9: 0x008c, 0x2bfa: 0x008c, 0x2bfb: 0x008c, + 0x2bfc: 0x008c, 0x2bfd: 0x008c, 0x2bfe: 0x008c, 0x2bff: 0x008c, + // Block 0xb0, offset 0x2c00 + 0x2c00: 0x008c, 0x2c01: 0x008c, 0x2c02: 0x008c, 0x2c03: 0x008c, 0x2c04: 0x008c, 0x2c05: 0x008c, + 0x2c06: 0x008c, 0x2c07: 0x008c, 0x2c08: 0x008c, 0x2c09: 0x008c, 0x2c0a: 0x008c, 0x2c0b: 0x008c, + 0x2c0c: 0x008c, 0x2c0d: 0x008c, 0x2c0e: 0x008c, 0x2c0f: 0x008c, 0x2c10: 0x008c, 0x2c11: 0x008c, + 0x2c12: 0x008c, 0x2c13: 0x008c, 0x2c14: 0x008c, 0x2c15: 0x008c, 0x2c16: 0x008c, 0x2c17: 0x008c, + 0x2c18: 0x008c, 0x2c19: 0x008c, 0x2c1a: 0x008c, 0x2c1b: 0x008c, 0x2c1c: 0x008c, 0x2c1d: 0x008c, + 0x2c1e: 0x008c, 0x2c1f: 0x008c, 0x2c20: 0x008c, 0x2c21: 0x008c, 0x2c22: 0x008c, 0x2c23: 0x008c, + 0x2c24: 0x008c, 0x2c25: 0x008c, 0x2c26: 0x008c, 0x2c27: 0x008c, 0x2c28: 0x008c, 0x2c29: 0x008c, + 0x2c2a: 0x008c, 0x2c2b: 0x008c, 0x2c2c: 0x008c, 0x2c2d: 0x008c, + 0x2c30: 0x008c, 0x2c31: 0x008c, 0x2c32: 0x008c, 0x2c33: 0x008c, 0x2c34: 0x008c, 0x2c35: 0x008c, + 0x2c36: 0x008c, 0x2c37: 0x008c, 0x2c38: 0x008c, 0x2c39: 0x008c, 0x2c3a: 0x008c, 0x2c3b: 0x008c, + 0x2c3c: 0x008c, 0x2c3d: 0x008c, 0x2c3e: 0x008c, 0x2c3f: 0x008c, + // Block 0xb1, offset 0x2c40 + 0x2c40: 0x008c, 0x2c41: 0x008c, 0x2c42: 0x008c, 0x2c43: 0x008c, 0x2c44: 0x008c, 0x2c45: 0x008c, + 0x2c46: 0x008c, 0x2c47: 0x008c, 0x2c48: 0x008c, 0x2c49: 0x008c, 0x2c4a: 0x008c, 0x2c4b: 0x008c, + 0x2c4c: 0x008c, 0x2c4d: 0x008c, 0x2c4e: 0x008c, 0x2c4f: 0x008c, 0x2c50: 0x008c, 0x2c51: 0x008c, + 0x2c52: 0x008c, 0x2c53: 0x008c, 0x2c54: 0x008c, 0x2c55: 0x008c, 0x2c56: 0x008c, 0x2c57: 0x008c, + 0x2c58: 0x008c, 0x2c59: 0x008c, + // Block 0xb2, offset 0x2c80 + 0x2c80: 0x0080, 0x2c81: 0x0080, 0x2c82: 0x0080, 0x2c83: 0x0080, 0x2c84: 0x0080, 0x2c85: 0x0080, + 0x2c86: 0x0080, + 0x2c93: 0x0080, 0x2c94: 0x0080, 0x2c95: 0x0080, 0x2c96: 0x0080, 0x2c97: 0x0080, + 0x2c9d: 0x008a, + 0x2c9e: 0x00cb, 0x2c9f: 0x008a, 0x2ca0: 0x008a, 0x2ca1: 0x008a, 0x2ca2: 0x008a, 0x2ca3: 0x008a, + 0x2ca4: 0x008a, 0x2ca5: 0x008a, 0x2ca6: 0x008a, 0x2ca7: 0x008a, 0x2ca8: 0x008a, 0x2ca9: 0x008a, + 0x2caa: 0x008a, 0x2cab: 0x008a, 0x2cac: 0x008a, 0x2cad: 0x008a, 0x2cae: 0x008a, 0x2caf: 0x008a, + 0x2cb0: 0x008a, 0x2cb1: 0x008a, 0x2cb2: 0x008a, 0x2cb3: 0x008a, 0x2cb4: 0x008a, 0x2cb5: 0x008a, + 0x2cb6: 0x008a, 0x2cb8: 0x008a, 0x2cb9: 0x008a, 0x2cba: 0x008a, 0x2cbb: 0x008a, + 0x2cbc: 0x008a, 0x2cbe: 0x008a, + // Block 0xb3, offset 0x2cc0 + 0x2cc0: 0x008a, 0x2cc1: 0x008a, 0x2cc3: 0x008a, 0x2cc4: 0x008a, + 0x2cc6: 0x008a, 0x2cc7: 0x008a, 0x2cc8: 0x008a, 0x2cc9: 0x008a, 0x2cca: 0x008a, 0x2ccb: 0x008a, + 0x2ccc: 0x008a, 0x2ccd: 0x008a, 0x2cce: 0x008a, 0x2ccf: 0x008a, 0x2cd0: 0x0080, 0x2cd1: 0x0080, + 0x2cd2: 0x0080, 0x2cd3: 0x0080, 0x2cd4: 0x0080, 0x2cd5: 0x0080, 0x2cd6: 0x0080, 0x2cd7: 0x0080, + 0x2cd8: 0x0080, 0x2cd9: 0x0080, 0x2cda: 0x0080, 0x2cdb: 0x0080, 0x2cdc: 0x0080, 0x2cdd: 0x0080, + 0x2cde: 0x0080, 0x2cdf: 0x0080, 0x2ce0: 0x0080, 0x2ce1: 0x0080, 0x2ce2: 0x0080, 0x2ce3: 0x0080, + 0x2ce4: 0x0080, 0x2ce5: 0x0080, 0x2ce6: 0x0080, 0x2ce7: 0x0080, 0x2ce8: 0x0080, 0x2ce9: 0x0080, + 0x2cea: 0x0080, 0x2ceb: 0x0080, 0x2cec: 0x0080, 0x2ced: 0x0080, 0x2cee: 0x0080, 0x2cef: 0x0080, + 0x2cf0: 0x0080, 0x2cf1: 0x0080, 0x2cf2: 0x0080, 0x2cf3: 0x0080, 0x2cf4: 0x0080, 0x2cf5: 0x0080, + 0x2cf6: 0x0080, 0x2cf7: 0x0080, 0x2cf8: 0x0080, 0x2cf9: 0x0080, 0x2cfa: 0x0080, 0x2cfb: 0x0080, + 0x2cfc: 0x0080, 0x2cfd: 0x0080, 0x2cfe: 0x0080, 0x2cff: 0x0080, + // Block 0xb4, offset 0x2d00 + 0x2d00: 0x0080, 0x2d01: 0x0080, + 0x2d13: 0x0080, 0x2d14: 0x0080, 0x2d15: 0x0080, 0x2d16: 0x0080, 0x2d17: 0x0080, + 0x2d18: 0x0080, 0x2d19: 0x0080, 0x2d1a: 0x0080, 0x2d1b: 0x0080, 0x2d1c: 0x0080, 0x2d1d: 0x0080, + 0x2d1e: 0x0080, 0x2d1f: 0x0080, 0x2d20: 0x0080, 0x2d21: 0x0080, 0x2d22: 0x0080, 0x2d23: 0x0080, + 0x2d24: 0x0080, 0x2d25: 0x0080, 0x2d26: 0x0080, 0x2d27: 0x0080, 0x2d28: 0x0080, 0x2d29: 0x0080, + 0x2d2a: 0x0080, 0x2d2b: 0x0080, 0x2d2c: 0x0080, 0x2d2d: 0x0080, 0x2d2e: 0x0080, 0x2d2f: 0x0080, + 0x2d30: 0x0080, 0x2d31: 0x0080, 0x2d32: 0x0080, 0x2d33: 0x0080, 0x2d34: 0x0080, 0x2d35: 0x0080, + 0x2d36: 0x0080, 0x2d37: 0x0080, 0x2d38: 0x0080, 0x2d39: 0x0080, 0x2d3a: 0x0080, 0x2d3b: 0x0080, + 0x2d3c: 0x0080, 0x2d3d: 0x0080, 0x2d3e: 0x0080, 0x2d3f: 0x0080, + // Block 0xb5, offset 0x2d40 + 0x2d50: 0x0080, 0x2d51: 0x0080, + 0x2d52: 0x0080, 0x2d53: 0x0080, 0x2d54: 0x0080, 0x2d55: 0x0080, 0x2d56: 0x0080, 0x2d57: 0x0080, + 0x2d58: 0x0080, 0x2d59: 0x0080, 0x2d5a: 0x0080, 0x2d5b: 0x0080, 0x2d5c: 0x0080, 0x2d5d: 0x0080, + 0x2d5e: 0x0080, 0x2d5f: 0x0080, 0x2d60: 0x0080, 0x2d61: 0x0080, 0x2d62: 0x0080, 0x2d63: 0x0080, + 0x2d64: 0x0080, 0x2d65: 0x0080, 0x2d66: 0x0080, 0x2d67: 0x0080, 0x2d68: 0x0080, 0x2d69: 0x0080, + 0x2d6a: 0x0080, 0x2d6b: 0x0080, 0x2d6c: 0x0080, 0x2d6d: 0x0080, 0x2d6e: 0x0080, 0x2d6f: 0x0080, + 0x2d70: 0x0080, 0x2d71: 0x0080, 0x2d72: 0x0080, 0x2d73: 0x0080, 0x2d74: 0x0080, 0x2d75: 0x0080, + 0x2d76: 0x0080, 0x2d77: 0x0080, 0x2d78: 0x0080, 0x2d79: 0x0080, 0x2d7a: 0x0080, 0x2d7b: 0x0080, + 0x2d7c: 0x0080, 0x2d7d: 0x0080, 0x2d7e: 0x0080, 0x2d7f: 0x0080, + // Block 0xb6, offset 0x2d80 + 0x2d80: 0x0080, 0x2d81: 0x0080, 0x2d82: 0x0080, 0x2d83: 0x0080, 0x2d84: 0x0080, 0x2d85: 0x0080, + 0x2d86: 0x0080, 0x2d87: 0x0080, 0x2d88: 0x0080, 0x2d89: 0x0080, 0x2d8a: 0x0080, 0x2d8b: 0x0080, + 0x2d8c: 0x0080, 0x2d8d: 0x0080, 0x2d8e: 0x0080, 0x2d8f: 0x0080, + 0x2d92: 0x0080, 0x2d93: 0x0080, 0x2d94: 0x0080, 0x2d95: 0x0080, 0x2d96: 0x0080, 0x2d97: 0x0080, + 0x2d98: 0x0080, 0x2d99: 0x0080, 0x2d9a: 0x0080, 0x2d9b: 0x0080, 0x2d9c: 0x0080, 0x2d9d: 0x0080, + 0x2d9e: 0x0080, 0x2d9f: 0x0080, 0x2da0: 0x0080, 0x2da1: 0x0080, 0x2da2: 0x0080, 0x2da3: 0x0080, + 0x2da4: 0x0080, 0x2da5: 0x0080, 0x2da6: 0x0080, 0x2da7: 0x0080, 0x2da8: 0x0080, 0x2da9: 0x0080, + 0x2daa: 0x0080, 0x2dab: 0x0080, 0x2dac: 0x0080, 0x2dad: 0x0080, 0x2dae: 0x0080, 0x2daf: 0x0080, + 0x2db0: 0x0080, 0x2db1: 0x0080, 0x2db2: 0x0080, 0x2db3: 0x0080, 0x2db4: 0x0080, 0x2db5: 0x0080, + 0x2db6: 0x0080, 0x2db7: 0x0080, 0x2db8: 0x0080, 0x2db9: 0x0080, 0x2dba: 0x0080, 0x2dbb: 0x0080, + 0x2dbc: 0x0080, 0x2dbd: 0x0080, 0x2dbe: 0x0080, 0x2dbf: 0x0080, + // Block 0xb7, offset 0x2dc0 + 0x2dc0: 0x0080, 0x2dc1: 0x0080, 0x2dc2: 0x0080, 0x2dc3: 0x0080, 0x2dc4: 0x0080, 0x2dc5: 0x0080, + 0x2dc6: 0x0080, 0x2dc7: 0x0080, + 0x2df0: 0x0080, 0x2df1: 0x0080, 0x2df2: 0x0080, 0x2df3: 0x0080, 0x2df4: 0x0080, 0x2df5: 0x0080, + 0x2df6: 0x0080, 0x2df7: 0x0080, 0x2df8: 0x0080, 0x2df9: 0x0080, 0x2dfa: 0x0080, 0x2dfb: 0x0080, + 0x2dfc: 0x0080, 0x2dfd: 0x0080, + // Block 0xb8, offset 0x2e00 + 0x2e00: 0x0040, 0x2e01: 0x0040, 0x2e02: 0x0040, 0x2e03: 0x0040, 0x2e04: 0x0040, 0x2e05: 0x0040, + 0x2e06: 0x0040, 0x2e07: 0x0040, 0x2e08: 0x0040, 0x2e09: 0x0040, 0x2e0a: 0x0040, 0x2e0b: 0x0040, + 0x2e0c: 0x0040, 0x2e0d: 0x0040, 0x2e0e: 0x0040, 0x2e0f: 0x0040, 0x2e10: 0x0080, 0x2e11: 0x0080, + 0x2e12: 0x0080, 0x2e13: 0x0080, 0x2e14: 0x0080, 0x2e15: 0x0080, 0x2e16: 0x0080, 0x2e17: 0x0080, + 0x2e18: 0x0080, 0x2e19: 0x0080, + 0x2e20: 0x00c3, 0x2e21: 0x00c3, 0x2e22: 0x00c3, 0x2e23: 0x00c3, + 0x2e24: 0x00c3, 0x2e25: 0x00c3, 0x2e26: 0x00c3, 0x2e27: 0x00c3, 0x2e28: 0x00c3, 0x2e29: 0x00c3, + 0x2e2a: 0x00c3, 0x2e2b: 0x00c3, 0x2e2c: 0x00c3, 0x2e2d: 0x00c3, 0x2e2e: 0x00c3, 0x2e2f: 0x00c3, + 0x2e30: 0x0080, 0x2e31: 0x0080, 0x2e32: 0x0080, 0x2e33: 0x0080, 0x2e34: 0x0080, 0x2e35: 0x0080, + 0x2e36: 0x0080, 0x2e37: 0x0080, 0x2e38: 0x0080, 0x2e39: 0x0080, 0x2e3a: 0x0080, 0x2e3b: 0x0080, + 0x2e3c: 0x0080, 0x2e3d: 0x0080, 0x2e3e: 0x0080, 0x2e3f: 0x0080, + // Block 0xb9, offset 0x2e40 + 0x2e40: 0x0080, 0x2e41: 0x0080, 0x2e42: 0x0080, 0x2e43: 0x0080, 0x2e44: 0x0080, 0x2e45: 0x0080, + 0x2e46: 0x0080, 0x2e47: 0x0080, 0x2e48: 0x0080, 0x2e49: 0x0080, 0x2e4a: 0x0080, 0x2e4b: 0x0080, + 0x2e4c: 0x0080, 0x2e4d: 0x0080, 0x2e4e: 0x0080, 0x2e4f: 0x0080, 0x2e50: 0x0080, 0x2e51: 0x0080, + 0x2e52: 0x0080, 0x2e54: 0x0080, 0x2e55: 0x0080, 0x2e56: 0x0080, 0x2e57: 0x0080, + 0x2e58: 0x0080, 0x2e59: 0x0080, 0x2e5a: 0x0080, 0x2e5b: 0x0080, 0x2e5c: 0x0080, 0x2e5d: 0x0080, + 0x2e5e: 0x0080, 0x2e5f: 0x0080, 0x2e60: 0x0080, 0x2e61: 0x0080, 0x2e62: 0x0080, 0x2e63: 0x0080, + 0x2e64: 0x0080, 0x2e65: 0x0080, 0x2e66: 0x0080, 0x2e68: 0x0080, 0x2e69: 0x0080, + 0x2e6a: 0x0080, 0x2e6b: 0x0080, + 0x2e70: 0x0080, 0x2e71: 0x0080, 0x2e72: 0x0080, 0x2e73: 0x00c0, 0x2e74: 0x0080, + 0x2e76: 0x0080, 0x2e77: 0x0080, 0x2e78: 0x0080, 0x2e79: 0x0080, 0x2e7a: 0x0080, 0x2e7b: 0x0080, + 0x2e7c: 0x0080, 0x2e7d: 0x0080, 0x2e7e: 0x0080, 0x2e7f: 0x0080, + // Block 0xba, offset 0x2e80 + 0x2e80: 0x0080, 0x2e81: 0x0080, 0x2e82: 0x0080, 0x2e83: 0x0080, 0x2e84: 0x0080, 0x2e85: 0x0080, + 0x2e86: 0x0080, 0x2e87: 0x0080, 0x2e88: 0x0080, 0x2e89: 0x0080, 0x2e8a: 0x0080, 0x2e8b: 0x0080, + 0x2e8c: 0x0080, 0x2e8d: 0x0080, 0x2e8e: 0x0080, 0x2e8f: 0x0080, 0x2e90: 0x0080, 0x2e91: 0x0080, + 0x2e92: 0x0080, 0x2e93: 0x0080, 0x2e94: 0x0080, 0x2e95: 0x0080, 0x2e96: 0x0080, 0x2e97: 0x0080, + 0x2e98: 0x0080, 0x2e99: 0x0080, 0x2e9a: 0x0080, 0x2e9b: 0x0080, 0x2e9c: 0x0080, 0x2e9d: 0x0080, + 0x2e9e: 0x0080, 0x2e9f: 0x0080, 0x2ea0: 0x0080, 0x2ea1: 0x0080, 0x2ea2: 0x0080, 0x2ea3: 0x0080, + 0x2ea4: 0x0080, 0x2ea5: 0x0080, 0x2ea6: 0x0080, 0x2ea7: 0x0080, 0x2ea8: 0x0080, 0x2ea9: 0x0080, + 0x2eaa: 0x0080, 0x2eab: 0x0080, 0x2eac: 0x0080, 0x2ead: 0x0080, 0x2eae: 0x0080, 0x2eaf: 0x0080, + 0x2eb0: 0x0080, 0x2eb1: 0x0080, 0x2eb2: 0x0080, 0x2eb3: 0x0080, 0x2eb4: 0x0080, 0x2eb5: 0x0080, + 0x2eb6: 0x0080, 0x2eb7: 0x0080, 0x2eb8: 0x0080, 0x2eb9: 0x0080, 0x2eba: 0x0080, 0x2ebb: 0x0080, + 0x2ebc: 0x0080, 0x2ebf: 0x0040, + // Block 0xbb, offset 0x2ec0 + 0x2ec1: 0x0080, 0x2ec2: 0x0080, 0x2ec3: 0x0080, 0x2ec4: 0x0080, 0x2ec5: 0x0080, + 0x2ec6: 0x0080, 0x2ec7: 0x0080, 0x2ec8: 0x0080, 0x2ec9: 0x0080, 0x2eca: 0x0080, 0x2ecb: 0x0080, + 0x2ecc: 0x0080, 0x2ecd: 0x0080, 0x2ece: 0x0080, 0x2ecf: 0x0080, 0x2ed0: 0x0080, 0x2ed1: 0x0080, + 0x2ed2: 0x0080, 0x2ed3: 0x0080, 0x2ed4: 0x0080, 0x2ed5: 0x0080, 0x2ed6: 0x0080, 0x2ed7: 0x0080, + 0x2ed8: 0x0080, 0x2ed9: 0x0080, 0x2eda: 0x0080, 0x2edb: 0x0080, 0x2edc: 0x0080, 0x2edd: 0x0080, + 0x2ede: 0x0080, 0x2edf: 0x0080, 0x2ee0: 0x0080, 0x2ee1: 0x0080, 0x2ee2: 0x0080, 0x2ee3: 0x0080, + 0x2ee4: 0x0080, 0x2ee5: 0x0080, 0x2ee6: 0x0080, 0x2ee7: 0x0080, 0x2ee8: 0x0080, 0x2ee9: 0x0080, + 0x2eea: 0x0080, 0x2eeb: 0x0080, 0x2eec: 0x0080, 0x2eed: 0x0080, 0x2eee: 0x0080, 0x2eef: 0x0080, + 0x2ef0: 0x0080, 0x2ef1: 0x0080, 0x2ef2: 0x0080, 0x2ef3: 0x0080, 0x2ef4: 0x0080, 0x2ef5: 0x0080, + 0x2ef6: 0x0080, 0x2ef7: 0x0080, 0x2ef8: 0x0080, 0x2ef9: 0x0080, 0x2efa: 0x0080, 0x2efb: 0x0080, + 0x2efc: 0x0080, 0x2efd: 0x0080, 0x2efe: 0x0080, 0x2eff: 0x0080, + // Block 0xbc, offset 0x2f00 + 0x2f00: 0x0080, 0x2f01: 0x0080, 0x2f02: 0x0080, 0x2f03: 0x0080, 0x2f04: 0x0080, 0x2f05: 0x0080, + 0x2f06: 0x0080, 0x2f07: 0x0080, 0x2f08: 0x0080, 0x2f09: 0x0080, 0x2f0a: 0x0080, 0x2f0b: 0x0080, + 0x2f0c: 0x0080, 0x2f0d: 0x0080, 0x2f0e: 0x0080, 0x2f0f: 0x0080, 0x2f10: 0x0080, 0x2f11: 0x0080, + 0x2f12: 0x0080, 0x2f13: 0x0080, 0x2f14: 0x0080, 0x2f15: 0x0080, 0x2f16: 0x0080, 0x2f17: 0x0080, + 0x2f18: 0x0080, 0x2f19: 0x0080, 0x2f1a: 0x0080, 0x2f1b: 0x0080, 0x2f1c: 0x0080, 0x2f1d: 0x0080, + 0x2f1e: 0x0080, 0x2f1f: 0x0080, 0x2f20: 0x0080, 0x2f21: 0x0080, 0x2f22: 0x0080, 0x2f23: 0x0080, + 0x2f24: 0x0080, 0x2f25: 0x0080, 0x2f26: 0x008c, 0x2f27: 0x008c, 0x2f28: 0x008c, 0x2f29: 0x008c, + 0x2f2a: 0x008c, 0x2f2b: 0x008c, 0x2f2c: 0x008c, 0x2f2d: 0x008c, 0x2f2e: 0x008c, 0x2f2f: 0x008c, + 0x2f30: 0x0080, 0x2f31: 0x008c, 0x2f32: 0x008c, 0x2f33: 0x008c, 0x2f34: 0x008c, 0x2f35: 0x008c, + 0x2f36: 0x008c, 0x2f37: 0x008c, 0x2f38: 0x008c, 0x2f39: 0x008c, 0x2f3a: 0x008c, 0x2f3b: 0x008c, + 0x2f3c: 0x008c, 0x2f3d: 0x008c, 0x2f3e: 0x008c, 0x2f3f: 0x008c, + // Block 0xbd, offset 0x2f40 + 0x2f40: 0x008c, 0x2f41: 0x008c, 0x2f42: 0x008c, 0x2f43: 0x008c, 0x2f44: 0x008c, 0x2f45: 0x008c, + 0x2f46: 0x008c, 0x2f47: 0x008c, 0x2f48: 0x008c, 0x2f49: 0x008c, 0x2f4a: 0x008c, 0x2f4b: 0x008c, + 0x2f4c: 0x008c, 0x2f4d: 0x008c, 0x2f4e: 0x008c, 0x2f4f: 0x008c, 0x2f50: 0x008c, 0x2f51: 0x008c, + 0x2f52: 0x008c, 0x2f53: 0x008c, 0x2f54: 0x008c, 0x2f55: 0x008c, 0x2f56: 0x008c, 0x2f57: 0x008c, + 0x2f58: 0x008c, 0x2f59: 0x008c, 0x2f5a: 0x008c, 0x2f5b: 0x008c, 0x2f5c: 0x008c, 0x2f5d: 0x008c, + 0x2f5e: 0x0080, 0x2f5f: 0x0080, 0x2f60: 0x0040, 0x2f61: 0x0080, 0x2f62: 0x0080, 0x2f63: 0x0080, + 0x2f64: 0x0080, 0x2f65: 0x0080, 0x2f66: 0x0080, 0x2f67: 0x0080, 0x2f68: 0x0080, 0x2f69: 0x0080, + 0x2f6a: 0x0080, 0x2f6b: 0x0080, 0x2f6c: 0x0080, 0x2f6d: 0x0080, 0x2f6e: 0x0080, 0x2f6f: 0x0080, + 0x2f70: 0x0080, 0x2f71: 0x0080, 0x2f72: 0x0080, 0x2f73: 0x0080, 0x2f74: 0x0080, 0x2f75: 0x0080, + 0x2f76: 0x0080, 0x2f77: 0x0080, 0x2f78: 0x0080, 0x2f79: 0x0080, 0x2f7a: 0x0080, 0x2f7b: 0x0080, + 0x2f7c: 0x0080, 0x2f7d: 0x0080, 0x2f7e: 0x0080, + // Block 0xbe, offset 0x2f80 + 0x2f82: 0x0080, 0x2f83: 0x0080, 0x2f84: 0x0080, 0x2f85: 0x0080, + 0x2f86: 0x0080, 0x2f87: 0x0080, 0x2f8a: 0x0080, 0x2f8b: 0x0080, + 0x2f8c: 0x0080, 0x2f8d: 0x0080, 0x2f8e: 0x0080, 0x2f8f: 0x0080, + 0x2f92: 0x0080, 0x2f93: 0x0080, 0x2f94: 0x0080, 0x2f95: 0x0080, 0x2f96: 0x0080, 0x2f97: 0x0080, + 0x2f9a: 0x0080, 0x2f9b: 0x0080, 0x2f9c: 0x0080, + 0x2fa0: 0x0080, 0x2fa1: 0x0080, 0x2fa2: 0x0080, 0x2fa3: 0x0080, + 0x2fa4: 0x0080, 0x2fa5: 0x0080, 0x2fa6: 0x0080, 0x2fa8: 0x0080, 0x2fa9: 0x0080, + 0x2faa: 0x0080, 0x2fab: 0x0080, 0x2fac: 0x0080, 0x2fad: 0x0080, 0x2fae: 0x0080, + 0x2fb9: 0x0040, 0x2fba: 0x0040, 0x2fbb: 0x0040, + 0x2fbc: 0x0080, 0x2fbd: 0x0080, + // Block 0xbf, offset 0x2fc0 + 0x2fc0: 0x00c0, 0x2fc1: 0x00c0, 0x2fc2: 0x00c0, 0x2fc3: 0x00c0, 0x2fc4: 0x00c0, 0x2fc5: 0x00c0, + 0x2fc6: 0x00c0, 0x2fc7: 0x00c0, 0x2fc8: 0x00c0, 0x2fc9: 0x00c0, 0x2fca: 0x00c0, 0x2fcb: 0x00c0, + 0x2fcd: 0x00c0, 0x2fce: 0x00c0, 0x2fcf: 0x00c0, 0x2fd0: 0x00c0, 0x2fd1: 0x00c0, + 0x2fd2: 0x00c0, 0x2fd3: 0x00c0, 0x2fd4: 0x00c0, 0x2fd5: 0x00c0, 0x2fd6: 0x00c0, 0x2fd7: 0x00c0, + 0x2fd8: 0x00c0, 0x2fd9: 0x00c0, 0x2fda: 0x00c0, 0x2fdb: 0x00c0, 0x2fdc: 0x00c0, 0x2fdd: 0x00c0, + 0x2fde: 0x00c0, 0x2fdf: 0x00c0, 0x2fe0: 0x00c0, 0x2fe1: 0x00c0, 0x2fe2: 0x00c0, 0x2fe3: 0x00c0, + 0x2fe4: 0x00c0, 0x2fe5: 0x00c0, 0x2fe6: 0x00c0, 0x2fe8: 0x00c0, 0x2fe9: 0x00c0, + 0x2fea: 0x00c0, 0x2feb: 0x00c0, 0x2fec: 0x00c0, 0x2fed: 0x00c0, 0x2fee: 0x00c0, 0x2fef: 0x00c0, + 0x2ff0: 0x00c0, 0x2ff1: 0x00c0, 0x2ff2: 0x00c0, 0x2ff3: 0x00c0, 0x2ff4: 0x00c0, 0x2ff5: 0x00c0, + 0x2ff6: 0x00c0, 0x2ff7: 0x00c0, 0x2ff8: 0x00c0, 0x2ff9: 0x00c0, 0x2ffa: 0x00c0, + 0x2ffc: 0x00c0, 0x2ffd: 0x00c0, 0x2fff: 0x00c0, + // Block 0xc0, offset 0x3000 + 0x3000: 0x00c0, 0x3001: 0x00c0, 0x3002: 0x00c0, 0x3003: 0x00c0, 0x3004: 0x00c0, 0x3005: 0x00c0, + 0x3006: 0x00c0, 0x3007: 0x00c0, 0x3008: 0x00c0, 0x3009: 0x00c0, 0x300a: 0x00c0, 0x300b: 0x00c0, + 0x300c: 0x00c0, 0x300d: 0x00c0, 0x3010: 0x00c0, 0x3011: 0x00c0, + 0x3012: 0x00c0, 0x3013: 0x00c0, 0x3014: 0x00c0, 0x3015: 0x00c0, 0x3016: 0x00c0, 0x3017: 0x00c0, + 0x3018: 0x00c0, 0x3019: 0x00c0, 0x301a: 0x00c0, 0x301b: 0x00c0, 0x301c: 0x00c0, 0x301d: 0x00c0, + // Block 0xc1, offset 0x3040 + 0x3040: 0x00c0, 0x3041: 0x00c0, 0x3042: 0x00c0, 0x3043: 0x00c0, 0x3044: 0x00c0, 0x3045: 0x00c0, + 0x3046: 0x00c0, 0x3047: 0x00c0, 0x3048: 0x00c0, 0x3049: 0x00c0, 0x304a: 0x00c0, 0x304b: 0x00c0, + 0x304c: 0x00c0, 0x304d: 0x00c0, 0x304e: 0x00c0, 0x304f: 0x00c0, 0x3050: 0x00c0, 0x3051: 0x00c0, + 0x3052: 0x00c0, 0x3053: 0x00c0, 0x3054: 0x00c0, 0x3055: 0x00c0, 0x3056: 0x00c0, 0x3057: 0x00c0, + 0x3058: 0x00c0, 0x3059: 0x00c0, 0x305a: 0x00c0, 0x305b: 0x00c0, 0x305c: 0x00c0, 0x305d: 0x00c0, + 0x305e: 0x00c0, 0x305f: 0x00c0, 0x3060: 0x00c0, 0x3061: 0x00c0, 0x3062: 0x00c0, 0x3063: 0x00c0, + 0x3064: 0x00c0, 0x3065: 0x00c0, 0x3066: 0x00c0, 0x3067: 0x00c0, 0x3068: 0x00c0, 0x3069: 0x00c0, + 0x306a: 0x00c0, 0x306b: 0x00c0, 0x306c: 0x00c0, 0x306d: 0x00c0, 0x306e: 0x00c0, 0x306f: 0x00c0, + 0x3070: 0x00c0, 0x3071: 0x00c0, 0x3072: 0x00c0, 0x3073: 0x00c0, 0x3074: 0x00c0, 0x3075: 0x00c0, + 0x3076: 0x00c0, 0x3077: 0x00c0, 0x3078: 0x00c0, 0x3079: 0x00c0, 0x307a: 0x00c0, + // Block 0xc2, offset 0x3080 + 0x3080: 0x0080, 0x3081: 0x0080, 0x3082: 0x0080, + 0x3087: 0x0080, 0x3088: 0x0080, 0x3089: 0x0080, 0x308a: 0x0080, 0x308b: 0x0080, + 0x308c: 0x0080, 0x308d: 0x0080, 0x308e: 0x0080, 0x308f: 0x0080, 0x3090: 0x0080, 0x3091: 0x0080, + 0x3092: 0x0080, 0x3093: 0x0080, 0x3094: 0x0080, 0x3095: 0x0080, 0x3096: 0x0080, 0x3097: 0x0080, + 0x3098: 0x0080, 0x3099: 0x0080, 0x309a: 0x0080, 0x309b: 0x0080, 0x309c: 0x0080, 0x309d: 0x0080, + 0x309e: 0x0080, 0x309f: 0x0080, 0x30a0: 0x0080, 0x30a1: 0x0080, 0x30a2: 0x0080, 0x30a3: 0x0080, + 0x30a4: 0x0080, 0x30a5: 0x0080, 0x30a6: 0x0080, 0x30a7: 0x0080, 0x30a8: 0x0080, 0x30a9: 0x0080, + 0x30aa: 0x0080, 0x30ab: 0x0080, 0x30ac: 0x0080, 0x30ad: 0x0080, 0x30ae: 0x0080, 0x30af: 0x0080, + 0x30b0: 0x0080, 0x30b1: 0x0080, 0x30b2: 0x0080, 0x30b3: 0x0080, + 0x30b7: 0x0080, 0x30b8: 0x0080, 0x30b9: 0x0080, 0x30ba: 0x0080, 0x30bb: 0x0080, + 0x30bc: 0x0080, 0x30bd: 0x0080, 0x30be: 0x0080, 0x30bf: 0x0080, + // Block 0xc3, offset 0x30c0 + 0x30c0: 0x0088, 0x30c1: 0x0088, 0x30c2: 0x0088, 0x30c3: 0x0088, 0x30c4: 0x0088, 0x30c5: 0x0088, + 0x30c6: 0x0088, 0x30c7: 0x0088, 0x30c8: 0x0088, 0x30c9: 0x0088, 0x30ca: 0x0088, 0x30cb: 0x0088, + 0x30cc: 0x0088, 0x30cd: 0x0088, 0x30ce: 0x0088, 0x30cf: 0x0088, 0x30d0: 0x0088, 0x30d1: 0x0088, + 0x30d2: 0x0088, 0x30d3: 0x0088, 0x30d4: 0x0088, 0x30d5: 0x0088, 0x30d6: 0x0088, 0x30d7: 0x0088, + 0x30d8: 0x0088, 0x30d9: 0x0088, 0x30da: 0x0088, 0x30db: 0x0088, 0x30dc: 0x0088, 0x30dd: 0x0088, + 0x30de: 0x0088, 0x30df: 0x0088, 0x30e0: 0x0088, 0x30e1: 0x0088, 0x30e2: 0x0088, 0x30e3: 0x0088, + 0x30e4: 0x0088, 0x30e5: 0x0088, 0x30e6: 0x0088, 0x30e7: 0x0088, 0x30e8: 0x0088, 0x30e9: 0x0088, + 0x30ea: 0x0088, 0x30eb: 0x0088, 0x30ec: 0x0088, 0x30ed: 0x0088, 0x30ee: 0x0088, 0x30ef: 0x0088, + 0x30f0: 0x0088, 0x30f1: 0x0088, 0x30f2: 0x0088, 0x30f3: 0x0088, 0x30f4: 0x0088, 0x30f5: 0x0088, + 0x30f6: 0x0088, 0x30f7: 0x0088, 0x30f8: 0x0088, 0x30f9: 0x0088, 0x30fa: 0x0088, 0x30fb: 0x0088, + 0x30fc: 0x0088, 0x30fd: 0x0088, 0x30fe: 0x0088, 0x30ff: 0x0088, + // Block 0xc4, offset 0x3100 + 0x3100: 0x0088, 0x3101: 0x0088, 0x3102: 0x0088, 0x3103: 0x0088, 0x3104: 0x0088, 0x3105: 0x0088, + 0x3106: 0x0088, 0x3107: 0x0088, 0x3108: 0x0088, 0x3109: 0x0088, 0x310a: 0x0088, 0x310b: 0x0088, + 0x310c: 0x0088, 0x310d: 0x0088, 0x310e: 0x0088, 0x3110: 0x0080, 0x3111: 0x0080, + 0x3112: 0x0080, 0x3113: 0x0080, 0x3114: 0x0080, 0x3115: 0x0080, 0x3116: 0x0080, 0x3117: 0x0080, + 0x3118: 0x0080, 0x3119: 0x0080, 0x311a: 0x0080, 0x311b: 0x0080, + 0x3120: 0x0088, + // Block 0xc5, offset 0x3140 + 0x3150: 0x0080, 0x3151: 0x0080, + 0x3152: 0x0080, 0x3153: 0x0080, 0x3154: 0x0080, 0x3155: 0x0080, 0x3156: 0x0080, 0x3157: 0x0080, + 0x3158: 0x0080, 0x3159: 0x0080, 0x315a: 0x0080, 0x315b: 0x0080, 0x315c: 0x0080, 0x315d: 0x0080, + 0x315e: 0x0080, 0x315f: 0x0080, 0x3160: 0x0080, 0x3161: 0x0080, 0x3162: 0x0080, 0x3163: 0x0080, + 0x3164: 0x0080, 0x3165: 0x0080, 0x3166: 0x0080, 0x3167: 0x0080, 0x3168: 0x0080, 0x3169: 0x0080, + 0x316a: 0x0080, 0x316b: 0x0080, 0x316c: 0x0080, 0x316d: 0x0080, 0x316e: 0x0080, 0x316f: 0x0080, + 0x3170: 0x0080, 0x3171: 0x0080, 0x3172: 0x0080, 0x3173: 0x0080, 0x3174: 0x0080, 0x3175: 0x0080, + 0x3176: 0x0080, 0x3177: 0x0080, 0x3178: 0x0080, 0x3179: 0x0080, 0x317a: 0x0080, 0x317b: 0x0080, + 0x317c: 0x0080, 0x317d: 0x00c3, + // Block 0xc6, offset 0x3180 + 0x3180: 0x00c0, 0x3181: 0x00c0, 0x3182: 0x00c0, 0x3183: 0x00c0, 0x3184: 0x00c0, 0x3185: 0x00c0, + 0x3186: 0x00c0, 0x3187: 0x00c0, 0x3188: 0x00c0, 0x3189: 0x00c0, 0x318a: 0x00c0, 0x318b: 0x00c0, + 0x318c: 0x00c0, 0x318d: 0x00c0, 0x318e: 0x00c0, 0x318f: 0x00c0, 0x3190: 0x00c0, 0x3191: 0x00c0, + 0x3192: 0x00c0, 0x3193: 0x00c0, 0x3194: 0x00c0, 0x3195: 0x00c0, 0x3196: 0x00c0, 0x3197: 0x00c0, + 0x3198: 0x00c0, 0x3199: 0x00c0, 0x319a: 0x00c0, 0x319b: 0x00c0, 0x319c: 0x00c0, + 0x31a0: 0x00c0, 0x31a1: 0x00c0, 0x31a2: 0x00c0, 0x31a3: 0x00c0, + 0x31a4: 0x00c0, 0x31a5: 0x00c0, 0x31a6: 0x00c0, 0x31a7: 0x00c0, 0x31a8: 0x00c0, 0x31a9: 0x00c0, + 0x31aa: 0x00c0, 0x31ab: 0x00c0, 0x31ac: 0x00c0, 0x31ad: 0x00c0, 0x31ae: 0x00c0, 0x31af: 0x00c0, + 0x31b0: 0x00c0, 0x31b1: 0x00c0, 0x31b2: 0x00c0, 0x31b3: 0x00c0, 0x31b4: 0x00c0, 0x31b5: 0x00c0, + 0x31b6: 0x00c0, 0x31b7: 0x00c0, 0x31b8: 0x00c0, 0x31b9: 0x00c0, 0x31ba: 0x00c0, 0x31bb: 0x00c0, + 0x31bc: 0x00c0, 0x31bd: 0x00c0, 0x31be: 0x00c0, 0x31bf: 0x00c0, + // Block 0xc7, offset 0x31c0 + 0x31c0: 0x00c0, 0x31c1: 0x00c0, 0x31c2: 0x00c0, 0x31c3: 0x00c0, 0x31c4: 0x00c0, 0x31c5: 0x00c0, + 0x31c6: 0x00c0, 0x31c7: 0x00c0, 0x31c8: 0x00c0, 0x31c9: 0x00c0, 0x31ca: 0x00c0, 0x31cb: 0x00c0, + 0x31cc: 0x00c0, 0x31cd: 0x00c0, 0x31ce: 0x00c0, 0x31cf: 0x00c0, 0x31d0: 0x00c0, + 0x31e0: 0x00c3, 0x31e1: 0x0080, 0x31e2: 0x0080, 0x31e3: 0x0080, + 0x31e4: 0x0080, 0x31e5: 0x0080, 0x31e6: 0x0080, 0x31e7: 0x0080, 0x31e8: 0x0080, 0x31e9: 0x0080, + 0x31ea: 0x0080, 0x31eb: 0x0080, 0x31ec: 0x0080, 0x31ed: 0x0080, 0x31ee: 0x0080, 0x31ef: 0x0080, + 0x31f0: 0x0080, 0x31f1: 0x0080, 0x31f2: 0x0080, 0x31f3: 0x0080, 0x31f4: 0x0080, 0x31f5: 0x0080, + 0x31f6: 0x0080, 0x31f7: 0x0080, 0x31f8: 0x0080, 0x31f9: 0x0080, 0x31fa: 0x0080, 0x31fb: 0x0080, + // Block 0xc8, offset 0x3200 + 0x3200: 0x00c0, 0x3201: 0x00c0, 0x3202: 0x00c0, 0x3203: 0x00c0, 0x3204: 0x00c0, 0x3205: 0x00c0, + 0x3206: 0x00c0, 0x3207: 0x00c0, 0x3208: 0x00c0, 0x3209: 0x00c0, 0x320a: 0x00c0, 0x320b: 0x00c0, + 0x320c: 0x00c0, 0x320d: 0x00c0, 0x320e: 0x00c0, 0x320f: 0x00c0, 0x3210: 0x00c0, 0x3211: 0x00c0, + 0x3212: 0x00c0, 0x3213: 0x00c0, 0x3214: 0x00c0, 0x3215: 0x00c0, 0x3216: 0x00c0, 0x3217: 0x00c0, + 0x3218: 0x00c0, 0x3219: 0x00c0, 0x321a: 0x00c0, 0x321b: 0x00c0, 0x321c: 0x00c0, 0x321d: 0x00c0, + 0x321e: 0x00c0, 0x321f: 0x00c0, 0x3220: 0x0080, 0x3221: 0x0080, 0x3222: 0x0080, 0x3223: 0x0080, + 0x3230: 0x00c0, 0x3231: 0x00c0, 0x3232: 0x00c0, 0x3233: 0x00c0, 0x3234: 0x00c0, 0x3235: 0x00c0, + 0x3236: 0x00c0, 0x3237: 0x00c0, 0x3238: 0x00c0, 0x3239: 0x00c0, 0x323a: 0x00c0, 0x323b: 0x00c0, + 0x323c: 0x00c0, 0x323d: 0x00c0, 0x323e: 0x00c0, 0x323f: 0x00c0, + // Block 0xc9, offset 0x3240 + 0x3240: 0x00c0, 0x3241: 0x0080, 0x3242: 0x00c0, 0x3243: 0x00c0, 0x3244: 0x00c0, 0x3245: 0x00c0, + 0x3246: 0x00c0, 0x3247: 0x00c0, 0x3248: 0x00c0, 0x3249: 0x00c0, 0x324a: 0x0080, + 0x3250: 0x00c0, 0x3251: 0x00c0, + 0x3252: 0x00c0, 0x3253: 0x00c0, 0x3254: 0x00c0, 0x3255: 0x00c0, 0x3256: 0x00c0, 0x3257: 0x00c0, + 0x3258: 0x00c0, 0x3259: 0x00c0, 0x325a: 0x00c0, 0x325b: 0x00c0, 0x325c: 0x00c0, 0x325d: 0x00c0, + 0x325e: 0x00c0, 0x325f: 0x00c0, 0x3260: 0x00c0, 0x3261: 0x00c0, 0x3262: 0x00c0, 0x3263: 0x00c0, + 0x3264: 0x00c0, 0x3265: 0x00c0, 0x3266: 0x00c0, 0x3267: 0x00c0, 0x3268: 0x00c0, 0x3269: 0x00c0, + 0x326a: 0x00c0, 0x326b: 0x00c0, 0x326c: 0x00c0, 0x326d: 0x00c0, 0x326e: 0x00c0, 0x326f: 0x00c0, + 0x3270: 0x00c0, 0x3271: 0x00c0, 0x3272: 0x00c0, 0x3273: 0x00c0, 0x3274: 0x00c0, 0x3275: 0x00c0, + 0x3276: 0x00c3, 0x3277: 0x00c3, 0x3278: 0x00c3, 0x3279: 0x00c3, 0x327a: 0x00c3, + // Block 0xca, offset 0x3280 + 0x3280: 0x00c0, 0x3281: 0x00c0, 0x3282: 0x00c0, 0x3283: 0x00c0, 0x3284: 0x00c0, 0x3285: 0x00c0, + 0x3286: 0x00c0, 0x3287: 0x00c0, 0x3288: 0x00c0, 0x3289: 0x00c0, 0x328a: 0x00c0, 0x328b: 0x00c0, + 0x328c: 0x00c0, 0x328d: 0x00c0, 0x328e: 0x00c0, 0x328f: 0x00c0, 0x3290: 0x00c0, 0x3291: 0x00c0, + 0x3292: 0x00c0, 0x3293: 0x00c0, 0x3294: 0x00c0, 0x3295: 0x00c0, 0x3296: 0x00c0, 0x3297: 0x00c0, + 0x3298: 0x00c0, 0x3299: 0x00c0, 0x329a: 0x00c0, 0x329b: 0x00c0, 0x329c: 0x00c0, 0x329d: 0x00c0, + 0x329f: 0x0080, 0x32a0: 0x00c0, 0x32a1: 0x00c0, 0x32a2: 0x00c0, 0x32a3: 0x00c0, + 0x32a4: 0x00c0, 0x32a5: 0x00c0, 0x32a6: 0x00c0, 0x32a7: 0x00c0, 0x32a8: 0x00c0, 0x32a9: 0x00c0, + 0x32aa: 0x00c0, 0x32ab: 0x00c0, 0x32ac: 0x00c0, 0x32ad: 0x00c0, 0x32ae: 0x00c0, 0x32af: 0x00c0, + 0x32b0: 0x00c0, 0x32b1: 0x00c0, 0x32b2: 0x00c0, 0x32b3: 0x00c0, 0x32b4: 0x00c0, 0x32b5: 0x00c0, + 0x32b6: 0x00c0, 0x32b7: 0x00c0, 0x32b8: 0x00c0, 0x32b9: 0x00c0, 0x32ba: 0x00c0, 0x32bb: 0x00c0, + 0x32bc: 0x00c0, 0x32bd: 0x00c0, 0x32be: 0x00c0, 0x32bf: 0x00c0, + // Block 0xcb, offset 0x32c0 + 0x32c0: 0x00c0, 0x32c1: 0x00c0, 0x32c2: 0x00c0, 0x32c3: 0x00c0, + 0x32c8: 0x00c0, 0x32c9: 0x00c0, 0x32ca: 0x00c0, 0x32cb: 0x00c0, + 0x32cc: 0x00c0, 0x32cd: 0x00c0, 0x32ce: 0x00c0, 0x32cf: 0x00c0, 0x32d0: 0x0080, 0x32d1: 0x0080, + 0x32d2: 0x0080, 0x32d3: 0x0080, 0x32d4: 0x0080, 0x32d5: 0x0080, + // Block 0xcc, offset 0x3300 + 0x3300: 0x00c0, 0x3301: 0x00c0, 0x3302: 0x00c0, 0x3303: 0x00c0, 0x3304: 0x00c0, 0x3305: 0x00c0, + 0x3306: 0x00c0, 0x3307: 0x00c0, 0x3308: 0x00c0, 0x3309: 0x00c0, 0x330a: 0x00c0, 0x330b: 0x00c0, + 0x330c: 0x00c0, 0x330d: 0x00c0, 0x330e: 0x00c0, 0x330f: 0x00c0, 0x3310: 0x00c0, 0x3311: 0x00c0, + 0x3312: 0x00c0, 0x3313: 0x00c0, 0x3314: 0x00c0, 0x3315: 0x00c0, 0x3316: 0x00c0, 0x3317: 0x00c0, + 0x3318: 0x00c0, 0x3319: 0x00c0, 0x331a: 0x00c0, 0x331b: 0x00c0, 0x331c: 0x00c0, 0x331d: 0x00c0, + 0x3320: 0x00c0, 0x3321: 0x00c0, 0x3322: 0x00c0, 0x3323: 0x00c0, + 0x3324: 0x00c0, 0x3325: 0x00c0, 0x3326: 0x00c0, 0x3327: 0x00c0, 0x3328: 0x00c0, 0x3329: 0x00c0, + 0x3330: 0x00c0, 0x3331: 0x00c0, 0x3332: 0x00c0, 0x3333: 0x00c0, 0x3334: 0x00c0, 0x3335: 0x00c0, + 0x3336: 0x00c0, 0x3337: 0x00c0, 0x3338: 0x00c0, 0x3339: 0x00c0, 0x333a: 0x00c0, 0x333b: 0x00c0, + 0x333c: 0x00c0, 0x333d: 0x00c0, 0x333e: 0x00c0, 0x333f: 0x00c0, + // Block 0xcd, offset 0x3340 + 0x3340: 0x00c0, 0x3341: 0x00c0, 0x3342: 0x00c0, 0x3343: 0x00c0, 0x3344: 0x00c0, 0x3345: 0x00c0, + 0x3346: 0x00c0, 0x3347: 0x00c0, 0x3348: 0x00c0, 0x3349: 0x00c0, 0x334a: 0x00c0, 0x334b: 0x00c0, + 0x334c: 0x00c0, 0x334d: 0x00c0, 0x334e: 0x00c0, 0x334f: 0x00c0, 0x3350: 0x00c0, 0x3351: 0x00c0, + 0x3352: 0x00c0, 0x3353: 0x00c0, + 0x3358: 0x00c0, 0x3359: 0x00c0, 0x335a: 0x00c0, 0x335b: 0x00c0, 0x335c: 0x00c0, 0x335d: 0x00c0, + 0x335e: 0x00c0, 0x335f: 0x00c0, 0x3360: 0x00c0, 0x3361: 0x00c0, 0x3362: 0x00c0, 0x3363: 0x00c0, + 0x3364: 0x00c0, 0x3365: 0x00c0, 0x3366: 0x00c0, 0x3367: 0x00c0, 0x3368: 0x00c0, 0x3369: 0x00c0, + 0x336a: 0x00c0, 0x336b: 0x00c0, 0x336c: 0x00c0, 0x336d: 0x00c0, 0x336e: 0x00c0, 0x336f: 0x00c0, + 0x3370: 0x00c0, 0x3371: 0x00c0, 0x3372: 0x00c0, 0x3373: 0x00c0, 0x3374: 0x00c0, 0x3375: 0x00c0, + 0x3376: 0x00c0, 0x3377: 0x00c0, 0x3378: 0x00c0, 0x3379: 0x00c0, 0x337a: 0x00c0, 0x337b: 0x00c0, + // Block 0xce, offset 0x3380 + 0x3380: 0x00c0, 0x3381: 0x00c0, 0x3382: 0x00c0, 0x3383: 0x00c0, 0x3384: 0x00c0, 0x3385: 0x00c0, + 0x3386: 0x00c0, 0x3387: 0x00c0, 0x3388: 0x00c0, 0x3389: 0x00c0, 0x338a: 0x00c0, 0x338b: 0x00c0, + 0x338c: 0x00c0, 0x338d: 0x00c0, 0x338e: 0x00c0, 0x338f: 0x00c0, 0x3390: 0x00c0, 0x3391: 0x00c0, + 0x3392: 0x00c0, 0x3393: 0x00c0, 0x3394: 0x00c0, 0x3395: 0x00c0, 0x3396: 0x00c0, 0x3397: 0x00c0, + 0x3398: 0x00c0, 0x3399: 0x00c0, 0x339a: 0x00c0, 0x339b: 0x00c0, 0x339c: 0x00c0, 0x339d: 0x00c0, + 0x339e: 0x00c0, 0x339f: 0x00c0, 0x33a0: 0x00c0, 0x33a1: 0x00c0, 0x33a2: 0x00c0, 0x33a3: 0x00c0, + 0x33a4: 0x00c0, 0x33a5: 0x00c0, 0x33a6: 0x00c0, 0x33a7: 0x00c0, + 0x33b0: 0x00c0, 0x33b1: 0x00c0, 0x33b2: 0x00c0, 0x33b3: 0x00c0, 0x33b4: 0x00c0, 0x33b5: 0x00c0, + 0x33b6: 0x00c0, 0x33b7: 0x00c0, 0x33b8: 0x00c0, 0x33b9: 0x00c0, 0x33ba: 0x00c0, 0x33bb: 0x00c0, + 0x33bc: 0x00c0, 0x33bd: 0x00c0, 0x33be: 0x00c0, 0x33bf: 0x00c0, + // Block 0xcf, offset 0x33c0 + 0x33c0: 0x00c0, 0x33c1: 0x00c0, 0x33c2: 0x00c0, 0x33c3: 0x00c0, 0x33c4: 0x00c0, 0x33c5: 0x00c0, + 0x33c6: 0x00c0, 0x33c7: 0x00c0, 0x33c8: 0x00c0, 0x33c9: 0x00c0, 0x33ca: 0x00c0, 0x33cb: 0x00c0, + 0x33cc: 0x00c0, 0x33cd: 0x00c0, 0x33ce: 0x00c0, 0x33cf: 0x00c0, 0x33d0: 0x00c0, 0x33d1: 0x00c0, + 0x33d2: 0x00c0, 0x33d3: 0x00c0, 0x33d4: 0x00c0, 0x33d5: 0x00c0, 0x33d6: 0x00c0, 0x33d7: 0x00c0, + 0x33d8: 0x00c0, 0x33d9: 0x00c0, 0x33da: 0x00c0, 0x33db: 0x00c0, 0x33dc: 0x00c0, 0x33dd: 0x00c0, + 0x33de: 0x00c0, 0x33df: 0x00c0, 0x33e0: 0x00c0, 0x33e1: 0x00c0, 0x33e2: 0x00c0, 0x33e3: 0x00c0, + 0x33ef: 0x0080, + // Block 0xd0, offset 0x3400 + 0x3400: 0x00c0, 0x3401: 0x00c0, 0x3402: 0x00c0, 0x3403: 0x00c0, 0x3404: 0x00c0, 0x3405: 0x00c0, + 0x3406: 0x00c0, 0x3407: 0x00c0, 0x3408: 0x00c0, 0x3409: 0x00c0, 0x340a: 0x00c0, 0x340b: 0x00c0, + 0x340c: 0x00c0, 0x340d: 0x00c0, 0x340e: 0x00c0, 0x340f: 0x00c0, 0x3410: 0x00c0, 0x3411: 0x00c0, + 0x3412: 0x00c0, 0x3413: 0x00c0, 0x3414: 0x00c0, 0x3415: 0x00c0, 0x3416: 0x00c0, 0x3417: 0x00c0, + 0x3418: 0x00c0, 0x3419: 0x00c0, 0x341a: 0x00c0, 0x341b: 0x00c0, 0x341c: 0x00c0, 0x341d: 0x00c0, + 0x341e: 0x00c0, 0x341f: 0x00c0, 0x3420: 0x00c0, 0x3421: 0x00c0, 0x3422: 0x00c0, 0x3423: 0x00c0, + 0x3424: 0x00c0, 0x3425: 0x00c0, 0x3426: 0x00c0, 0x3427: 0x00c0, 0x3428: 0x00c0, 0x3429: 0x00c0, + 0x342a: 0x00c0, 0x342b: 0x00c0, 0x342c: 0x00c0, 0x342d: 0x00c0, 0x342e: 0x00c0, 0x342f: 0x00c0, + 0x3430: 0x00c0, 0x3431: 0x00c0, 0x3432: 0x00c0, 0x3433: 0x00c0, 0x3434: 0x00c0, 0x3435: 0x00c0, + 0x3436: 0x00c0, + // Block 0xd1, offset 0x3440 + 0x3440: 0x00c0, 0x3441: 0x00c0, 0x3442: 0x00c0, 0x3443: 0x00c0, 0x3444: 0x00c0, 0x3445: 0x00c0, + 0x3446: 0x00c0, 0x3447: 0x00c0, 0x3448: 0x00c0, 0x3449: 0x00c0, 0x344a: 0x00c0, 0x344b: 0x00c0, + 0x344c: 0x00c0, 0x344d: 0x00c0, 0x344e: 0x00c0, 0x344f: 0x00c0, 0x3450: 0x00c0, 0x3451: 0x00c0, + 0x3452: 0x00c0, 0x3453: 0x00c0, 0x3454: 0x00c0, 0x3455: 0x00c0, + 0x3460: 0x00c0, 0x3461: 0x00c0, 0x3462: 0x00c0, 0x3463: 0x00c0, + 0x3464: 0x00c0, 0x3465: 0x00c0, 0x3466: 0x00c0, 0x3467: 0x00c0, + // Block 0xd2, offset 0x3480 + 0x3480: 0x00c0, 0x3481: 0x00c0, 0x3482: 0x00c0, 0x3483: 0x00c0, 0x3484: 0x00c0, 0x3485: 0x00c0, + 0x3488: 0x00c0, 0x348a: 0x00c0, 0x348b: 0x00c0, + 0x348c: 0x00c0, 0x348d: 0x00c0, 0x348e: 0x00c0, 0x348f: 0x00c0, 0x3490: 0x00c0, 0x3491: 0x00c0, + 0x3492: 0x00c0, 0x3493: 0x00c0, 0x3494: 0x00c0, 0x3495: 0x00c0, 0x3496: 0x00c0, 0x3497: 0x00c0, + 0x3498: 0x00c0, 0x3499: 0x00c0, 0x349a: 0x00c0, 0x349b: 0x00c0, 0x349c: 0x00c0, 0x349d: 0x00c0, + 0x349e: 0x00c0, 0x349f: 0x00c0, 0x34a0: 0x00c0, 0x34a1: 0x00c0, 0x34a2: 0x00c0, 0x34a3: 0x00c0, + 0x34a4: 0x00c0, 0x34a5: 0x00c0, 0x34a6: 0x00c0, 0x34a7: 0x00c0, 0x34a8: 0x00c0, 0x34a9: 0x00c0, + 0x34aa: 0x00c0, 0x34ab: 0x00c0, 0x34ac: 0x00c0, 0x34ad: 0x00c0, 0x34ae: 0x00c0, 0x34af: 0x00c0, + 0x34b0: 0x00c0, 0x34b1: 0x00c0, 0x34b2: 0x00c0, 0x34b3: 0x00c0, 0x34b4: 0x00c0, 0x34b5: 0x00c0, + 0x34b7: 0x00c0, 0x34b8: 0x00c0, + 0x34bc: 0x00c0, 0x34bf: 0x00c0, + // Block 0xd3, offset 0x34c0 + 0x34c0: 0x00c0, 0x34c1: 0x00c0, 0x34c2: 0x00c0, 0x34c3: 0x00c0, 0x34c4: 0x00c0, 0x34c5: 0x00c0, + 0x34c6: 0x00c0, 0x34c7: 0x00c0, 0x34c8: 0x00c0, 0x34c9: 0x00c0, 0x34ca: 0x00c0, 0x34cb: 0x00c0, + 0x34cc: 0x00c0, 0x34cd: 0x00c0, 0x34ce: 0x00c0, 0x34cf: 0x00c0, 0x34d0: 0x00c0, 0x34d1: 0x00c0, + 0x34d2: 0x00c0, 0x34d3: 0x00c0, 0x34d4: 0x00c0, 0x34d5: 0x00c0, 0x34d7: 0x0080, + 0x34d8: 0x0080, 0x34d9: 0x0080, 0x34da: 0x0080, 0x34db: 0x0080, 0x34dc: 0x0080, 0x34dd: 0x0080, + 0x34de: 0x0080, 0x34df: 0x0080, 0x34e0: 0x00c0, 0x34e1: 0x00c0, 0x34e2: 0x00c0, 0x34e3: 0x00c0, + 0x34e4: 0x00c0, 0x34e5: 0x00c0, 0x34e6: 0x00c0, 0x34e7: 0x00c0, 0x34e8: 0x00c0, 0x34e9: 0x00c0, + 0x34ea: 0x00c0, 0x34eb: 0x00c0, 0x34ec: 0x00c0, 0x34ed: 0x00c0, 0x34ee: 0x00c0, 0x34ef: 0x00c0, + 0x34f0: 0x00c0, 0x34f1: 0x00c0, 0x34f2: 0x00c0, 0x34f3: 0x00c0, 0x34f4: 0x00c0, 0x34f5: 0x00c0, + 0x34f6: 0x00c0, 0x34f7: 0x0080, 0x34f8: 0x0080, 0x34f9: 0x0080, 0x34fa: 0x0080, 0x34fb: 0x0080, + 0x34fc: 0x0080, 0x34fd: 0x0080, 0x34fe: 0x0080, 0x34ff: 0x0080, + // Block 0xd4, offset 0x3500 + 0x3500: 0x00c0, 0x3501: 0x00c0, 0x3502: 0x00c0, 0x3503: 0x00c0, 0x3504: 0x00c0, 0x3505: 0x00c0, + 0x3506: 0x00c0, 0x3507: 0x00c0, 0x3508: 0x00c0, 0x3509: 0x00c0, 0x350a: 0x00c0, 0x350b: 0x00c0, + 0x350c: 0x00c0, 0x350d: 0x00c0, 0x350e: 0x00c0, 0x350f: 0x00c0, 0x3510: 0x00c0, 0x3511: 0x00c0, + 0x3512: 0x00c0, 0x3513: 0x00c0, 0x3514: 0x00c0, 0x3515: 0x00c0, 0x3516: 0x00c0, 0x3517: 0x00c0, + 0x3518: 0x00c0, 0x3519: 0x00c0, 0x351a: 0x00c0, 0x351b: 0x00c0, 0x351c: 0x00c0, 0x351d: 0x00c0, + 0x351e: 0x00c0, + 0x3527: 0x0080, 0x3528: 0x0080, 0x3529: 0x0080, + 0x352a: 0x0080, 0x352b: 0x0080, 0x352c: 0x0080, 0x352d: 0x0080, 0x352e: 0x0080, 0x352f: 0x0080, + // Block 0xd5, offset 0x3540 + 0x3560: 0x00c0, 0x3561: 0x00c0, 0x3562: 0x00c0, 0x3563: 0x00c0, + 0x3564: 0x00c0, 0x3565: 0x00c0, 0x3566: 0x00c0, 0x3567: 0x00c0, 0x3568: 0x00c0, 0x3569: 0x00c0, + 0x356a: 0x00c0, 0x356b: 0x00c0, 0x356c: 0x00c0, 0x356d: 0x00c0, 0x356e: 0x00c0, 0x356f: 0x00c0, + 0x3570: 0x00c0, 0x3571: 0x00c0, 0x3572: 0x00c0, 0x3574: 0x00c0, 0x3575: 0x00c0, + 0x357b: 0x0080, + 0x357c: 0x0080, 0x357d: 0x0080, 0x357e: 0x0080, 0x357f: 0x0080, + // Block 0xd6, offset 0x3580 + 0x3580: 0x00c0, 0x3581: 0x00c0, 0x3582: 0x00c0, 0x3583: 0x00c0, 0x3584: 0x00c0, 0x3585: 0x00c0, + 0x3586: 0x00c0, 0x3587: 0x00c0, 0x3588: 0x00c0, 0x3589: 0x00c0, 0x358a: 0x00c0, 0x358b: 0x00c0, + 0x358c: 0x00c0, 0x358d: 0x00c0, 0x358e: 0x00c0, 0x358f: 0x00c0, 0x3590: 0x00c0, 0x3591: 0x00c0, + 0x3592: 0x00c0, 0x3593: 0x00c0, 0x3594: 0x00c0, 0x3595: 0x00c0, 0x3596: 0x0080, 0x3597: 0x0080, + 0x3598: 0x0080, 0x3599: 0x0080, 0x359a: 0x0080, 0x359b: 0x0080, + 0x359f: 0x0080, 0x35a0: 0x00c0, 0x35a1: 0x00c0, 0x35a2: 0x00c0, 0x35a3: 0x00c0, + 0x35a4: 0x00c0, 0x35a5: 0x00c0, 0x35a6: 0x00c0, 0x35a7: 0x00c0, 0x35a8: 0x00c0, 0x35a9: 0x00c0, + 0x35aa: 0x00c0, 0x35ab: 0x00c0, 0x35ac: 0x00c0, 0x35ad: 0x00c0, 0x35ae: 0x00c0, 0x35af: 0x00c0, + 0x35b0: 0x00c0, 0x35b1: 0x00c0, 0x35b2: 0x00c0, 0x35b3: 0x00c0, 0x35b4: 0x00c0, 0x35b5: 0x00c0, + 0x35b6: 0x00c0, 0x35b7: 0x00c0, 0x35b8: 0x00c0, 0x35b9: 0x00c0, + 0x35bf: 0x0080, + // Block 0xd7, offset 0x35c0 + 0x35c0: 0x00c0, 0x35c1: 0x00c0, 0x35c2: 0x00c0, 0x35c3: 0x00c0, 0x35c4: 0x00c0, 0x35c5: 0x00c0, + 0x35c6: 0x00c0, 0x35c7: 0x00c0, 0x35c8: 0x00c0, 0x35c9: 0x00c0, 0x35ca: 0x00c0, 0x35cb: 0x00c0, + 0x35cc: 0x00c0, 0x35cd: 0x00c0, 0x35ce: 0x00c0, 0x35cf: 0x00c0, 0x35d0: 0x00c0, 0x35d1: 0x00c0, + 0x35d2: 0x00c0, 0x35d3: 0x00c0, 0x35d4: 0x00c0, 0x35d5: 0x00c0, 0x35d6: 0x00c0, 0x35d7: 0x00c0, + 0x35d8: 0x00c0, 0x35d9: 0x00c0, 0x35da: 0x00c0, 0x35db: 0x00c0, 0x35dc: 0x00c0, 0x35dd: 0x00c0, + 0x35de: 0x00c0, 0x35df: 0x00c0, 0x35e0: 0x00c0, 0x35e1: 0x00c0, 0x35e2: 0x00c0, 0x35e3: 0x00c0, + 0x35e4: 0x00c0, 0x35e5: 0x00c0, 0x35e6: 0x00c0, 0x35e7: 0x00c0, 0x35e8: 0x00c0, 0x35e9: 0x00c0, + 0x35ea: 0x00c0, 0x35eb: 0x00c0, 0x35ec: 0x00c0, 0x35ed: 0x00c0, 0x35ee: 0x00c0, 0x35ef: 0x00c0, + 0x35f0: 0x00c0, 0x35f1: 0x00c0, 0x35f2: 0x00c0, 0x35f3: 0x00c0, 0x35f4: 0x00c0, 0x35f5: 0x00c0, + 0x35f6: 0x00c0, 0x35f7: 0x00c0, + 0x35fc: 0x0080, 0x35fd: 0x0080, 0x35fe: 0x00c0, 0x35ff: 0x00c0, + // Block 0xd8, offset 0x3600 + 0x3600: 0x00c0, 0x3601: 0x00c3, 0x3602: 0x00c3, 0x3603: 0x00c3, 0x3605: 0x00c3, + 0x3606: 0x00c3, + 0x360c: 0x00c3, 0x360d: 0x00c3, 0x360e: 0x00c3, 0x360f: 0x00c3, 0x3610: 0x00c0, 0x3611: 0x00c0, + 0x3612: 0x00c0, 0x3613: 0x00c0, 0x3615: 0x00c0, 0x3616: 0x00c0, 0x3617: 0x00c0, + 0x3619: 0x00c0, 0x361a: 0x00c0, 0x361b: 0x00c0, 0x361c: 0x00c0, 0x361d: 0x00c0, + 0x361e: 0x00c0, 0x361f: 0x00c0, 0x3620: 0x00c0, 0x3621: 0x00c0, 0x3622: 0x00c0, 0x3623: 0x00c0, + 0x3624: 0x00c0, 0x3625: 0x00c0, 0x3626: 0x00c0, 0x3627: 0x00c0, 0x3628: 0x00c0, 0x3629: 0x00c0, + 0x362a: 0x00c0, 0x362b: 0x00c0, 0x362c: 0x00c0, 0x362d: 0x00c0, 0x362e: 0x00c0, 0x362f: 0x00c0, + 0x3630: 0x00c0, 0x3631: 0x00c0, 0x3632: 0x00c0, 0x3633: 0x00c0, + 0x3638: 0x00c3, 0x3639: 0x00c3, 0x363a: 0x00c3, + 0x363f: 0x00c6, + // Block 0xd9, offset 0x3640 + 0x3640: 0x0080, 0x3641: 0x0080, 0x3642: 0x0080, 0x3643: 0x0080, 0x3644: 0x0080, 0x3645: 0x0080, + 0x3646: 0x0080, 0x3647: 0x0080, + 0x3650: 0x0080, 0x3651: 0x0080, + 0x3652: 0x0080, 0x3653: 0x0080, 0x3654: 0x0080, 0x3655: 0x0080, 0x3656: 0x0080, 0x3657: 0x0080, + 0x3658: 0x0080, + 0x3660: 0x00c0, 0x3661: 0x00c0, 0x3662: 0x00c0, 0x3663: 0x00c0, + 0x3664: 0x00c0, 0x3665: 0x00c0, 0x3666: 0x00c0, 0x3667: 0x00c0, 0x3668: 0x00c0, 0x3669: 0x00c0, + 0x366a: 0x00c0, 0x366b: 0x00c0, 0x366c: 0x00c0, 0x366d: 0x00c0, 0x366e: 0x00c0, 0x366f: 0x00c0, + 0x3670: 0x00c0, 0x3671: 0x00c0, 0x3672: 0x00c0, 0x3673: 0x00c0, 0x3674: 0x00c0, 0x3675: 0x00c0, + 0x3676: 0x00c0, 0x3677: 0x00c0, 0x3678: 0x00c0, 0x3679: 0x00c0, 0x367a: 0x00c0, 0x367b: 0x00c0, + 0x367c: 0x00c0, 0x367d: 0x0080, 0x367e: 0x0080, 0x367f: 0x0080, + // Block 0xda, offset 0x3680 + 0x3680: 0x00c0, 0x3681: 0x00c0, 0x3682: 0x00c0, 0x3683: 0x00c0, 0x3684: 0x00c0, 0x3685: 0x00c0, + 0x3686: 0x00c0, 0x3687: 0x00c0, 0x3688: 0x00c0, 0x3689: 0x00c0, 0x368a: 0x00c0, 0x368b: 0x00c0, + 0x368c: 0x00c0, 0x368d: 0x00c0, 0x368e: 0x00c0, 0x368f: 0x00c0, 0x3690: 0x00c0, 0x3691: 0x00c0, + 0x3692: 0x00c0, 0x3693: 0x00c0, 0x3694: 0x00c0, 0x3695: 0x00c0, 0x3696: 0x00c0, 0x3697: 0x00c0, + 0x3698: 0x00c0, 0x3699: 0x00c0, 0x369a: 0x00c0, 0x369b: 0x00c0, 0x369c: 0x00c0, 0x369d: 0x0080, + 0x369e: 0x0080, 0x369f: 0x0080, + // Block 0xdb, offset 0x36c0 + 0x36c0: 0x00c2, 0x36c1: 0x00c2, 0x36c2: 0x00c2, 0x36c3: 0x00c2, 0x36c4: 0x00c2, 0x36c5: 0x00c4, + 0x36c6: 0x00c0, 0x36c7: 0x00c4, 0x36c8: 0x0080, 0x36c9: 0x00c4, 0x36ca: 0x00c4, 0x36cb: 0x00c0, + 0x36cc: 0x00c0, 0x36cd: 0x00c1, 0x36ce: 0x00c4, 0x36cf: 0x00c4, 0x36d0: 0x00c4, 0x36d1: 0x00c4, + 0x36d2: 0x00c4, 0x36d3: 0x00c2, 0x36d4: 0x00c2, 0x36d5: 0x00c2, 0x36d6: 0x00c2, 0x36d7: 0x00c1, + 0x36d8: 0x00c2, 0x36d9: 0x00c2, 0x36da: 0x00c2, 0x36db: 0x00c2, 0x36dc: 0x00c2, 0x36dd: 0x00c4, + 0x36de: 0x00c2, 0x36df: 0x00c2, 0x36e0: 0x00c2, 0x36e1: 0x00c4, 0x36e2: 0x00c0, 0x36e3: 0x00c0, + 0x36e4: 0x00c4, 0x36e5: 0x00c3, 0x36e6: 0x00c3, + 0x36eb: 0x0082, 0x36ec: 0x0082, 0x36ed: 0x0082, 0x36ee: 0x0082, 0x36ef: 0x0084, + 0x36f0: 0x0080, 0x36f1: 0x0080, 0x36f2: 0x0080, 0x36f3: 0x0080, 0x36f4: 0x0080, 0x36f5: 0x0080, + 0x36f6: 0x0080, + // Block 0xdc, offset 0x3700 + 0x3700: 0x00c0, 0x3701: 0x00c0, 0x3702: 0x00c0, 0x3703: 0x00c0, 0x3704: 0x00c0, 0x3705: 0x00c0, + 0x3706: 0x00c0, 0x3707: 0x00c0, 0x3708: 0x00c0, 0x3709: 0x00c0, 0x370a: 0x00c0, 0x370b: 0x00c0, + 0x370c: 0x00c0, 0x370d: 0x00c0, 0x370e: 0x00c0, 0x370f: 0x00c0, 0x3710: 0x00c0, 0x3711: 0x00c0, + 0x3712: 0x00c0, 0x3713: 0x00c0, 0x3714: 0x00c0, 0x3715: 0x00c0, 0x3716: 0x00c0, 0x3717: 0x00c0, + 0x3718: 0x00c0, 0x3719: 0x00c0, 0x371a: 0x00c0, 0x371b: 0x00c0, 0x371c: 0x00c0, 0x371d: 0x00c0, + 0x371e: 0x00c0, 0x371f: 0x00c0, 0x3720: 0x00c0, 0x3721: 0x00c0, 0x3722: 0x00c0, 0x3723: 0x00c0, + 0x3724: 0x00c0, 0x3725: 0x00c0, 0x3726: 0x00c0, 0x3727: 0x00c0, 0x3728: 0x00c0, 0x3729: 0x00c0, + 0x372a: 0x00c0, 0x372b: 0x00c0, 0x372c: 0x00c0, 0x372d: 0x00c0, 0x372e: 0x00c0, 0x372f: 0x00c0, + 0x3730: 0x00c0, 0x3731: 0x00c0, 0x3732: 0x00c0, 0x3733: 0x00c0, 0x3734: 0x00c0, 0x3735: 0x00c0, + 0x3739: 0x0080, 0x373a: 0x0080, 0x373b: 0x0080, + 0x373c: 0x0080, 0x373d: 0x0080, 0x373e: 0x0080, 0x373f: 0x0080, + // Block 0xdd, offset 0x3740 + 0x3740: 0x00c0, 0x3741: 0x00c0, 0x3742: 0x00c0, 0x3743: 0x00c0, 0x3744: 0x00c0, 0x3745: 0x00c0, + 0x3746: 0x00c0, 0x3747: 0x00c0, 0x3748: 0x00c0, 0x3749: 0x00c0, 0x374a: 0x00c0, 0x374b: 0x00c0, + 0x374c: 0x00c0, 0x374d: 0x00c0, 0x374e: 0x00c0, 0x374f: 0x00c0, 0x3750: 0x00c0, 0x3751: 0x00c0, + 0x3752: 0x00c0, 0x3753: 0x00c0, 0x3754: 0x00c0, 0x3755: 0x00c0, + 0x3758: 0x0080, 0x3759: 0x0080, 0x375a: 0x0080, 0x375b: 0x0080, 0x375c: 0x0080, 0x375d: 0x0080, + 0x375e: 0x0080, 0x375f: 0x0080, 0x3760: 0x00c0, 0x3761: 0x00c0, 0x3762: 0x00c0, 0x3763: 0x00c0, + 0x3764: 0x00c0, 0x3765: 0x00c0, 0x3766: 0x00c0, 0x3767: 0x00c0, 0x3768: 0x00c0, 0x3769: 0x00c0, + 0x376a: 0x00c0, 0x376b: 0x00c0, 0x376c: 0x00c0, 0x376d: 0x00c0, 0x376e: 0x00c0, 0x376f: 0x00c0, + 0x3770: 0x00c0, 0x3771: 0x00c0, 0x3772: 0x00c0, + 0x3778: 0x0080, 0x3779: 0x0080, 0x377a: 0x0080, 0x377b: 0x0080, + 0x377c: 0x0080, 0x377d: 0x0080, 0x377e: 0x0080, 0x377f: 0x0080, + // Block 0xde, offset 0x3780 + 0x3780: 0x00c2, 0x3781: 0x00c4, 0x3782: 0x00c2, 0x3783: 0x00c4, 0x3784: 0x00c4, 0x3785: 0x00c4, + 0x3786: 0x00c2, 0x3787: 0x00c2, 0x3788: 0x00c2, 0x3789: 0x00c4, 0x378a: 0x00c2, 0x378b: 0x00c2, + 0x378c: 0x00c4, 0x378d: 0x00c2, 0x378e: 0x00c4, 0x378f: 0x00c4, 0x3790: 0x00c2, 0x3791: 0x00c4, + 0x3799: 0x0080, 0x379a: 0x0080, 0x379b: 0x0080, 0x379c: 0x0080, + 0x37a9: 0x0084, + 0x37aa: 0x0084, 0x37ab: 0x0084, 0x37ac: 0x0084, 0x37ad: 0x0082, 0x37ae: 0x0082, 0x37af: 0x0080, + // Block 0xdf, offset 0x37c0 + 0x37c0: 0x00c0, 0x37c1: 0x00c0, 0x37c2: 0x00c0, 0x37c3: 0x00c0, 0x37c4: 0x00c0, 0x37c5: 0x00c0, + 0x37c6: 0x00c0, 0x37c7: 0x00c0, 0x37c8: 0x00c0, 0x37c9: 0x00c0, 0x37ca: 0x00c0, 0x37cb: 0x00c0, + 0x37cc: 0x00c0, 0x37cd: 0x00c0, 0x37ce: 0x00c0, 0x37cf: 0x00c0, 0x37d0: 0x00c0, 0x37d1: 0x00c0, + 0x37d2: 0x00c0, 0x37d3: 0x00c0, 0x37d4: 0x00c0, 0x37d5: 0x00c0, 0x37d6: 0x00c0, 0x37d7: 0x00c0, + 0x37d8: 0x00c0, 0x37d9: 0x00c0, 0x37da: 0x00c0, 0x37db: 0x00c0, 0x37dc: 0x00c0, 0x37dd: 0x00c0, + 0x37de: 0x00c0, 0x37df: 0x00c0, 0x37e0: 0x00c0, 0x37e1: 0x00c0, 0x37e2: 0x00c0, 0x37e3: 0x00c0, + 0x37e4: 0x00c0, 0x37e5: 0x00c0, 0x37e6: 0x00c0, 0x37e7: 0x00c0, 0x37e8: 0x00c0, 0x37e9: 0x00c0, + 0x37ea: 0x00c0, 0x37eb: 0x00c0, 0x37ec: 0x00c0, 0x37ed: 0x00c0, 0x37ee: 0x00c0, 0x37ef: 0x00c0, + 0x37f0: 0x00c0, 0x37f1: 0x00c0, 0x37f2: 0x00c0, + // Block 0xe0, offset 0x3800 + 0x3800: 0x00c0, 0x3801: 0x00c0, 0x3802: 0x00c0, 0x3803: 0x00c0, 0x3804: 0x00c0, 0x3805: 0x00c0, + 0x3806: 0x00c0, 0x3807: 0x00c0, 0x3808: 0x00c0, 0x3809: 0x00c0, 0x380a: 0x00c0, 0x380b: 0x00c0, + 0x380c: 0x00c0, 0x380d: 0x00c0, 0x380e: 0x00c0, 0x380f: 0x00c0, 0x3810: 0x00c0, 0x3811: 0x00c0, + 0x3812: 0x00c0, 0x3813: 0x00c0, 0x3814: 0x00c0, 0x3815: 0x00c0, 0x3816: 0x00c0, 0x3817: 0x00c0, + 0x3818: 0x00c0, 0x3819: 0x00c0, 0x381a: 0x00c0, 0x381b: 0x00c0, 0x381c: 0x00c0, 0x381d: 0x00c0, + 0x381e: 0x00c0, 0x381f: 0x00c0, 0x3820: 0x00c0, 0x3821: 0x00c0, 0x3822: 0x00c0, 0x3823: 0x00c0, + 0x3824: 0x00c0, 0x3825: 0x00c0, 0x3826: 0x00c0, 0x3827: 0x00c0, 0x3828: 0x00c0, 0x3829: 0x00c0, + 0x382a: 0x00c0, 0x382b: 0x00c0, 0x382c: 0x00c0, 0x382d: 0x00c0, 0x382e: 0x00c0, 0x382f: 0x00c0, + 0x3830: 0x00c0, 0x3831: 0x00c0, 0x3832: 0x00c0, + 0x383a: 0x0080, 0x383b: 0x0080, + 0x383c: 0x0080, 0x383d: 0x0080, 0x383e: 0x0080, 0x383f: 0x0080, + // Block 0xe1, offset 0x3840 + 0x3860: 0x0080, 0x3861: 0x0080, 0x3862: 0x0080, 0x3863: 0x0080, + 0x3864: 0x0080, 0x3865: 0x0080, 0x3866: 0x0080, 0x3867: 0x0080, 0x3868: 0x0080, 0x3869: 0x0080, + 0x386a: 0x0080, 0x386b: 0x0080, 0x386c: 0x0080, 0x386d: 0x0080, 0x386e: 0x0080, 0x386f: 0x0080, + 0x3870: 0x0080, 0x3871: 0x0080, 0x3872: 0x0080, 0x3873: 0x0080, 0x3874: 0x0080, 0x3875: 0x0080, + 0x3876: 0x0080, 0x3877: 0x0080, 0x3878: 0x0080, 0x3879: 0x0080, 0x387a: 0x0080, 0x387b: 0x0080, + 0x387c: 0x0080, 0x387d: 0x0080, 0x387e: 0x0080, + // Block 0xe2, offset 0x3880 + 0x3880: 0x00c0, 0x3881: 0x00c3, 0x3882: 0x00c0, 0x3883: 0x00c0, 0x3884: 0x00c0, 0x3885: 0x00c0, + 0x3886: 0x00c0, 0x3887: 0x00c0, 0x3888: 0x00c0, 0x3889: 0x00c0, 0x388a: 0x00c0, 0x388b: 0x00c0, + 0x388c: 0x00c0, 0x388d: 0x00c0, 0x388e: 0x00c0, 0x388f: 0x00c0, 0x3890: 0x00c0, 0x3891: 0x00c0, + 0x3892: 0x00c0, 0x3893: 0x00c0, 0x3894: 0x00c0, 0x3895: 0x00c0, 0x3896: 0x00c0, 0x3897: 0x00c0, + 0x3898: 0x00c0, 0x3899: 0x00c0, 0x389a: 0x00c0, 0x389b: 0x00c0, 0x389c: 0x00c0, 0x389d: 0x00c0, + 0x389e: 0x00c0, 0x389f: 0x00c0, 0x38a0: 0x00c0, 0x38a1: 0x00c0, 0x38a2: 0x00c0, 0x38a3: 0x00c0, + 0x38a4: 0x00c0, 0x38a5: 0x00c0, 0x38a6: 0x00c0, 0x38a7: 0x00c0, 0x38a8: 0x00c0, 0x38a9: 0x00c0, + 0x38aa: 0x00c0, 0x38ab: 0x00c0, 0x38ac: 0x00c0, 0x38ad: 0x00c0, 0x38ae: 0x00c0, 0x38af: 0x00c0, + 0x38b0: 0x00c0, 0x38b1: 0x00c0, 0x38b2: 0x00c0, 0x38b3: 0x00c0, 0x38b4: 0x00c0, 0x38b5: 0x00c0, + 0x38b6: 0x00c0, 0x38b7: 0x00c0, 0x38b8: 0x00c3, 0x38b9: 0x00c3, 0x38ba: 0x00c3, 0x38bb: 0x00c3, + 0x38bc: 0x00c3, 0x38bd: 0x00c3, 0x38be: 0x00c3, 0x38bf: 0x00c3, + // Block 0xe3, offset 0x38c0 + 0x38c0: 0x00c3, 0x38c1: 0x00c3, 0x38c2: 0x00c3, 0x38c3: 0x00c3, 0x38c4: 0x00c3, 0x38c5: 0x00c3, + 0x38c6: 0x00c6, 0x38c7: 0x0080, 0x38c8: 0x0080, 0x38c9: 0x0080, 0x38ca: 0x0080, 0x38cb: 0x0080, + 0x38cc: 0x0080, 0x38cd: 0x0080, + 0x38d2: 0x0080, 0x38d3: 0x0080, 0x38d4: 0x0080, 0x38d5: 0x0080, 0x38d6: 0x0080, 0x38d7: 0x0080, + 0x38d8: 0x0080, 0x38d9: 0x0080, 0x38da: 0x0080, 0x38db: 0x0080, 0x38dc: 0x0080, 0x38dd: 0x0080, + 0x38de: 0x0080, 0x38df: 0x0080, 0x38e0: 0x0080, 0x38e1: 0x0080, 0x38e2: 0x0080, 0x38e3: 0x0080, + 0x38e4: 0x0080, 0x38e5: 0x0080, 0x38e6: 0x00c0, 0x38e7: 0x00c0, 0x38e8: 0x00c0, 0x38e9: 0x00c0, + 0x38ea: 0x00c0, 0x38eb: 0x00c0, 0x38ec: 0x00c0, 0x38ed: 0x00c0, 0x38ee: 0x00c0, 0x38ef: 0x00c0, + 0x38ff: 0x00c6, + // Block 0xe4, offset 0x3900 + 0x3900: 0x00c3, 0x3901: 0x00c3, 0x3902: 0x00c0, 0x3903: 0x00c0, 0x3904: 0x00c0, 0x3905: 0x00c0, + 0x3906: 0x00c0, 0x3907: 0x00c0, 0x3908: 0x00c0, 0x3909: 0x00c0, 0x390a: 0x00c0, 0x390b: 0x00c0, + 0x390c: 0x00c0, 0x390d: 0x00c0, 0x390e: 0x00c0, 0x390f: 0x00c0, 0x3910: 0x00c0, 0x3911: 0x00c0, + 0x3912: 0x00c0, 0x3913: 0x00c0, 0x3914: 0x00c0, 0x3915: 0x00c0, 0x3916: 0x00c0, 0x3917: 0x00c0, + 0x3918: 0x00c0, 0x3919: 0x00c0, 0x391a: 0x00c0, 0x391b: 0x00c0, 0x391c: 0x00c0, 0x391d: 0x00c0, + 0x391e: 0x00c0, 0x391f: 0x00c0, 0x3920: 0x00c0, 0x3921: 0x00c0, 0x3922: 0x00c0, 0x3923: 0x00c0, + 0x3924: 0x00c0, 0x3925: 0x00c0, 0x3926: 0x00c0, 0x3927: 0x00c0, 0x3928: 0x00c0, 0x3929: 0x00c0, + 0x392a: 0x00c0, 0x392b: 0x00c0, 0x392c: 0x00c0, 0x392d: 0x00c0, 0x392e: 0x00c0, 0x392f: 0x00c0, + 0x3930: 0x00c0, 0x3931: 0x00c0, 0x3932: 0x00c0, 0x3933: 0x00c3, 0x3934: 0x00c3, 0x3935: 0x00c3, + 0x3936: 0x00c3, 0x3937: 0x00c0, 0x3938: 0x00c0, 0x3939: 0x00c6, 0x393a: 0x00c3, 0x393b: 0x0080, + 0x393c: 0x0080, 0x393d: 0x0040, 0x393e: 0x0080, 0x393f: 0x0080, + // Block 0xe5, offset 0x3940 + 0x3940: 0x0080, 0x3941: 0x0080, + 0x3950: 0x00c0, 0x3951: 0x00c0, + 0x3952: 0x00c0, 0x3953: 0x00c0, 0x3954: 0x00c0, 0x3955: 0x00c0, 0x3956: 0x00c0, 0x3957: 0x00c0, + 0x3958: 0x00c0, 0x3959: 0x00c0, 0x395a: 0x00c0, 0x395b: 0x00c0, 0x395c: 0x00c0, 0x395d: 0x00c0, + 0x395e: 0x00c0, 0x395f: 0x00c0, 0x3960: 0x00c0, 0x3961: 0x00c0, 0x3962: 0x00c0, 0x3963: 0x00c0, + 0x3964: 0x00c0, 0x3965: 0x00c0, 0x3966: 0x00c0, 0x3967: 0x00c0, 0x3968: 0x00c0, + 0x3970: 0x00c0, 0x3971: 0x00c0, 0x3972: 0x00c0, 0x3973: 0x00c0, 0x3974: 0x00c0, 0x3975: 0x00c0, + 0x3976: 0x00c0, 0x3977: 0x00c0, 0x3978: 0x00c0, 0x3979: 0x00c0, + // Block 0xe6, offset 0x3980 + 0x3980: 0x00c3, 0x3981: 0x00c3, 0x3982: 0x00c3, 0x3983: 0x00c0, 0x3984: 0x00c0, 0x3985: 0x00c0, + 0x3986: 0x00c0, 0x3987: 0x00c0, 0x3988: 0x00c0, 0x3989: 0x00c0, 0x398a: 0x00c0, 0x398b: 0x00c0, + 0x398c: 0x00c0, 0x398d: 0x00c0, 0x398e: 0x00c0, 0x398f: 0x00c0, 0x3990: 0x00c0, 0x3991: 0x00c0, + 0x3992: 0x00c0, 0x3993: 0x00c0, 0x3994: 0x00c0, 0x3995: 0x00c0, 0x3996: 0x00c0, 0x3997: 0x00c0, + 0x3998: 0x00c0, 0x3999: 0x00c0, 0x399a: 0x00c0, 0x399b: 0x00c0, 0x399c: 0x00c0, 0x399d: 0x00c0, + 0x399e: 0x00c0, 0x399f: 0x00c0, 0x39a0: 0x00c0, 0x39a1: 0x00c0, 0x39a2: 0x00c0, 0x39a3: 0x00c0, + 0x39a4: 0x00c0, 0x39a5: 0x00c0, 0x39a6: 0x00c0, 0x39a7: 0x00c3, 0x39a8: 0x00c3, 0x39a9: 0x00c3, + 0x39aa: 0x00c3, 0x39ab: 0x00c3, 0x39ac: 0x00c0, 0x39ad: 0x00c3, 0x39ae: 0x00c3, 0x39af: 0x00c3, + 0x39b0: 0x00c3, 0x39b1: 0x00c3, 0x39b2: 0x00c3, 0x39b3: 0x00c6, 0x39b4: 0x00c6, + 0x39b6: 0x00c0, 0x39b7: 0x00c0, 0x39b8: 0x00c0, 0x39b9: 0x00c0, 0x39ba: 0x00c0, 0x39bb: 0x00c0, + 0x39bc: 0x00c0, 0x39bd: 0x00c0, 0x39be: 0x00c0, 0x39bf: 0x00c0, + // Block 0xe7, offset 0x39c0 + 0x39c0: 0x0080, 0x39c1: 0x0080, 0x39c2: 0x0080, 0x39c3: 0x0080, + 0x39d0: 0x00c0, 0x39d1: 0x00c0, + 0x39d2: 0x00c0, 0x39d3: 0x00c0, 0x39d4: 0x00c0, 0x39d5: 0x00c0, 0x39d6: 0x00c0, 0x39d7: 0x00c0, + 0x39d8: 0x00c0, 0x39d9: 0x00c0, 0x39da: 0x00c0, 0x39db: 0x00c0, 0x39dc: 0x00c0, 0x39dd: 0x00c0, + 0x39de: 0x00c0, 0x39df: 0x00c0, 0x39e0: 0x00c0, 0x39e1: 0x00c0, 0x39e2: 0x00c0, 0x39e3: 0x00c0, + 0x39e4: 0x00c0, 0x39e5: 0x00c0, 0x39e6: 0x00c0, 0x39e7: 0x00c0, 0x39e8: 0x00c0, 0x39e9: 0x00c0, + 0x39ea: 0x00c0, 0x39eb: 0x00c0, 0x39ec: 0x00c0, 0x39ed: 0x00c0, 0x39ee: 0x00c0, 0x39ef: 0x00c0, + 0x39f0: 0x00c0, 0x39f1: 0x00c0, 0x39f2: 0x00c0, 0x39f3: 0x00c3, 0x39f4: 0x0080, 0x39f5: 0x0080, + 0x39f6: 0x00c0, + // Block 0xe8, offset 0x3a00 + 0x3a00: 0x00c3, 0x3a01: 0x00c3, 0x3a02: 0x00c0, 0x3a03: 0x00c0, 0x3a04: 0x00c0, 0x3a05: 0x00c0, + 0x3a06: 0x00c0, 0x3a07: 0x00c0, 0x3a08: 0x00c0, 0x3a09: 0x00c0, 0x3a0a: 0x00c0, 0x3a0b: 0x00c0, + 0x3a0c: 0x00c0, 0x3a0d: 0x00c0, 0x3a0e: 0x00c0, 0x3a0f: 0x00c0, 0x3a10: 0x00c0, 0x3a11: 0x00c0, + 0x3a12: 0x00c0, 0x3a13: 0x00c0, 0x3a14: 0x00c0, 0x3a15: 0x00c0, 0x3a16: 0x00c0, 0x3a17: 0x00c0, + 0x3a18: 0x00c0, 0x3a19: 0x00c0, 0x3a1a: 0x00c0, 0x3a1b: 0x00c0, 0x3a1c: 0x00c0, 0x3a1d: 0x00c0, + 0x3a1e: 0x00c0, 0x3a1f: 0x00c0, 0x3a20: 0x00c0, 0x3a21: 0x00c0, 0x3a22: 0x00c0, 0x3a23: 0x00c0, + 0x3a24: 0x00c0, 0x3a25: 0x00c0, 0x3a26: 0x00c0, 0x3a27: 0x00c0, 0x3a28: 0x00c0, 0x3a29: 0x00c0, + 0x3a2a: 0x00c0, 0x3a2b: 0x00c0, 0x3a2c: 0x00c0, 0x3a2d: 0x00c0, 0x3a2e: 0x00c0, 0x3a2f: 0x00c0, + 0x3a30: 0x00c0, 0x3a31: 0x00c0, 0x3a32: 0x00c0, 0x3a33: 0x00c0, 0x3a34: 0x00c0, 0x3a35: 0x00c0, + 0x3a36: 0x00c3, 0x3a37: 0x00c3, 0x3a38: 0x00c3, 0x3a39: 0x00c3, 0x3a3a: 0x00c3, 0x3a3b: 0x00c3, + 0x3a3c: 0x00c3, 0x3a3d: 0x00c3, 0x3a3e: 0x00c3, 0x3a3f: 0x00c0, + // Block 0xe9, offset 0x3a40 + 0x3a40: 0x00c5, 0x3a41: 0x00c0, 0x3a42: 0x00c0, 0x3a43: 0x00c0, 0x3a44: 0x00c0, 0x3a45: 0x0080, + 0x3a46: 0x0080, 0x3a47: 0x0080, 0x3a48: 0x0080, 0x3a49: 0x0080, 0x3a4a: 0x00c3, 0x3a4b: 0x00c3, + 0x3a4c: 0x00c3, 0x3a4d: 0x0080, 0x3a50: 0x00c0, 0x3a51: 0x00c0, + 0x3a52: 0x00c0, 0x3a53: 0x00c0, 0x3a54: 0x00c0, 0x3a55: 0x00c0, 0x3a56: 0x00c0, 0x3a57: 0x00c0, + 0x3a58: 0x00c0, 0x3a59: 0x00c0, 0x3a5a: 0x00c0, 0x3a5b: 0x0080, 0x3a5c: 0x00c0, 0x3a5d: 0x0080, + 0x3a5e: 0x0080, 0x3a5f: 0x0080, 0x3a61: 0x0080, 0x3a62: 0x0080, 0x3a63: 0x0080, + 0x3a64: 0x0080, 0x3a65: 0x0080, 0x3a66: 0x0080, 0x3a67: 0x0080, 0x3a68: 0x0080, 0x3a69: 0x0080, + 0x3a6a: 0x0080, 0x3a6b: 0x0080, 0x3a6c: 0x0080, 0x3a6d: 0x0080, 0x3a6e: 0x0080, 0x3a6f: 0x0080, + 0x3a70: 0x0080, 0x3a71: 0x0080, 0x3a72: 0x0080, 0x3a73: 0x0080, 0x3a74: 0x0080, + // Block 0xea, offset 0x3a80 + 0x3a80: 0x00c0, 0x3a81: 0x00c0, 0x3a82: 0x00c0, 0x3a83: 0x00c0, 0x3a84: 0x00c0, 0x3a85: 0x00c0, + 0x3a86: 0x00c0, 0x3a87: 0x00c0, 0x3a88: 0x00c0, 0x3a89: 0x00c0, 0x3a8a: 0x00c0, 0x3a8b: 0x00c0, + 0x3a8c: 0x00c0, 0x3a8d: 0x00c0, 0x3a8e: 0x00c0, 0x3a8f: 0x00c0, 0x3a90: 0x00c0, 0x3a91: 0x00c0, + 0x3a93: 0x00c0, 0x3a94: 0x00c0, 0x3a95: 0x00c0, 0x3a96: 0x00c0, 0x3a97: 0x00c0, + 0x3a98: 0x00c0, 0x3a99: 0x00c0, 0x3a9a: 0x00c0, 0x3a9b: 0x00c0, 0x3a9c: 0x00c0, 0x3a9d: 0x00c0, + 0x3a9e: 0x00c0, 0x3a9f: 0x00c0, 0x3aa0: 0x00c0, 0x3aa1: 0x00c0, 0x3aa2: 0x00c0, 0x3aa3: 0x00c0, + 0x3aa4: 0x00c0, 0x3aa5: 0x00c0, 0x3aa6: 0x00c0, 0x3aa7: 0x00c0, 0x3aa8: 0x00c0, 0x3aa9: 0x00c0, + 0x3aaa: 0x00c0, 0x3aab: 0x00c0, 0x3aac: 0x00c0, 0x3aad: 0x00c0, 0x3aae: 0x00c0, 0x3aaf: 0x00c3, + 0x3ab0: 0x00c3, 0x3ab1: 0x00c3, 0x3ab2: 0x00c0, 0x3ab3: 0x00c0, 0x3ab4: 0x00c3, 0x3ab5: 0x00c5, + 0x3ab6: 0x00c3, 0x3ab7: 0x00c3, 0x3ab8: 0x0080, 0x3ab9: 0x0080, 0x3aba: 0x0080, 0x3abb: 0x0080, + 0x3abc: 0x0080, 0x3abd: 0x0080, 0x3abe: 0x00c3, + // Block 0xeb, offset 0x3ac0 + 0x3ac0: 0x00c0, 0x3ac1: 0x00c0, 0x3ac2: 0x00c0, 0x3ac3: 0x00c0, 0x3ac4: 0x00c0, 0x3ac5: 0x00c0, + 0x3ac6: 0x00c0, 0x3ac8: 0x00c0, 0x3aca: 0x00c0, 0x3acb: 0x00c0, + 0x3acc: 0x00c0, 0x3acd: 0x00c0, 0x3acf: 0x00c0, 0x3ad0: 0x00c0, 0x3ad1: 0x00c0, + 0x3ad2: 0x00c0, 0x3ad3: 0x00c0, 0x3ad4: 0x00c0, 0x3ad5: 0x00c0, 0x3ad6: 0x00c0, 0x3ad7: 0x00c0, + 0x3ad8: 0x00c0, 0x3ad9: 0x00c0, 0x3ada: 0x00c0, 0x3adb: 0x00c0, 0x3adc: 0x00c0, 0x3add: 0x00c0, + 0x3adf: 0x00c0, 0x3ae0: 0x00c0, 0x3ae1: 0x00c0, 0x3ae2: 0x00c0, 0x3ae3: 0x00c0, + 0x3ae4: 0x00c0, 0x3ae5: 0x00c0, 0x3ae6: 0x00c0, 0x3ae7: 0x00c0, 0x3ae8: 0x00c0, 0x3ae9: 0x0080, + 0x3af0: 0x00c0, 0x3af1: 0x00c0, 0x3af2: 0x00c0, 0x3af3: 0x00c0, 0x3af4: 0x00c0, 0x3af5: 0x00c0, + 0x3af6: 0x00c0, 0x3af7: 0x00c0, 0x3af8: 0x00c0, 0x3af9: 0x00c0, 0x3afa: 0x00c0, 0x3afb: 0x00c0, + 0x3afc: 0x00c0, 0x3afd: 0x00c0, 0x3afe: 0x00c0, 0x3aff: 0x00c0, + // Block 0xec, offset 0x3b00 + 0x3b00: 0x00c0, 0x3b01: 0x00c0, 0x3b02: 0x00c0, 0x3b03: 0x00c0, 0x3b04: 0x00c0, 0x3b05: 0x00c0, + 0x3b06: 0x00c0, 0x3b07: 0x00c0, 0x3b08: 0x00c0, 0x3b09: 0x00c0, 0x3b0a: 0x00c0, 0x3b0b: 0x00c0, + 0x3b0c: 0x00c0, 0x3b0d: 0x00c0, 0x3b0e: 0x00c0, 0x3b0f: 0x00c0, 0x3b10: 0x00c0, 0x3b11: 0x00c0, + 0x3b12: 0x00c0, 0x3b13: 0x00c0, 0x3b14: 0x00c0, 0x3b15: 0x00c0, 0x3b16: 0x00c0, 0x3b17: 0x00c0, + 0x3b18: 0x00c0, 0x3b19: 0x00c0, 0x3b1a: 0x00c0, 0x3b1b: 0x00c0, 0x3b1c: 0x00c0, 0x3b1d: 0x00c0, + 0x3b1e: 0x00c0, 0x3b1f: 0x00c3, 0x3b20: 0x00c0, 0x3b21: 0x00c0, 0x3b22: 0x00c0, 0x3b23: 0x00c3, + 0x3b24: 0x00c3, 0x3b25: 0x00c3, 0x3b26: 0x00c3, 0x3b27: 0x00c3, 0x3b28: 0x00c3, 0x3b29: 0x00c3, + 0x3b2a: 0x00c6, + 0x3b30: 0x00c0, 0x3b31: 0x00c0, 0x3b32: 0x00c0, 0x3b33: 0x00c0, 0x3b34: 0x00c0, 0x3b35: 0x00c0, + 0x3b36: 0x00c0, 0x3b37: 0x00c0, 0x3b38: 0x00c0, 0x3b39: 0x00c0, + // Block 0xed, offset 0x3b40 + 0x3b40: 0x00c3, 0x3b41: 0x00c3, 0x3b42: 0x00c0, 0x3b43: 0x00c0, 0x3b45: 0x00c0, + 0x3b46: 0x00c0, 0x3b47: 0x00c0, 0x3b48: 0x00c0, 0x3b49: 0x00c0, 0x3b4a: 0x00c0, 0x3b4b: 0x00c0, + 0x3b4c: 0x00c0, 0x3b4f: 0x00c0, 0x3b50: 0x00c0, + 0x3b53: 0x00c0, 0x3b54: 0x00c0, 0x3b55: 0x00c0, 0x3b56: 0x00c0, 0x3b57: 0x00c0, + 0x3b58: 0x00c0, 0x3b59: 0x00c0, 0x3b5a: 0x00c0, 0x3b5b: 0x00c0, 0x3b5c: 0x00c0, 0x3b5d: 0x00c0, + 0x3b5e: 0x00c0, 0x3b5f: 0x00c0, 0x3b60: 0x00c0, 0x3b61: 0x00c0, 0x3b62: 0x00c0, 0x3b63: 0x00c0, + 0x3b64: 0x00c0, 0x3b65: 0x00c0, 0x3b66: 0x00c0, 0x3b67: 0x00c0, 0x3b68: 0x00c0, + 0x3b6a: 0x00c0, 0x3b6b: 0x00c0, 0x3b6c: 0x00c0, 0x3b6d: 0x00c0, 0x3b6e: 0x00c0, 0x3b6f: 0x00c0, + 0x3b70: 0x00c0, 0x3b72: 0x00c0, 0x3b73: 0x00c0, 0x3b75: 0x00c0, + 0x3b76: 0x00c0, 0x3b77: 0x00c0, 0x3b78: 0x00c0, 0x3b79: 0x00c0, + 0x3b7c: 0x00c3, 0x3b7d: 0x00c0, 0x3b7e: 0x00c0, 0x3b7f: 0x00c0, + // Block 0xee, offset 0x3b80 + 0x3b80: 0x00c3, 0x3b81: 0x00c0, 0x3b82: 0x00c0, 0x3b83: 0x00c0, 0x3b84: 0x00c0, + 0x3b87: 0x00c0, 0x3b88: 0x00c0, 0x3b8b: 0x00c0, + 0x3b8c: 0x00c0, 0x3b8d: 0x00c5, 0x3b90: 0x00c0, + 0x3b97: 0x00c0, + 0x3b9d: 0x00c0, + 0x3b9e: 0x00c0, 0x3b9f: 0x00c0, 0x3ba0: 0x00c0, 0x3ba1: 0x00c0, 0x3ba2: 0x00c0, 0x3ba3: 0x00c0, + 0x3ba6: 0x00c3, 0x3ba7: 0x00c3, 0x3ba8: 0x00c3, 0x3ba9: 0x00c3, + 0x3baa: 0x00c3, 0x3bab: 0x00c3, 0x3bac: 0x00c3, + 0x3bb0: 0x00c3, 0x3bb1: 0x00c3, 0x3bb2: 0x00c3, 0x3bb3: 0x00c3, 0x3bb4: 0x00c3, + // Block 0xef, offset 0x3bc0 + 0x3bc0: 0x00c0, 0x3bc1: 0x00c0, 0x3bc2: 0x00c0, 0x3bc3: 0x00c0, 0x3bc4: 0x00c0, 0x3bc5: 0x00c0, + 0x3bc6: 0x00c0, 0x3bc7: 0x00c0, 0x3bc8: 0x00c0, 0x3bc9: 0x00c0, 0x3bca: 0x00c0, 0x3bcb: 0x00c0, + 0x3bcc: 0x00c0, 0x3bcd: 0x00c0, 0x3bce: 0x00c0, 0x3bcf: 0x00c0, 0x3bd0: 0x00c0, 0x3bd1: 0x00c0, + 0x3bd2: 0x00c0, 0x3bd3: 0x00c0, 0x3bd4: 0x00c0, 0x3bd5: 0x00c0, 0x3bd6: 0x00c0, 0x3bd7: 0x00c0, + 0x3bd8: 0x00c0, 0x3bd9: 0x00c0, 0x3bda: 0x00c0, 0x3bdb: 0x00c0, 0x3bdc: 0x00c0, 0x3bdd: 0x00c0, + 0x3bde: 0x00c0, 0x3bdf: 0x00c0, 0x3be0: 0x00c0, 0x3be1: 0x00c0, 0x3be2: 0x00c0, 0x3be3: 0x00c0, + 0x3be4: 0x00c0, 0x3be5: 0x00c0, 0x3be6: 0x00c0, 0x3be7: 0x00c0, 0x3be8: 0x00c0, 0x3be9: 0x00c0, + 0x3bea: 0x00c0, 0x3beb: 0x00c0, 0x3bec: 0x00c0, 0x3bed: 0x00c0, 0x3bee: 0x00c0, 0x3bef: 0x00c0, + 0x3bf0: 0x00c0, 0x3bf1: 0x00c0, 0x3bf2: 0x00c0, 0x3bf3: 0x00c0, 0x3bf4: 0x00c0, 0x3bf5: 0x00c0, + 0x3bf6: 0x00c0, 0x3bf7: 0x00c0, 0x3bf8: 0x00c3, 0x3bf9: 0x00c3, 0x3bfa: 0x00c3, 0x3bfb: 0x00c3, + 0x3bfc: 0x00c3, 0x3bfd: 0x00c3, 0x3bfe: 0x00c3, 0x3bff: 0x00c3, + // Block 0xf0, offset 0x3c00 + 0x3c00: 0x00c0, 0x3c01: 0x00c0, 0x3c02: 0x00c6, 0x3c03: 0x00c3, 0x3c04: 0x00c3, 0x3c05: 0x00c0, + 0x3c06: 0x00c3, 0x3c07: 0x00c0, 0x3c08: 0x00c0, 0x3c09: 0x00c0, 0x3c0a: 0x00c0, 0x3c0b: 0x0080, + 0x3c0c: 0x0080, 0x3c0d: 0x0080, 0x3c0e: 0x0080, 0x3c0f: 0x0080, 0x3c10: 0x00c0, 0x3c11: 0x00c0, + 0x3c12: 0x00c0, 0x3c13: 0x00c0, 0x3c14: 0x00c0, 0x3c15: 0x00c0, 0x3c16: 0x00c0, 0x3c17: 0x00c0, + 0x3c18: 0x00c0, 0x3c19: 0x00c0, 0x3c1b: 0x0080, 0x3c1d: 0x0080, + // Block 0xf1, offset 0x3c40 + 0x3c40: 0x00c0, 0x3c41: 0x00c0, 0x3c42: 0x00c0, 0x3c43: 0x00c0, 0x3c44: 0x00c0, 0x3c45: 0x00c0, + 0x3c46: 0x00c0, 0x3c47: 0x00c0, 0x3c48: 0x00c0, 0x3c49: 0x00c0, 0x3c4a: 0x00c0, 0x3c4b: 0x00c0, + 0x3c4c: 0x00c0, 0x3c4d: 0x00c0, 0x3c4e: 0x00c0, 0x3c4f: 0x00c0, 0x3c50: 0x00c0, 0x3c51: 0x00c0, + 0x3c52: 0x00c0, 0x3c53: 0x00c0, 0x3c54: 0x00c0, 0x3c55: 0x00c0, 0x3c56: 0x00c0, 0x3c57: 0x00c0, + 0x3c58: 0x00c0, 0x3c59: 0x00c0, 0x3c5a: 0x00c0, 0x3c5b: 0x00c0, 0x3c5c: 0x00c0, 0x3c5d: 0x00c0, + 0x3c5e: 0x00c0, 0x3c5f: 0x00c0, 0x3c60: 0x00c0, 0x3c61: 0x00c0, 0x3c62: 0x00c0, 0x3c63: 0x00c0, + 0x3c64: 0x00c0, 0x3c65: 0x00c0, 0x3c66: 0x00c0, 0x3c67: 0x00c0, 0x3c68: 0x00c0, 0x3c69: 0x00c0, + 0x3c6a: 0x00c0, 0x3c6b: 0x00c0, 0x3c6c: 0x00c0, 0x3c6d: 0x00c0, 0x3c6e: 0x00c0, 0x3c6f: 0x00c0, + 0x3c70: 0x00c0, 0x3c71: 0x00c0, 0x3c72: 0x00c0, 0x3c73: 0x00c3, 0x3c74: 0x00c3, 0x3c75: 0x00c3, + 0x3c76: 0x00c3, 0x3c77: 0x00c3, 0x3c78: 0x00c3, 0x3c79: 0x00c0, 0x3c7a: 0x00c3, 0x3c7b: 0x00c0, + 0x3c7c: 0x00c0, 0x3c7d: 0x00c0, 0x3c7e: 0x00c0, 0x3c7f: 0x00c3, + // Block 0xf2, offset 0x3c80 + 0x3c80: 0x00c3, 0x3c81: 0x00c0, 0x3c82: 0x00c6, 0x3c83: 0x00c3, 0x3c84: 0x00c0, 0x3c85: 0x00c0, + 0x3c86: 0x0080, 0x3c87: 0x00c0, + 0x3c90: 0x00c0, 0x3c91: 0x00c0, + 0x3c92: 0x00c0, 0x3c93: 0x00c0, 0x3c94: 0x00c0, 0x3c95: 0x00c0, 0x3c96: 0x00c0, 0x3c97: 0x00c0, + 0x3c98: 0x00c0, 0x3c99: 0x00c0, + // Block 0xf3, offset 0x3cc0 + 0x3cc0: 0x00c0, 0x3cc1: 0x00c0, 0x3cc2: 0x00c0, 0x3cc3: 0x00c0, 0x3cc4: 0x00c0, 0x3cc5: 0x00c0, + 0x3cc6: 0x00c0, 0x3cc7: 0x00c0, 0x3cc8: 0x00c0, 0x3cc9: 0x00c0, 0x3cca: 0x00c0, 0x3ccb: 0x00c0, + 0x3ccc: 0x00c0, 0x3ccd: 0x00c0, 0x3cce: 0x00c0, 0x3ccf: 0x00c0, 0x3cd0: 0x00c0, 0x3cd1: 0x00c0, + 0x3cd2: 0x00c0, 0x3cd3: 0x00c0, 0x3cd4: 0x00c0, 0x3cd5: 0x00c0, 0x3cd6: 0x00c0, 0x3cd7: 0x00c0, + 0x3cd8: 0x00c0, 0x3cd9: 0x00c0, 0x3cda: 0x00c0, 0x3cdb: 0x00c0, 0x3cdc: 0x00c0, 0x3cdd: 0x00c0, + 0x3cde: 0x00c0, 0x3cdf: 0x00c0, 0x3ce0: 0x00c0, 0x3ce1: 0x00c0, 0x3ce2: 0x00c0, 0x3ce3: 0x00c0, + 0x3ce4: 0x00c0, 0x3ce5: 0x00c0, 0x3ce6: 0x00c0, 0x3ce7: 0x00c0, 0x3ce8: 0x00c0, 0x3ce9: 0x00c0, + 0x3cea: 0x00c0, 0x3ceb: 0x00c0, 0x3cec: 0x00c0, 0x3ced: 0x00c0, 0x3cee: 0x00c0, 0x3cef: 0x00c0, + 0x3cf0: 0x00c0, 0x3cf1: 0x00c0, 0x3cf2: 0x00c3, 0x3cf3: 0x00c3, 0x3cf4: 0x00c3, 0x3cf5: 0x00c3, + 0x3cf8: 0x00c0, 0x3cf9: 0x00c0, 0x3cfa: 0x00c0, 0x3cfb: 0x00c0, + 0x3cfc: 0x00c3, 0x3cfd: 0x00c3, 0x3cfe: 0x00c0, 0x3cff: 0x00c6, + // Block 0xf4, offset 0x3d00 + 0x3d00: 0x00c3, 0x3d01: 0x0080, 0x3d02: 0x0080, 0x3d03: 0x0080, 0x3d04: 0x0080, 0x3d05: 0x0080, + 0x3d06: 0x0080, 0x3d07: 0x0080, 0x3d08: 0x0080, 0x3d09: 0x0080, 0x3d0a: 0x0080, 0x3d0b: 0x0080, + 0x3d0c: 0x0080, 0x3d0d: 0x0080, 0x3d0e: 0x0080, 0x3d0f: 0x0080, 0x3d10: 0x0080, 0x3d11: 0x0080, + 0x3d12: 0x0080, 0x3d13: 0x0080, 0x3d14: 0x0080, 0x3d15: 0x0080, 0x3d16: 0x0080, 0x3d17: 0x0080, + 0x3d18: 0x00c0, 0x3d19: 0x00c0, 0x3d1a: 0x00c0, 0x3d1b: 0x00c0, 0x3d1c: 0x00c3, 0x3d1d: 0x00c3, + // Block 0xf5, offset 0x3d40 + 0x3d40: 0x00c0, 0x3d41: 0x00c0, 0x3d42: 0x00c0, 0x3d43: 0x00c0, 0x3d44: 0x00c0, 0x3d45: 0x00c0, + 0x3d46: 0x00c0, 0x3d47: 0x00c0, 0x3d48: 0x00c0, 0x3d49: 0x00c0, 0x3d4a: 0x00c0, 0x3d4b: 0x00c0, + 0x3d4c: 0x00c0, 0x3d4d: 0x00c0, 0x3d4e: 0x00c0, 0x3d4f: 0x00c0, 0x3d50: 0x00c0, 0x3d51: 0x00c0, + 0x3d52: 0x00c0, 0x3d53: 0x00c0, 0x3d54: 0x00c0, 0x3d55: 0x00c0, 0x3d56: 0x00c0, 0x3d57: 0x00c0, + 0x3d58: 0x00c0, 0x3d59: 0x00c0, 0x3d5a: 0x00c0, 0x3d5b: 0x00c0, 0x3d5c: 0x00c0, 0x3d5d: 0x00c0, + 0x3d5e: 0x00c0, 0x3d5f: 0x00c0, 0x3d60: 0x00c0, 0x3d61: 0x00c0, 0x3d62: 0x00c0, 0x3d63: 0x00c0, + 0x3d64: 0x00c0, 0x3d65: 0x00c0, 0x3d66: 0x00c0, 0x3d67: 0x00c0, 0x3d68: 0x00c0, 0x3d69: 0x00c0, + 0x3d6a: 0x00c0, 0x3d6b: 0x00c0, 0x3d6c: 0x00c0, 0x3d6d: 0x00c0, 0x3d6e: 0x00c0, 0x3d6f: 0x00c0, + 0x3d70: 0x00c0, 0x3d71: 0x00c0, 0x3d72: 0x00c0, 0x3d73: 0x00c3, 0x3d74: 0x00c3, 0x3d75: 0x00c3, + 0x3d76: 0x00c3, 0x3d77: 0x00c3, 0x3d78: 0x00c3, 0x3d79: 0x00c3, 0x3d7a: 0x00c3, 0x3d7b: 0x00c0, + 0x3d7c: 0x00c0, 0x3d7d: 0x00c3, 0x3d7e: 0x00c0, 0x3d7f: 0x00c6, + // Block 0xf6, offset 0x3d80 + 0x3d80: 0x00c3, 0x3d81: 0x0080, 0x3d82: 0x0080, 0x3d83: 0x0080, 0x3d84: 0x00c0, + 0x3d90: 0x00c0, 0x3d91: 0x00c0, + 0x3d92: 0x00c0, 0x3d93: 0x00c0, 0x3d94: 0x00c0, 0x3d95: 0x00c0, 0x3d96: 0x00c0, 0x3d97: 0x00c0, + 0x3d98: 0x00c0, 0x3d99: 0x00c0, + 0x3da0: 0x0080, 0x3da1: 0x0080, 0x3da2: 0x0080, 0x3da3: 0x0080, + 0x3da4: 0x0080, 0x3da5: 0x0080, 0x3da6: 0x0080, 0x3da7: 0x0080, 0x3da8: 0x0080, 0x3da9: 0x0080, + 0x3daa: 0x0080, 0x3dab: 0x0080, 0x3dac: 0x0080, + // Block 0xf7, offset 0x3dc0 + 0x3dc0: 0x00c0, 0x3dc1: 0x00c0, 0x3dc2: 0x00c0, 0x3dc3: 0x00c0, 0x3dc4: 0x00c0, 0x3dc5: 0x00c0, + 0x3dc6: 0x00c0, 0x3dc7: 0x00c0, 0x3dc8: 0x00c0, 0x3dc9: 0x00c0, 0x3dca: 0x00c0, 0x3dcb: 0x00c0, + 0x3dcc: 0x00c0, 0x3dcd: 0x00c0, 0x3dce: 0x00c0, 0x3dcf: 0x00c0, 0x3dd0: 0x00c0, 0x3dd1: 0x00c0, + 0x3dd2: 0x00c0, 0x3dd3: 0x00c0, 0x3dd4: 0x00c0, 0x3dd5: 0x00c0, 0x3dd6: 0x00c0, 0x3dd7: 0x00c0, + 0x3dd8: 0x00c0, 0x3dd9: 0x00c0, 0x3dda: 0x00c0, 0x3ddb: 0x00c0, 0x3ddc: 0x00c0, 0x3ddd: 0x00c0, + 0x3dde: 0x00c0, 0x3ddf: 0x00c0, 0x3de0: 0x00c0, 0x3de1: 0x00c0, 0x3de2: 0x00c0, 0x3de3: 0x00c0, + 0x3de4: 0x00c0, 0x3de5: 0x00c0, 0x3de6: 0x00c0, 0x3de7: 0x00c0, 0x3de8: 0x00c0, 0x3de9: 0x00c0, + 0x3dea: 0x00c0, 0x3deb: 0x00c3, 0x3dec: 0x00c0, 0x3ded: 0x00c3, 0x3dee: 0x00c0, 0x3def: 0x00c0, + 0x3df0: 0x00c3, 0x3df1: 0x00c3, 0x3df2: 0x00c3, 0x3df3: 0x00c3, 0x3df4: 0x00c3, 0x3df5: 0x00c3, + 0x3df6: 0x00c5, 0x3df7: 0x00c3, + // Block 0xf8, offset 0x3e00 + 0x3e00: 0x00c0, 0x3e01: 0x00c0, 0x3e02: 0x00c0, 0x3e03: 0x00c0, 0x3e04: 0x00c0, 0x3e05: 0x00c0, + 0x3e06: 0x00c0, 0x3e07: 0x00c0, 0x3e08: 0x00c0, 0x3e09: 0x00c0, + // Block 0xf9, offset 0x3e40 + 0x3e40: 0x00c0, 0x3e41: 0x00c0, 0x3e42: 0x00c0, 0x3e43: 0x00c0, 0x3e44: 0x00c0, 0x3e45: 0x00c0, + 0x3e46: 0x00c0, 0x3e47: 0x00c0, 0x3e48: 0x00c0, 0x3e49: 0x00c0, 0x3e4a: 0x00c0, 0x3e4b: 0x00c0, + 0x3e4c: 0x00c0, 0x3e4d: 0x00c0, 0x3e4e: 0x00c0, 0x3e4f: 0x00c0, 0x3e50: 0x00c0, 0x3e51: 0x00c0, + 0x3e52: 0x00c0, 0x3e53: 0x00c0, 0x3e54: 0x00c0, 0x3e55: 0x00c0, 0x3e56: 0x00c0, 0x3e57: 0x00c0, + 0x3e58: 0x00c0, 0x3e59: 0x00c0, 0x3e5d: 0x00c3, + 0x3e5e: 0x00c3, 0x3e5f: 0x00c3, 0x3e60: 0x00c0, 0x3e61: 0x00c0, 0x3e62: 0x00c3, 0x3e63: 0x00c3, + 0x3e64: 0x00c3, 0x3e65: 0x00c3, 0x3e66: 0x00c0, 0x3e67: 0x00c3, 0x3e68: 0x00c3, 0x3e69: 0x00c3, + 0x3e6a: 0x00c3, 0x3e6b: 0x00c6, + 0x3e70: 0x00c0, 0x3e71: 0x00c0, 0x3e72: 0x00c0, 0x3e73: 0x00c0, 0x3e74: 0x00c0, 0x3e75: 0x00c0, + 0x3e76: 0x00c0, 0x3e77: 0x00c0, 0x3e78: 0x00c0, 0x3e79: 0x00c0, 0x3e7a: 0x0080, 0x3e7b: 0x0080, + 0x3e7c: 0x0080, 0x3e7d: 0x0080, 0x3e7e: 0x0080, 0x3e7f: 0x0080, + // Block 0xfa, offset 0x3e80 + 0x3ea0: 0x00c0, 0x3ea1: 0x00c0, 0x3ea2: 0x00c0, 0x3ea3: 0x00c0, + 0x3ea4: 0x00c0, 0x3ea5: 0x00c0, 0x3ea6: 0x00c0, 0x3ea7: 0x00c0, 0x3ea8: 0x00c0, 0x3ea9: 0x00c0, + 0x3eaa: 0x00c0, 0x3eab: 0x00c0, 0x3eac: 0x00c0, 0x3ead: 0x00c0, 0x3eae: 0x00c0, 0x3eaf: 0x00c0, + 0x3eb0: 0x00c0, 0x3eb1: 0x00c0, 0x3eb2: 0x00c0, 0x3eb3: 0x00c0, 0x3eb4: 0x00c0, 0x3eb5: 0x00c0, + 0x3eb6: 0x00c0, 0x3eb7: 0x00c0, 0x3eb8: 0x00c0, 0x3eb9: 0x00c0, 0x3eba: 0x00c0, 0x3ebb: 0x00c0, + 0x3ebc: 0x00c0, 0x3ebd: 0x00c0, 0x3ebe: 0x00c0, 0x3ebf: 0x00c0, + // Block 0xfb, offset 0x3ec0 + 0x3ec0: 0x00c0, 0x3ec1: 0x00c0, 0x3ec2: 0x00c0, 0x3ec3: 0x00c0, 0x3ec4: 0x00c0, 0x3ec5: 0x00c0, + 0x3ec6: 0x00c0, 0x3ec7: 0x00c0, 0x3ec8: 0x00c0, 0x3ec9: 0x00c0, 0x3eca: 0x00c0, 0x3ecb: 0x00c0, + 0x3ecc: 0x00c0, 0x3ecd: 0x00c0, 0x3ece: 0x00c0, 0x3ecf: 0x00c0, 0x3ed0: 0x00c0, 0x3ed1: 0x00c0, + 0x3ed2: 0x00c0, 0x3ed3: 0x00c0, 0x3ed4: 0x00c0, 0x3ed5: 0x00c0, 0x3ed6: 0x00c0, 0x3ed7: 0x00c0, + 0x3ed8: 0x00c0, 0x3ed9: 0x00c0, 0x3eda: 0x00c0, 0x3edb: 0x00c0, 0x3edc: 0x00c0, 0x3edd: 0x00c0, + 0x3ede: 0x00c0, 0x3edf: 0x00c0, 0x3ee0: 0x00c0, 0x3ee1: 0x00c0, 0x3ee2: 0x00c0, 0x3ee3: 0x00c0, + 0x3ee4: 0x00c0, 0x3ee5: 0x00c0, 0x3ee6: 0x00c0, 0x3ee7: 0x00c0, 0x3ee8: 0x00c0, 0x3ee9: 0x00c0, + 0x3eea: 0x0080, 0x3eeb: 0x0080, 0x3eec: 0x0080, 0x3eed: 0x0080, 0x3eee: 0x0080, 0x3eef: 0x0080, + 0x3ef0: 0x0080, 0x3ef1: 0x0080, 0x3ef2: 0x0080, + 0x3eff: 0x00c0, + // Block 0xfc, offset 0x3f00 + 0x3f00: 0x00c0, 0x3f01: 0x00c0, 0x3f02: 0x00c0, 0x3f03: 0x00c0, 0x3f04: 0x00c0, 0x3f05: 0x00c0, + 0x3f06: 0x00c0, 0x3f07: 0x00c0, 0x3f08: 0x00c0, 0x3f09: 0x00c0, 0x3f0a: 0x00c0, 0x3f0b: 0x00c0, + 0x3f0c: 0x00c0, 0x3f0d: 0x00c0, 0x3f0e: 0x00c0, 0x3f0f: 0x00c0, 0x3f10: 0x00c0, 0x3f11: 0x00c0, + 0x3f12: 0x00c0, 0x3f13: 0x00c0, 0x3f14: 0x00c0, 0x3f15: 0x00c0, 0x3f16: 0x00c0, 0x3f17: 0x00c0, + 0x3f18: 0x00c0, 0x3f19: 0x00c0, 0x3f1a: 0x00c0, 0x3f1b: 0x00c0, 0x3f1c: 0x00c0, 0x3f1d: 0x00c0, + 0x3f1e: 0x00c0, 0x3f1f: 0x00c0, 0x3f20: 0x00c0, 0x3f21: 0x00c0, 0x3f22: 0x00c0, 0x3f23: 0x00c0, + 0x3f24: 0x00c0, 0x3f25: 0x00c0, 0x3f26: 0x00c0, 0x3f27: 0x00c0, 0x3f28: 0x00c0, 0x3f29: 0x00c0, + 0x3f2a: 0x00c0, 0x3f2b: 0x00c0, 0x3f2c: 0x00c0, 0x3f2d: 0x00c0, 0x3f2e: 0x00c0, 0x3f2f: 0x00c0, + 0x3f30: 0x00c0, 0x3f31: 0x00c0, 0x3f32: 0x00c0, 0x3f33: 0x00c0, 0x3f34: 0x00c0, 0x3f35: 0x00c0, + 0x3f36: 0x00c0, 0x3f37: 0x00c0, 0x3f38: 0x00c0, + // Block 0xfd, offset 0x3f40 + 0x3f40: 0x00c0, 0x3f41: 0x00c0, 0x3f42: 0x00c0, 0x3f43: 0x00c0, 0x3f44: 0x00c0, 0x3f45: 0x00c0, + 0x3f46: 0x00c0, 0x3f47: 0x00c0, 0x3f48: 0x00c0, 0x3f4a: 0x00c0, 0x3f4b: 0x00c0, + 0x3f4c: 0x00c0, 0x3f4d: 0x00c0, 0x3f4e: 0x00c0, 0x3f4f: 0x00c0, 0x3f50: 0x00c0, 0x3f51: 0x00c0, + 0x3f52: 0x00c0, 0x3f53: 0x00c0, 0x3f54: 0x00c0, 0x3f55: 0x00c0, 0x3f56: 0x00c0, 0x3f57: 0x00c0, + 0x3f58: 0x00c0, 0x3f59: 0x00c0, 0x3f5a: 0x00c0, 0x3f5b: 0x00c0, 0x3f5c: 0x00c0, 0x3f5d: 0x00c0, + 0x3f5e: 0x00c0, 0x3f5f: 0x00c0, 0x3f60: 0x00c0, 0x3f61: 0x00c0, 0x3f62: 0x00c0, 0x3f63: 0x00c0, + 0x3f64: 0x00c0, 0x3f65: 0x00c0, 0x3f66: 0x00c0, 0x3f67: 0x00c0, 0x3f68: 0x00c0, 0x3f69: 0x00c0, + 0x3f6a: 0x00c0, 0x3f6b: 0x00c0, 0x3f6c: 0x00c0, 0x3f6d: 0x00c0, 0x3f6e: 0x00c0, 0x3f6f: 0x00c0, + 0x3f70: 0x00c3, 0x3f71: 0x00c3, 0x3f72: 0x00c3, 0x3f73: 0x00c3, 0x3f74: 0x00c3, 0x3f75: 0x00c3, + 0x3f76: 0x00c3, 0x3f78: 0x00c3, 0x3f79: 0x00c3, 0x3f7a: 0x00c3, 0x3f7b: 0x00c3, + 0x3f7c: 0x00c3, 0x3f7d: 0x00c3, 0x3f7e: 0x00c0, 0x3f7f: 0x00c6, + // Block 0xfe, offset 0x3f80 + 0x3f80: 0x00c0, 0x3f81: 0x0080, 0x3f82: 0x0080, 0x3f83: 0x0080, 0x3f84: 0x0080, 0x3f85: 0x0080, + 0x3f90: 0x00c0, 0x3f91: 0x00c0, + 0x3f92: 0x00c0, 0x3f93: 0x00c0, 0x3f94: 0x00c0, 0x3f95: 0x00c0, 0x3f96: 0x00c0, 0x3f97: 0x00c0, + 0x3f98: 0x00c0, 0x3f99: 0x00c0, 0x3f9a: 0x0080, 0x3f9b: 0x0080, 0x3f9c: 0x0080, 0x3f9d: 0x0080, + 0x3f9e: 0x0080, 0x3f9f: 0x0080, 0x3fa0: 0x0080, 0x3fa1: 0x0080, 0x3fa2: 0x0080, 0x3fa3: 0x0080, + 0x3fa4: 0x0080, 0x3fa5: 0x0080, 0x3fa6: 0x0080, 0x3fa7: 0x0080, 0x3fa8: 0x0080, 0x3fa9: 0x0080, + 0x3faa: 0x0080, 0x3fab: 0x0080, 0x3fac: 0x0080, + 0x3fb0: 0x0080, 0x3fb1: 0x0080, 0x3fb2: 0x00c0, 0x3fb3: 0x00c0, 0x3fb4: 0x00c0, 0x3fb5: 0x00c0, + 0x3fb6: 0x00c0, 0x3fb7: 0x00c0, 0x3fb8: 0x00c0, 0x3fb9: 0x00c0, 0x3fba: 0x00c0, 0x3fbb: 0x00c0, + 0x3fbc: 0x00c0, 0x3fbd: 0x00c0, 0x3fbe: 0x00c0, 0x3fbf: 0x00c0, + // Block 0xff, offset 0x3fc0 + 0x3fc0: 0x00c0, 0x3fc1: 0x00c0, 0x3fc2: 0x00c0, 0x3fc3: 0x00c0, 0x3fc4: 0x00c0, 0x3fc5: 0x00c0, + 0x3fc6: 0x00c0, 0x3fc7: 0x00c0, 0x3fc8: 0x00c0, 0x3fc9: 0x00c0, 0x3fca: 0x00c0, 0x3fcb: 0x00c0, + 0x3fcc: 0x00c0, 0x3fcd: 0x00c0, 0x3fce: 0x00c0, 0x3fcf: 0x00c0, + 0x3fd2: 0x00c3, 0x3fd3: 0x00c3, 0x3fd4: 0x00c3, 0x3fd5: 0x00c3, 0x3fd6: 0x00c3, 0x3fd7: 0x00c3, + 0x3fd8: 0x00c3, 0x3fd9: 0x00c3, 0x3fda: 0x00c3, 0x3fdb: 0x00c3, 0x3fdc: 0x00c3, 0x3fdd: 0x00c3, + 0x3fde: 0x00c3, 0x3fdf: 0x00c3, 0x3fe0: 0x00c3, 0x3fe1: 0x00c3, 0x3fe2: 0x00c3, 0x3fe3: 0x00c3, + 0x3fe4: 0x00c3, 0x3fe5: 0x00c3, 0x3fe6: 0x00c3, 0x3fe7: 0x00c3, 0x3fe9: 0x00c0, + 0x3fea: 0x00c3, 0x3feb: 0x00c3, 0x3fec: 0x00c3, 0x3fed: 0x00c3, 0x3fee: 0x00c3, 0x3fef: 0x00c3, + 0x3ff0: 0x00c3, 0x3ff1: 0x00c0, 0x3ff2: 0x00c3, 0x3ff3: 0x00c3, 0x3ff4: 0x00c0, 0x3ff5: 0x00c3, + 0x3ff6: 0x00c3, + // Block 0x100, offset 0x4000 + 0x4000: 0x00c0, 0x4001: 0x00c0, 0x4002: 0x00c0, 0x4003: 0x00c0, 0x4004: 0x00c0, 0x4005: 0x00c0, + 0x4006: 0x00c0, 0x4007: 0x00c0, 0x4008: 0x00c0, 0x4009: 0x00c0, 0x400a: 0x00c0, 0x400b: 0x00c0, + 0x400c: 0x00c0, 0x400d: 0x00c0, 0x400e: 0x00c0, 0x400f: 0x00c0, 0x4010: 0x00c0, 0x4011: 0x00c0, + 0x4012: 0x00c0, 0x4013: 0x00c0, 0x4014: 0x00c0, 0x4015: 0x00c0, 0x4016: 0x00c0, 0x4017: 0x00c0, + 0x4018: 0x00c0, 0x4019: 0x00c0, + // Block 0x101, offset 0x4040 + 0x4040: 0x0080, 0x4041: 0x0080, 0x4042: 0x0080, 0x4043: 0x0080, 0x4044: 0x0080, 0x4045: 0x0080, + 0x4046: 0x0080, 0x4047: 0x0080, 0x4048: 0x0080, 0x4049: 0x0080, 0x404a: 0x0080, 0x404b: 0x0080, + 0x404c: 0x0080, 0x404d: 0x0080, 0x404e: 0x0080, 0x404f: 0x0080, 0x4050: 0x0080, 0x4051: 0x0080, + 0x4052: 0x0080, 0x4053: 0x0080, 0x4054: 0x0080, 0x4055: 0x0080, 0x4056: 0x0080, 0x4057: 0x0080, + 0x4058: 0x0080, 0x4059: 0x0080, 0x405a: 0x0080, 0x405b: 0x0080, 0x405c: 0x0080, 0x405d: 0x0080, + 0x405e: 0x0080, 0x405f: 0x0080, 0x4060: 0x0080, 0x4061: 0x0080, 0x4062: 0x0080, 0x4063: 0x0080, + 0x4064: 0x0080, 0x4065: 0x0080, 0x4066: 0x0080, 0x4067: 0x0080, 0x4068: 0x0080, 0x4069: 0x0080, + 0x406a: 0x0080, 0x406b: 0x0080, 0x406c: 0x0080, 0x406d: 0x0080, 0x406e: 0x0080, + 0x4070: 0x0080, 0x4071: 0x0080, 0x4072: 0x0080, 0x4073: 0x0080, 0x4074: 0x0080, + // Block 0x102, offset 0x4080 + 0x4080: 0x00c0, 0x4081: 0x00c0, 0x4082: 0x00c0, 0x4083: 0x00c0, + // Block 0x103, offset 0x40c0 + 0x40c0: 0x00c0, 0x40c1: 0x00c0, 0x40c2: 0x00c0, 0x40c3: 0x00c0, 0x40c4: 0x00c0, 0x40c5: 0x00c0, + 0x40c6: 0x00c0, 0x40c7: 0x00c0, 0x40c8: 0x00c0, 0x40c9: 0x00c0, 0x40ca: 0x00c0, 0x40cb: 0x00c0, + 0x40cc: 0x00c0, 0x40cd: 0x00c0, 0x40ce: 0x00c0, 0x40cf: 0x00c0, 0x40d0: 0x00c0, 0x40d1: 0x00c0, + 0x40d2: 0x00c0, 0x40d3: 0x00c0, 0x40d4: 0x00c0, 0x40d5: 0x00c0, 0x40d6: 0x00c0, 0x40d7: 0x00c0, + 0x40d8: 0x00c0, 0x40d9: 0x00c0, 0x40da: 0x00c0, 0x40db: 0x00c0, 0x40dc: 0x00c0, 0x40dd: 0x00c0, + 0x40de: 0x00c0, 0x40df: 0x00c0, 0x40e0: 0x00c0, 0x40e1: 0x00c0, 0x40e2: 0x00c0, 0x40e3: 0x00c0, + 0x40e4: 0x00c0, 0x40e5: 0x00c0, 0x40e6: 0x00c0, 0x40e7: 0x00c0, 0x40e8: 0x00c0, 0x40e9: 0x00c0, + 0x40ea: 0x00c0, 0x40eb: 0x00c0, 0x40ec: 0x00c0, 0x40ed: 0x00c0, 0x40ee: 0x00c0, + // Block 0x104, offset 0x4100 + 0x4100: 0x00c0, 0x4101: 0x00c0, 0x4102: 0x00c0, 0x4103: 0x00c0, 0x4104: 0x00c0, 0x4105: 0x00c0, + 0x4106: 0x00c0, + // Block 0x105, offset 0x4140 + 0x4140: 0x00c0, 0x4141: 0x00c0, 0x4142: 0x00c0, 0x4143: 0x00c0, 0x4144: 0x00c0, 0x4145: 0x00c0, + 0x4146: 0x00c0, 0x4147: 0x00c0, 0x4148: 0x00c0, 0x4149: 0x00c0, 0x414a: 0x00c0, 0x414b: 0x00c0, + 0x414c: 0x00c0, 0x414d: 0x00c0, 0x414e: 0x00c0, 0x414f: 0x00c0, 0x4150: 0x00c0, 0x4151: 0x00c0, + 0x4152: 0x00c0, 0x4153: 0x00c0, 0x4154: 0x00c0, 0x4155: 0x00c0, 0x4156: 0x00c0, 0x4157: 0x00c0, + 0x4158: 0x00c0, 0x4159: 0x00c0, 0x415a: 0x00c0, 0x415b: 0x00c0, 0x415c: 0x00c0, 0x415d: 0x00c0, + 0x415e: 0x00c0, 0x4160: 0x00c0, 0x4161: 0x00c0, 0x4162: 0x00c0, 0x4163: 0x00c0, + 0x4164: 0x00c0, 0x4165: 0x00c0, 0x4166: 0x00c0, 0x4167: 0x00c0, 0x4168: 0x00c0, 0x4169: 0x00c0, + 0x416e: 0x0080, 0x416f: 0x0080, + // Block 0x106, offset 0x4180 + 0x4190: 0x00c0, 0x4191: 0x00c0, + 0x4192: 0x00c0, 0x4193: 0x00c0, 0x4194: 0x00c0, 0x4195: 0x00c0, 0x4196: 0x00c0, 0x4197: 0x00c0, + 0x4198: 0x00c0, 0x4199: 0x00c0, 0x419a: 0x00c0, 0x419b: 0x00c0, 0x419c: 0x00c0, 0x419d: 0x00c0, + 0x419e: 0x00c0, 0x419f: 0x00c0, 0x41a0: 0x00c0, 0x41a1: 0x00c0, 0x41a2: 0x00c0, 0x41a3: 0x00c0, + 0x41a4: 0x00c0, 0x41a5: 0x00c0, 0x41a6: 0x00c0, 0x41a7: 0x00c0, 0x41a8: 0x00c0, 0x41a9: 0x00c0, + 0x41aa: 0x00c0, 0x41ab: 0x00c0, 0x41ac: 0x00c0, 0x41ad: 0x00c0, + 0x41b0: 0x00c3, 0x41b1: 0x00c3, 0x41b2: 0x00c3, 0x41b3: 0x00c3, 0x41b4: 0x00c3, 0x41b5: 0x0080, + // Block 0x107, offset 0x41c0 + 0x41c0: 0x00c0, 0x41c1: 0x00c0, 0x41c2: 0x00c0, 0x41c3: 0x00c0, 0x41c4: 0x00c0, 0x41c5: 0x00c0, + 0x41c6: 0x00c0, 0x41c7: 0x00c0, 0x41c8: 0x00c0, 0x41c9: 0x00c0, 0x41ca: 0x00c0, 0x41cb: 0x00c0, + 0x41cc: 0x00c0, 0x41cd: 0x00c0, 0x41ce: 0x00c0, 0x41cf: 0x00c0, 0x41d0: 0x00c0, 0x41d1: 0x00c0, + 0x41d2: 0x00c0, 0x41d3: 0x00c0, 0x41d4: 0x00c0, 0x41d5: 0x00c0, 0x41d6: 0x00c0, 0x41d7: 0x00c0, + 0x41d8: 0x00c0, 0x41d9: 0x00c0, 0x41da: 0x00c0, 0x41db: 0x00c0, 0x41dc: 0x00c0, 0x41dd: 0x00c0, + 0x41de: 0x00c0, 0x41df: 0x00c0, 0x41e0: 0x00c0, 0x41e1: 0x00c0, 0x41e2: 0x00c0, 0x41e3: 0x00c0, + 0x41e4: 0x00c0, 0x41e5: 0x00c0, 0x41e6: 0x00c0, 0x41e7: 0x00c0, 0x41e8: 0x00c0, 0x41e9: 0x00c0, + 0x41ea: 0x00c0, 0x41eb: 0x00c0, 0x41ec: 0x00c0, 0x41ed: 0x00c0, 0x41ee: 0x00c0, 0x41ef: 0x00c0, + 0x41f0: 0x00c3, 0x41f1: 0x00c3, 0x41f2: 0x00c3, 0x41f3: 0x00c3, 0x41f4: 0x00c3, 0x41f5: 0x00c3, + 0x41f6: 0x00c3, 0x41f7: 0x0080, 0x41f8: 0x0080, 0x41f9: 0x0080, 0x41fa: 0x0080, 0x41fb: 0x0080, + 0x41fc: 0x0080, 0x41fd: 0x0080, 0x41fe: 0x0080, 0x41ff: 0x0080, + // Block 0x108, offset 0x4200 + 0x4200: 0x00c0, 0x4201: 0x00c0, 0x4202: 0x00c0, 0x4203: 0x00c0, 0x4204: 0x0080, 0x4205: 0x0080, + 0x4210: 0x00c0, 0x4211: 0x00c0, + 0x4212: 0x00c0, 0x4213: 0x00c0, 0x4214: 0x00c0, 0x4215: 0x00c0, 0x4216: 0x00c0, 0x4217: 0x00c0, + 0x4218: 0x00c0, 0x4219: 0x00c0, 0x421b: 0x0080, 0x421c: 0x0080, 0x421d: 0x0080, + 0x421e: 0x0080, 0x421f: 0x0080, 0x4220: 0x0080, 0x4221: 0x0080, 0x4223: 0x00c0, + 0x4224: 0x00c0, 0x4225: 0x00c0, 0x4226: 0x00c0, 0x4227: 0x00c0, 0x4228: 0x00c0, 0x4229: 0x00c0, + 0x422a: 0x00c0, 0x422b: 0x00c0, 0x422c: 0x00c0, 0x422d: 0x00c0, 0x422e: 0x00c0, 0x422f: 0x00c0, + 0x4230: 0x00c0, 0x4231: 0x00c0, 0x4232: 0x00c0, 0x4233: 0x00c0, 0x4234: 0x00c0, 0x4235: 0x00c0, + 0x4236: 0x00c0, 0x4237: 0x00c0, + 0x423d: 0x00c0, 0x423e: 0x00c0, 0x423f: 0x00c0, + // Block 0x109, offset 0x4240 + 0x4240: 0x00c0, 0x4241: 0x00c0, 0x4242: 0x00c0, 0x4243: 0x00c0, 0x4244: 0x00c0, 0x4245: 0x00c0, + 0x4246: 0x00c0, 0x4247: 0x00c0, 0x4248: 0x00c0, 0x4249: 0x00c0, 0x424a: 0x00c0, 0x424b: 0x00c0, + 0x424c: 0x00c0, 0x424d: 0x00c0, 0x424e: 0x00c0, 0x424f: 0x00c0, + // Block 0x10a, offset 0x4280 + 0x4280: 0x00c0, 0x4281: 0x00c0, 0x4282: 0x00c0, 0x4283: 0x00c0, 0x4284: 0x00c0, + 0x4290: 0x00c0, 0x4291: 0x00c0, + 0x4292: 0x00c0, 0x4293: 0x00c0, 0x4294: 0x00c0, 0x4295: 0x00c0, 0x4296: 0x00c0, 0x4297: 0x00c0, + 0x4298: 0x00c0, 0x4299: 0x00c0, 0x429a: 0x00c0, 0x429b: 0x00c0, 0x429c: 0x00c0, 0x429d: 0x00c0, + 0x429e: 0x00c0, 0x429f: 0x00c0, 0x42a0: 0x00c0, 0x42a1: 0x00c0, 0x42a2: 0x00c0, 0x42a3: 0x00c0, + 0x42a4: 0x00c0, 0x42a5: 0x00c0, 0x42a6: 0x00c0, 0x42a7: 0x00c0, 0x42a8: 0x00c0, 0x42a9: 0x00c0, + 0x42aa: 0x00c0, 0x42ab: 0x00c0, 0x42ac: 0x00c0, 0x42ad: 0x00c0, 0x42ae: 0x00c0, 0x42af: 0x00c0, + 0x42b0: 0x00c0, 0x42b1: 0x00c0, 0x42b2: 0x00c0, 0x42b3: 0x00c0, 0x42b4: 0x00c0, 0x42b5: 0x00c0, + 0x42b6: 0x00c0, 0x42b7: 0x00c0, 0x42b8: 0x00c0, 0x42b9: 0x00c0, 0x42ba: 0x00c0, 0x42bb: 0x00c0, + 0x42bc: 0x00c0, 0x42bd: 0x00c0, 0x42be: 0x00c0, + // Block 0x10b, offset 0x42c0 + 0x42cf: 0x00c3, 0x42d0: 0x00c3, 0x42d1: 0x00c3, + 0x42d2: 0x00c3, 0x42d3: 0x00c0, 0x42d4: 0x00c0, 0x42d5: 0x00c0, 0x42d6: 0x00c0, 0x42d7: 0x00c0, + 0x42d8: 0x00c0, 0x42d9: 0x00c0, 0x42da: 0x00c0, 0x42db: 0x00c0, 0x42dc: 0x00c0, 0x42dd: 0x00c0, + 0x42de: 0x00c0, 0x42df: 0x00c0, + // Block 0x10c, offset 0x4300 + 0x4320: 0x00c0, + // Block 0x10d, offset 0x4340 + 0x4340: 0x00c0, 0x4341: 0x00c0, 0x4342: 0x00c0, 0x4343: 0x00c0, 0x4344: 0x00c0, 0x4345: 0x00c0, + 0x4346: 0x00c0, 0x4347: 0x00c0, 0x4348: 0x00c0, 0x4349: 0x00c0, 0x434a: 0x00c0, 0x434b: 0x00c0, + 0x434c: 0x00c0, 0x434d: 0x00c0, 0x434e: 0x00c0, 0x434f: 0x00c0, 0x4350: 0x00c0, 0x4351: 0x00c0, + 0x4352: 0x00c0, 0x4353: 0x00c0, 0x4354: 0x00c0, 0x4355: 0x00c0, 0x4356: 0x00c0, 0x4357: 0x00c0, + 0x4358: 0x00c0, 0x4359: 0x00c0, 0x435a: 0x00c0, 0x435b: 0x00c0, 0x435c: 0x00c0, 0x435d: 0x00c0, + 0x435e: 0x00c0, 0x435f: 0x00c0, 0x4360: 0x00c0, 0x4361: 0x00c0, 0x4362: 0x00c0, 0x4363: 0x00c0, + 0x4364: 0x00c0, 0x4365: 0x00c0, 0x4366: 0x00c0, 0x4367: 0x00c0, 0x4368: 0x00c0, 0x4369: 0x00c0, + 0x436a: 0x00c0, 0x436b: 0x00c0, 0x436c: 0x00c0, + // Block 0x10e, offset 0x4380 + 0x4380: 0x00cc, 0x4381: 0x00cc, + // Block 0x10f, offset 0x43c0 + 0x43c0: 0x00c0, 0x43c1: 0x00c0, 0x43c2: 0x00c0, 0x43c3: 0x00c0, 0x43c4: 0x00c0, 0x43c5: 0x00c0, + 0x43c6: 0x00c0, 0x43c7: 0x00c0, 0x43c8: 0x00c0, 0x43c9: 0x00c0, 0x43ca: 0x00c0, 0x43cb: 0x00c0, + 0x43cc: 0x00c0, 0x43cd: 0x00c0, 0x43ce: 0x00c0, 0x43cf: 0x00c0, 0x43d0: 0x00c0, 0x43d1: 0x00c0, + 0x43d2: 0x00c0, 0x43d3: 0x00c0, 0x43d4: 0x00c0, 0x43d5: 0x00c0, 0x43d6: 0x00c0, 0x43d7: 0x00c0, + 0x43d8: 0x00c0, 0x43d9: 0x00c0, 0x43da: 0x00c0, 0x43db: 0x00c0, 0x43dc: 0x00c0, 0x43dd: 0x00c0, + 0x43de: 0x00c0, 0x43df: 0x00c0, 0x43e0: 0x00c0, 0x43e1: 0x00c0, 0x43e2: 0x00c0, 0x43e3: 0x00c0, + 0x43e4: 0x00c0, 0x43e5: 0x00c0, 0x43e6: 0x00c0, 0x43e7: 0x00c0, 0x43e8: 0x00c0, 0x43e9: 0x00c0, + 0x43ea: 0x00c0, + 0x43f0: 0x00c0, 0x43f1: 0x00c0, 0x43f2: 0x00c0, 0x43f3: 0x00c0, 0x43f4: 0x00c0, 0x43f5: 0x00c0, + 0x43f6: 0x00c0, 0x43f7: 0x00c0, 0x43f8: 0x00c0, 0x43f9: 0x00c0, 0x43fa: 0x00c0, 0x43fb: 0x00c0, + 0x43fc: 0x00c0, + // Block 0x110, offset 0x4400 + 0x4400: 0x00c0, 0x4401: 0x00c0, 0x4402: 0x00c0, 0x4403: 0x00c0, 0x4404: 0x00c0, 0x4405: 0x00c0, + 0x4406: 0x00c0, 0x4407: 0x00c0, 0x4408: 0x00c0, + 0x4410: 0x00c0, 0x4411: 0x00c0, + 0x4412: 0x00c0, 0x4413: 0x00c0, 0x4414: 0x00c0, 0x4415: 0x00c0, 0x4416: 0x00c0, 0x4417: 0x00c0, + 0x4418: 0x00c0, 0x4419: 0x00c0, 0x441c: 0x0080, 0x441d: 0x00c3, + 0x441e: 0x00c3, 0x441f: 0x0080, 0x4420: 0x0040, 0x4421: 0x0040, 0x4422: 0x0040, 0x4423: 0x0040, + // Block 0x111, offset 0x4440 + 0x4440: 0x0080, 0x4441: 0x0080, 0x4442: 0x0080, 0x4443: 0x0080, 0x4444: 0x0080, 0x4445: 0x0080, + 0x4446: 0x0080, 0x4447: 0x0080, 0x4448: 0x0080, 0x4449: 0x0080, 0x444a: 0x0080, 0x444b: 0x0080, + 0x444c: 0x0080, 0x444d: 0x0080, 0x444e: 0x0080, 0x444f: 0x0080, 0x4450: 0x0080, 0x4451: 0x0080, + 0x4452: 0x0080, 0x4453: 0x0080, 0x4454: 0x0080, 0x4455: 0x0080, 0x4456: 0x0080, 0x4457: 0x0080, + 0x4458: 0x0080, 0x4459: 0x0080, 0x445a: 0x0080, 0x445b: 0x0080, 0x445c: 0x0080, 0x445d: 0x0080, + 0x445e: 0x0080, 0x445f: 0x0080, 0x4460: 0x0080, 0x4461: 0x0080, 0x4462: 0x0080, 0x4463: 0x0080, + 0x4464: 0x0080, 0x4465: 0x0080, 0x4466: 0x0080, 0x4467: 0x0080, 0x4468: 0x0080, 0x4469: 0x0080, + 0x446a: 0x0080, 0x446b: 0x0080, 0x446c: 0x0080, 0x446d: 0x0080, 0x446e: 0x0080, 0x446f: 0x0080, + 0x4470: 0x0080, 0x4471: 0x0080, 0x4472: 0x0080, 0x4473: 0x0080, 0x4474: 0x0080, 0x4475: 0x0080, + // Block 0x112, offset 0x4480 + 0x4480: 0x0080, 0x4481: 0x0080, 0x4482: 0x0080, 0x4483: 0x0080, 0x4484: 0x0080, 0x4485: 0x0080, + 0x4486: 0x0080, 0x4487: 0x0080, 0x4488: 0x0080, 0x4489: 0x0080, 0x448a: 0x0080, 0x448b: 0x0080, + 0x448c: 0x0080, 0x448d: 0x0080, 0x448e: 0x0080, 0x448f: 0x0080, 0x4490: 0x0080, 0x4491: 0x0080, + 0x4492: 0x0080, 0x4493: 0x0080, 0x4494: 0x0080, 0x4495: 0x0080, 0x4496: 0x0080, 0x4497: 0x0080, + 0x4498: 0x0080, 0x4499: 0x0080, 0x449a: 0x0080, 0x449b: 0x0080, 0x449c: 0x0080, 0x449d: 0x0080, + 0x449e: 0x0080, 0x449f: 0x0080, 0x44a0: 0x0080, 0x44a1: 0x0080, 0x44a2: 0x0080, 0x44a3: 0x0080, + 0x44a4: 0x0080, 0x44a5: 0x0080, 0x44a6: 0x0080, 0x44a9: 0x0080, + 0x44aa: 0x0080, 0x44ab: 0x0080, 0x44ac: 0x0080, 0x44ad: 0x0080, 0x44ae: 0x0080, 0x44af: 0x0080, + 0x44b0: 0x0080, 0x44b1: 0x0080, 0x44b2: 0x0080, 0x44b3: 0x0080, 0x44b4: 0x0080, 0x44b5: 0x0080, + 0x44b6: 0x0080, 0x44b7: 0x0080, 0x44b8: 0x0080, 0x44b9: 0x0080, 0x44ba: 0x0080, 0x44bb: 0x0080, + 0x44bc: 0x0080, 0x44bd: 0x0080, 0x44be: 0x0080, 0x44bf: 0x0080, + // Block 0x113, offset 0x44c0 + 0x44c0: 0x0080, 0x44c1: 0x0080, 0x44c2: 0x0080, 0x44c3: 0x0080, 0x44c4: 0x0080, 0x44c5: 0x0080, + 0x44c6: 0x0080, 0x44c7: 0x0080, 0x44c8: 0x0080, 0x44c9: 0x0080, 0x44ca: 0x0080, 0x44cb: 0x0080, + 0x44cc: 0x0080, 0x44cd: 0x0080, 0x44ce: 0x0080, 0x44cf: 0x0080, 0x44d0: 0x0080, 0x44d1: 0x0080, + 0x44d2: 0x0080, 0x44d3: 0x0080, 0x44d4: 0x0080, 0x44d5: 0x0080, 0x44d6: 0x0080, 0x44d7: 0x0080, + 0x44d8: 0x0080, 0x44d9: 0x0080, 0x44da: 0x0080, 0x44db: 0x0080, 0x44dc: 0x0080, 0x44dd: 0x0080, + 0x44de: 0x0080, 0x44df: 0x0080, 0x44e0: 0x0080, 0x44e1: 0x0080, 0x44e2: 0x0080, 0x44e3: 0x0080, + 0x44e4: 0x0080, 0x44e5: 0x00c0, 0x44e6: 0x00c0, 0x44e7: 0x00c3, 0x44e8: 0x00c3, 0x44e9: 0x00c3, + 0x44ea: 0x0080, 0x44eb: 0x0080, 0x44ec: 0x0080, 0x44ed: 0x00c0, 0x44ee: 0x00c0, 0x44ef: 0x00c0, + 0x44f0: 0x00c0, 0x44f1: 0x00c0, 0x44f2: 0x00c0, 0x44f3: 0x0040, 0x44f4: 0x0040, 0x44f5: 0x0040, + 0x44f6: 0x0040, 0x44f7: 0x0040, 0x44f8: 0x0040, 0x44f9: 0x0040, 0x44fa: 0x0040, 0x44fb: 0x00c3, + 0x44fc: 0x00c3, 0x44fd: 0x00c3, 0x44fe: 0x00c3, 0x44ff: 0x00c3, + // Block 0x114, offset 0x4500 + 0x4500: 0x00c3, 0x4501: 0x00c3, 0x4502: 0x00c3, 0x4503: 0x0080, 0x4504: 0x0080, 0x4505: 0x00c3, + 0x4506: 0x00c3, 0x4507: 0x00c3, 0x4508: 0x00c3, 0x4509: 0x00c3, 0x450a: 0x00c3, 0x450b: 0x00c3, + 0x450c: 0x0080, 0x450d: 0x0080, 0x450e: 0x0080, 0x450f: 0x0080, 0x4510: 0x0080, 0x4511: 0x0080, + 0x4512: 0x0080, 0x4513: 0x0080, 0x4514: 0x0080, 0x4515: 0x0080, 0x4516: 0x0080, 0x4517: 0x0080, + 0x4518: 0x0080, 0x4519: 0x0080, 0x451a: 0x0080, 0x451b: 0x0080, 0x451c: 0x0080, 0x451d: 0x0080, + 0x451e: 0x0080, 0x451f: 0x0080, 0x4520: 0x0080, 0x4521: 0x0080, 0x4522: 0x0080, 0x4523: 0x0080, + 0x4524: 0x0080, 0x4525: 0x0080, 0x4526: 0x0080, 0x4527: 0x0080, 0x4528: 0x0080, 0x4529: 0x0080, + 0x452a: 0x00c3, 0x452b: 0x00c3, 0x452c: 0x00c3, 0x452d: 0x00c3, 0x452e: 0x0080, 0x452f: 0x0080, + 0x4530: 0x0080, 0x4531: 0x0080, 0x4532: 0x0080, 0x4533: 0x0080, 0x4534: 0x0080, 0x4535: 0x0080, + 0x4536: 0x0080, 0x4537: 0x0080, 0x4538: 0x0080, 0x4539: 0x0080, 0x453a: 0x0080, 0x453b: 0x0080, + 0x453c: 0x0080, 0x453d: 0x0080, 0x453e: 0x0080, 0x453f: 0x0080, + // Block 0x115, offset 0x4540 + 0x4540: 0x0080, 0x4541: 0x0080, 0x4542: 0x0080, 0x4543: 0x0080, 0x4544: 0x0080, 0x4545: 0x0080, + 0x4546: 0x0080, 0x4547: 0x0080, 0x4548: 0x0080, 0x4549: 0x0080, 0x454a: 0x0080, 0x454b: 0x0080, + 0x454c: 0x0080, 0x454d: 0x0080, 0x454e: 0x0080, 0x454f: 0x0080, 0x4550: 0x0080, 0x4551: 0x0080, + 0x4552: 0x0080, 0x4553: 0x0080, 0x4554: 0x0080, 0x4555: 0x0080, 0x4556: 0x0080, 0x4557: 0x0080, + 0x4558: 0x0080, 0x4559: 0x0080, 0x455a: 0x0080, 0x455b: 0x0080, 0x455c: 0x0080, 0x455d: 0x0080, + 0x455e: 0x0080, 0x455f: 0x0080, 0x4560: 0x0080, 0x4561: 0x0080, 0x4562: 0x0080, 0x4563: 0x0080, + 0x4564: 0x0080, 0x4565: 0x0080, 0x4566: 0x0080, 0x4567: 0x0080, 0x4568: 0x0080, + // Block 0x116, offset 0x4580 + 0x4580: 0x0088, 0x4581: 0x0088, 0x4582: 0x00c9, 0x4583: 0x00c9, 0x4584: 0x00c9, 0x4585: 0x0088, + // Block 0x117, offset 0x45c0 + 0x45c0: 0x0080, 0x45c1: 0x0080, 0x45c2: 0x0080, 0x45c3: 0x0080, 0x45c4: 0x0080, 0x45c5: 0x0080, + 0x45c6: 0x0080, 0x45c7: 0x0080, 0x45c8: 0x0080, 0x45c9: 0x0080, 0x45ca: 0x0080, 0x45cb: 0x0080, + 0x45cc: 0x0080, 0x45cd: 0x0080, 0x45ce: 0x0080, 0x45cf: 0x0080, 0x45d0: 0x0080, 0x45d1: 0x0080, + 0x45d2: 0x0080, 0x45d3: 0x0080, 0x45d4: 0x0080, 0x45d5: 0x0080, 0x45d6: 0x0080, + 0x45e0: 0x0080, 0x45e1: 0x0080, 0x45e2: 0x0080, 0x45e3: 0x0080, + 0x45e4: 0x0080, 0x45e5: 0x0080, 0x45e6: 0x0080, 0x45e7: 0x0080, 0x45e8: 0x0080, 0x45e9: 0x0080, + 0x45ea: 0x0080, 0x45eb: 0x0080, 0x45ec: 0x0080, 0x45ed: 0x0080, 0x45ee: 0x0080, 0x45ef: 0x0080, + 0x45f0: 0x0080, 0x45f1: 0x0080, + // Block 0x118, offset 0x4600 + 0x4600: 0x0080, 0x4601: 0x0080, 0x4602: 0x0080, 0x4603: 0x0080, 0x4604: 0x0080, 0x4605: 0x0080, + 0x4606: 0x0080, 0x4607: 0x0080, 0x4608: 0x0080, 0x4609: 0x0080, 0x460a: 0x0080, 0x460b: 0x0080, + 0x460c: 0x0080, 0x460d: 0x0080, 0x460e: 0x0080, 0x460f: 0x0080, 0x4610: 0x0080, 0x4611: 0x0080, + 0x4612: 0x0080, 0x4613: 0x0080, 0x4614: 0x0080, 0x4616: 0x0080, 0x4617: 0x0080, + 0x4618: 0x0080, 0x4619: 0x0080, 0x461a: 0x0080, 0x461b: 0x0080, 0x461c: 0x0080, 0x461d: 0x0080, + 0x461e: 0x0080, 0x461f: 0x0080, 0x4620: 0x0080, 0x4621: 0x0080, 0x4622: 0x0080, 0x4623: 0x0080, + 0x4624: 0x0080, 0x4625: 0x0080, 0x4626: 0x0080, 0x4627: 0x0080, 0x4628: 0x0080, 0x4629: 0x0080, + 0x462a: 0x0080, 0x462b: 0x0080, 0x462c: 0x0080, 0x462d: 0x0080, 0x462e: 0x0080, 0x462f: 0x0080, + 0x4630: 0x0080, 0x4631: 0x0080, 0x4632: 0x0080, 0x4633: 0x0080, 0x4634: 0x0080, 0x4635: 0x0080, + 0x4636: 0x0080, 0x4637: 0x0080, 0x4638: 0x0080, 0x4639: 0x0080, 0x463a: 0x0080, 0x463b: 0x0080, + 0x463c: 0x0080, 0x463d: 0x0080, 0x463e: 0x0080, 0x463f: 0x0080, + // Block 0x119, offset 0x4640 + 0x4640: 0x0080, 0x4641: 0x0080, 0x4642: 0x0080, 0x4643: 0x0080, 0x4644: 0x0080, 0x4645: 0x0080, + 0x4646: 0x0080, 0x4647: 0x0080, 0x4648: 0x0080, 0x4649: 0x0080, 0x464a: 0x0080, 0x464b: 0x0080, + 0x464c: 0x0080, 0x464d: 0x0080, 0x464e: 0x0080, 0x464f: 0x0080, 0x4650: 0x0080, 0x4651: 0x0080, + 0x4652: 0x0080, 0x4653: 0x0080, 0x4654: 0x0080, 0x4655: 0x0080, 0x4656: 0x0080, 0x4657: 0x0080, + 0x4658: 0x0080, 0x4659: 0x0080, 0x465a: 0x0080, 0x465b: 0x0080, 0x465c: 0x0080, + 0x465e: 0x0080, 0x465f: 0x0080, 0x4662: 0x0080, + 0x4665: 0x0080, 0x4666: 0x0080, 0x4669: 0x0080, + 0x466a: 0x0080, 0x466b: 0x0080, 0x466c: 0x0080, 0x466e: 0x0080, 0x466f: 0x0080, + 0x4670: 0x0080, 0x4671: 0x0080, 0x4672: 0x0080, 0x4673: 0x0080, 0x4674: 0x0080, 0x4675: 0x0080, + 0x4676: 0x0080, 0x4677: 0x0080, 0x4678: 0x0080, 0x4679: 0x0080, 0x467b: 0x0080, + 0x467d: 0x0080, 0x467e: 0x0080, 0x467f: 0x0080, + // Block 0x11a, offset 0x4680 + 0x4680: 0x0080, 0x4681: 0x0080, 0x4682: 0x0080, 0x4683: 0x0080, 0x4685: 0x0080, + 0x4686: 0x0080, 0x4687: 0x0080, 0x4688: 0x0080, 0x4689: 0x0080, 0x468a: 0x0080, 0x468b: 0x0080, + 0x468c: 0x0080, 0x468d: 0x0080, 0x468e: 0x0080, 0x468f: 0x0080, 0x4690: 0x0080, 0x4691: 0x0080, + 0x4692: 0x0080, 0x4693: 0x0080, 0x4694: 0x0080, 0x4695: 0x0080, 0x4696: 0x0080, 0x4697: 0x0080, + 0x4698: 0x0080, 0x4699: 0x0080, 0x469a: 0x0080, 0x469b: 0x0080, 0x469c: 0x0080, 0x469d: 0x0080, + 0x469e: 0x0080, 0x469f: 0x0080, 0x46a0: 0x0080, 0x46a1: 0x0080, 0x46a2: 0x0080, 0x46a3: 0x0080, + 0x46a4: 0x0080, 0x46a5: 0x0080, 0x46a6: 0x0080, 0x46a7: 0x0080, 0x46a8: 0x0080, 0x46a9: 0x0080, + 0x46aa: 0x0080, 0x46ab: 0x0080, 0x46ac: 0x0080, 0x46ad: 0x0080, 0x46ae: 0x0080, 0x46af: 0x0080, + 0x46b0: 0x0080, 0x46b1: 0x0080, 0x46b2: 0x0080, 0x46b3: 0x0080, 0x46b4: 0x0080, 0x46b5: 0x0080, + 0x46b6: 0x0080, 0x46b7: 0x0080, 0x46b8: 0x0080, 0x46b9: 0x0080, 0x46ba: 0x0080, 0x46bb: 0x0080, + 0x46bc: 0x0080, 0x46bd: 0x0080, 0x46be: 0x0080, 0x46bf: 0x0080, + // Block 0x11b, offset 0x46c0 + 0x46c0: 0x0080, 0x46c1: 0x0080, 0x46c2: 0x0080, 0x46c3: 0x0080, 0x46c4: 0x0080, 0x46c5: 0x0080, + 0x46c7: 0x0080, 0x46c8: 0x0080, 0x46c9: 0x0080, 0x46ca: 0x0080, + 0x46cd: 0x0080, 0x46ce: 0x0080, 0x46cf: 0x0080, 0x46d0: 0x0080, 0x46d1: 0x0080, + 0x46d2: 0x0080, 0x46d3: 0x0080, 0x46d4: 0x0080, 0x46d6: 0x0080, 0x46d7: 0x0080, + 0x46d8: 0x0080, 0x46d9: 0x0080, 0x46da: 0x0080, 0x46db: 0x0080, 0x46dc: 0x0080, + 0x46de: 0x0080, 0x46df: 0x0080, 0x46e0: 0x0080, 0x46e1: 0x0080, 0x46e2: 0x0080, 0x46e3: 0x0080, + 0x46e4: 0x0080, 0x46e5: 0x0080, 0x46e6: 0x0080, 0x46e7: 0x0080, 0x46e8: 0x0080, 0x46e9: 0x0080, + 0x46ea: 0x0080, 0x46eb: 0x0080, 0x46ec: 0x0080, 0x46ed: 0x0080, 0x46ee: 0x0080, 0x46ef: 0x0080, + 0x46f0: 0x0080, 0x46f1: 0x0080, 0x46f2: 0x0080, 0x46f3: 0x0080, 0x46f4: 0x0080, 0x46f5: 0x0080, + 0x46f6: 0x0080, 0x46f7: 0x0080, 0x46f8: 0x0080, 0x46f9: 0x0080, 0x46fb: 0x0080, + 0x46fc: 0x0080, 0x46fd: 0x0080, 0x46fe: 0x0080, + // Block 0x11c, offset 0x4700 + 0x4700: 0x0080, 0x4701: 0x0080, 0x4702: 0x0080, 0x4703: 0x0080, 0x4704: 0x0080, + 0x4706: 0x0080, 0x470a: 0x0080, 0x470b: 0x0080, + 0x470c: 0x0080, 0x470d: 0x0080, 0x470e: 0x0080, 0x470f: 0x0080, 0x4710: 0x0080, + 0x4712: 0x0080, 0x4713: 0x0080, 0x4714: 0x0080, 0x4715: 0x0080, 0x4716: 0x0080, 0x4717: 0x0080, + 0x4718: 0x0080, 0x4719: 0x0080, 0x471a: 0x0080, 0x471b: 0x0080, 0x471c: 0x0080, 0x471d: 0x0080, + 0x471e: 0x0080, 0x471f: 0x0080, 0x4720: 0x0080, 0x4721: 0x0080, 0x4722: 0x0080, 0x4723: 0x0080, + 0x4724: 0x0080, 0x4725: 0x0080, 0x4726: 0x0080, 0x4727: 0x0080, 0x4728: 0x0080, 0x4729: 0x0080, + 0x472a: 0x0080, 0x472b: 0x0080, 0x472c: 0x0080, 0x472d: 0x0080, 0x472e: 0x0080, 0x472f: 0x0080, + 0x4730: 0x0080, 0x4731: 0x0080, 0x4732: 0x0080, 0x4733: 0x0080, 0x4734: 0x0080, 0x4735: 0x0080, + 0x4736: 0x0080, 0x4737: 0x0080, 0x4738: 0x0080, 0x4739: 0x0080, 0x473a: 0x0080, 0x473b: 0x0080, + 0x473c: 0x0080, 0x473d: 0x0080, 0x473e: 0x0080, 0x473f: 0x0080, + // Block 0x11d, offset 0x4740 + 0x4740: 0x0080, 0x4741: 0x0080, 0x4742: 0x0080, 0x4743: 0x0080, 0x4744: 0x0080, 0x4745: 0x0080, + 0x4746: 0x0080, 0x4747: 0x0080, 0x4748: 0x0080, 0x4749: 0x0080, 0x474a: 0x0080, 0x474b: 0x0080, + 0x474c: 0x0080, 0x474d: 0x0080, 0x474e: 0x0080, 0x474f: 0x0080, 0x4750: 0x0080, 0x4751: 0x0080, + 0x4752: 0x0080, 0x4753: 0x0080, 0x4754: 0x0080, 0x4755: 0x0080, 0x4756: 0x0080, 0x4757: 0x0080, + 0x4758: 0x0080, 0x4759: 0x0080, 0x475a: 0x0080, 0x475b: 0x0080, 0x475c: 0x0080, 0x475d: 0x0080, + 0x475e: 0x0080, 0x475f: 0x0080, 0x4760: 0x0080, 0x4761: 0x0080, 0x4762: 0x0080, 0x4763: 0x0080, + 0x4764: 0x0080, 0x4765: 0x0080, 0x4768: 0x0080, 0x4769: 0x0080, + 0x476a: 0x0080, 0x476b: 0x0080, 0x476c: 0x0080, 0x476d: 0x0080, 0x476e: 0x0080, 0x476f: 0x0080, + 0x4770: 0x0080, 0x4771: 0x0080, 0x4772: 0x0080, 0x4773: 0x0080, 0x4774: 0x0080, 0x4775: 0x0080, + 0x4776: 0x0080, 0x4777: 0x0080, 0x4778: 0x0080, 0x4779: 0x0080, 0x477a: 0x0080, 0x477b: 0x0080, + 0x477c: 0x0080, 0x477d: 0x0080, 0x477e: 0x0080, 0x477f: 0x0080, + // Block 0x11e, offset 0x4780 + 0x4780: 0x0080, 0x4781: 0x0080, 0x4782: 0x0080, 0x4783: 0x0080, 0x4784: 0x0080, 0x4785: 0x0080, + 0x4786: 0x0080, 0x4787: 0x0080, 0x4788: 0x0080, 0x4789: 0x0080, 0x478a: 0x0080, 0x478b: 0x0080, + 0x478e: 0x0080, 0x478f: 0x0080, 0x4790: 0x0080, 0x4791: 0x0080, + 0x4792: 0x0080, 0x4793: 0x0080, 0x4794: 0x0080, 0x4795: 0x0080, 0x4796: 0x0080, 0x4797: 0x0080, + 0x4798: 0x0080, 0x4799: 0x0080, 0x479a: 0x0080, 0x479b: 0x0080, 0x479c: 0x0080, 0x479d: 0x0080, + 0x479e: 0x0080, 0x479f: 0x0080, 0x47a0: 0x0080, 0x47a1: 0x0080, 0x47a2: 0x0080, 0x47a3: 0x0080, + 0x47a4: 0x0080, 0x47a5: 0x0080, 0x47a6: 0x0080, 0x47a7: 0x0080, 0x47a8: 0x0080, 0x47a9: 0x0080, + 0x47aa: 0x0080, 0x47ab: 0x0080, 0x47ac: 0x0080, 0x47ad: 0x0080, 0x47ae: 0x0080, 0x47af: 0x0080, + 0x47b0: 0x0080, 0x47b1: 0x0080, 0x47b2: 0x0080, 0x47b3: 0x0080, 0x47b4: 0x0080, 0x47b5: 0x0080, + 0x47b6: 0x0080, 0x47b7: 0x0080, 0x47b8: 0x0080, 0x47b9: 0x0080, 0x47ba: 0x0080, 0x47bb: 0x0080, + 0x47bc: 0x0080, 0x47bd: 0x0080, 0x47be: 0x0080, 0x47bf: 0x0080, + // Block 0x11f, offset 0x47c0 + 0x47c0: 0x00c3, 0x47c1: 0x00c3, 0x47c2: 0x00c3, 0x47c3: 0x00c3, 0x47c4: 0x00c3, 0x47c5: 0x00c3, + 0x47c6: 0x00c3, 0x47c7: 0x00c3, 0x47c8: 0x00c3, 0x47c9: 0x00c3, 0x47ca: 0x00c3, 0x47cb: 0x00c3, + 0x47cc: 0x00c3, 0x47cd: 0x00c3, 0x47ce: 0x00c3, 0x47cf: 0x00c3, 0x47d0: 0x00c3, 0x47d1: 0x00c3, + 0x47d2: 0x00c3, 0x47d3: 0x00c3, 0x47d4: 0x00c3, 0x47d5: 0x00c3, 0x47d6: 0x00c3, 0x47d7: 0x00c3, + 0x47d8: 0x00c3, 0x47d9: 0x00c3, 0x47da: 0x00c3, 0x47db: 0x00c3, 0x47dc: 0x00c3, 0x47dd: 0x00c3, + 0x47de: 0x00c3, 0x47df: 0x00c3, 0x47e0: 0x00c3, 0x47e1: 0x00c3, 0x47e2: 0x00c3, 0x47e3: 0x00c3, + 0x47e4: 0x00c3, 0x47e5: 0x00c3, 0x47e6: 0x00c3, 0x47e7: 0x00c3, 0x47e8: 0x00c3, 0x47e9: 0x00c3, + 0x47ea: 0x00c3, 0x47eb: 0x00c3, 0x47ec: 0x00c3, 0x47ed: 0x00c3, 0x47ee: 0x00c3, 0x47ef: 0x00c3, + 0x47f0: 0x00c3, 0x47f1: 0x00c3, 0x47f2: 0x00c3, 0x47f3: 0x00c3, 0x47f4: 0x00c3, 0x47f5: 0x00c3, + 0x47f6: 0x00c3, 0x47f7: 0x0080, 0x47f8: 0x0080, 0x47f9: 0x0080, 0x47fa: 0x0080, 0x47fb: 0x00c3, + 0x47fc: 0x00c3, 0x47fd: 0x00c3, 0x47fe: 0x00c3, 0x47ff: 0x00c3, + // Block 0x120, offset 0x4800 + 0x4800: 0x00c3, 0x4801: 0x00c3, 0x4802: 0x00c3, 0x4803: 0x00c3, 0x4804: 0x00c3, 0x4805: 0x00c3, + 0x4806: 0x00c3, 0x4807: 0x00c3, 0x4808: 0x00c3, 0x4809: 0x00c3, 0x480a: 0x00c3, 0x480b: 0x00c3, + 0x480c: 0x00c3, 0x480d: 0x00c3, 0x480e: 0x00c3, 0x480f: 0x00c3, 0x4810: 0x00c3, 0x4811: 0x00c3, + 0x4812: 0x00c3, 0x4813: 0x00c3, 0x4814: 0x00c3, 0x4815: 0x00c3, 0x4816: 0x00c3, 0x4817: 0x00c3, + 0x4818: 0x00c3, 0x4819: 0x00c3, 0x481a: 0x00c3, 0x481b: 0x00c3, 0x481c: 0x00c3, 0x481d: 0x00c3, + 0x481e: 0x00c3, 0x481f: 0x00c3, 0x4820: 0x00c3, 0x4821: 0x00c3, 0x4822: 0x00c3, 0x4823: 0x00c3, + 0x4824: 0x00c3, 0x4825: 0x00c3, 0x4826: 0x00c3, 0x4827: 0x00c3, 0x4828: 0x00c3, 0x4829: 0x00c3, + 0x482a: 0x00c3, 0x482b: 0x00c3, 0x482c: 0x00c3, 0x482d: 0x0080, 0x482e: 0x0080, 0x482f: 0x0080, + 0x4830: 0x0080, 0x4831: 0x0080, 0x4832: 0x0080, 0x4833: 0x0080, 0x4834: 0x0080, 0x4835: 0x00c3, + 0x4836: 0x0080, 0x4837: 0x0080, 0x4838: 0x0080, 0x4839: 0x0080, 0x483a: 0x0080, 0x483b: 0x0080, + 0x483c: 0x0080, 0x483d: 0x0080, 0x483e: 0x0080, 0x483f: 0x0080, + // Block 0x121, offset 0x4840 + 0x4840: 0x0080, 0x4841: 0x0080, 0x4842: 0x0080, 0x4843: 0x0080, 0x4844: 0x00c3, 0x4845: 0x0080, + 0x4846: 0x0080, 0x4847: 0x0080, 0x4848: 0x0080, 0x4849: 0x0080, 0x484a: 0x0080, 0x484b: 0x0080, + 0x485b: 0x00c3, 0x485c: 0x00c3, 0x485d: 0x00c3, + 0x485e: 0x00c3, 0x485f: 0x00c3, 0x4861: 0x00c3, 0x4862: 0x00c3, 0x4863: 0x00c3, + 0x4864: 0x00c3, 0x4865: 0x00c3, 0x4866: 0x00c3, 0x4867: 0x00c3, 0x4868: 0x00c3, 0x4869: 0x00c3, + 0x486a: 0x00c3, 0x486b: 0x00c3, 0x486c: 0x00c3, 0x486d: 0x00c3, 0x486e: 0x00c3, 0x486f: 0x00c3, + // Block 0x122, offset 0x4880 + 0x4880: 0x00c3, 0x4881: 0x00c3, 0x4882: 0x00c3, 0x4883: 0x00c3, 0x4884: 0x00c3, 0x4885: 0x00c3, + 0x4886: 0x00c3, 0x4888: 0x00c3, 0x4889: 0x00c3, 0x488a: 0x00c3, 0x488b: 0x00c3, + 0x488c: 0x00c3, 0x488d: 0x00c3, 0x488e: 0x00c3, 0x488f: 0x00c3, 0x4890: 0x00c3, 0x4891: 0x00c3, + 0x4892: 0x00c3, 0x4893: 0x00c3, 0x4894: 0x00c3, 0x4895: 0x00c3, 0x4896: 0x00c3, 0x4897: 0x00c3, + 0x4898: 0x00c3, 0x489b: 0x00c3, 0x489c: 0x00c3, 0x489d: 0x00c3, + 0x489e: 0x00c3, 0x489f: 0x00c3, 0x48a0: 0x00c3, 0x48a1: 0x00c3, 0x48a3: 0x00c3, + 0x48a4: 0x00c3, 0x48a6: 0x00c3, 0x48a7: 0x00c3, 0x48a8: 0x00c3, 0x48a9: 0x00c3, + 0x48aa: 0x00c3, + // Block 0x123, offset 0x48c0 + 0x48c0: 0x00c0, 0x48c1: 0x00c0, 0x48c2: 0x00c0, 0x48c3: 0x00c0, 0x48c4: 0x00c0, + 0x48c7: 0x0080, 0x48c8: 0x0080, 0x48c9: 0x0080, 0x48ca: 0x0080, 0x48cb: 0x0080, + 0x48cc: 0x0080, 0x48cd: 0x0080, 0x48ce: 0x0080, 0x48cf: 0x0080, 0x48d0: 0x00c3, 0x48d1: 0x00c3, + 0x48d2: 0x00c3, 0x48d3: 0x00c3, 0x48d4: 0x00c3, 0x48d5: 0x00c3, 0x48d6: 0x00c3, + // Block 0x124, offset 0x4900 + 0x4900: 0x00c2, 0x4901: 0x00c2, 0x4902: 0x00c2, 0x4903: 0x00c2, 0x4904: 0x00c2, 0x4905: 0x00c2, + 0x4906: 0x00c2, 0x4907: 0x00c2, 0x4908: 0x00c2, 0x4909: 0x00c2, 0x490a: 0x00c2, 0x490b: 0x00c2, + 0x490c: 0x00c2, 0x490d: 0x00c2, 0x490e: 0x00c2, 0x490f: 0x00c2, 0x4910: 0x00c2, 0x4911: 0x00c2, + 0x4912: 0x00c2, 0x4913: 0x00c2, 0x4914: 0x00c2, 0x4915: 0x00c2, 0x4916: 0x00c2, 0x4917: 0x00c2, + 0x4918: 0x00c2, 0x4919: 0x00c2, 0x491a: 0x00c2, 0x491b: 0x00c2, 0x491c: 0x00c2, 0x491d: 0x00c2, + 0x491e: 0x00c2, 0x491f: 0x00c2, 0x4920: 0x00c2, 0x4921: 0x00c2, 0x4922: 0x00c2, 0x4923: 0x00c2, + 0x4924: 0x00c2, 0x4925: 0x00c2, 0x4926: 0x00c2, 0x4927: 0x00c2, 0x4928: 0x00c2, 0x4929: 0x00c2, + 0x492a: 0x00c2, 0x492b: 0x00c2, 0x492c: 0x00c2, 0x492d: 0x00c2, 0x492e: 0x00c2, 0x492f: 0x00c2, + 0x4930: 0x00c2, 0x4931: 0x00c2, 0x4932: 0x00c2, 0x4933: 0x00c2, 0x4934: 0x00c2, 0x4935: 0x00c2, + 0x4936: 0x00c2, 0x4937: 0x00c2, 0x4938: 0x00c2, 0x4939: 0x00c2, 0x493a: 0x00c2, 0x493b: 0x00c2, + 0x493c: 0x00c2, 0x493d: 0x00c2, 0x493e: 0x00c2, 0x493f: 0x00c2, + // Block 0x125, offset 0x4940 + 0x4940: 0x00c2, 0x4941: 0x00c2, 0x4942: 0x00c2, 0x4943: 0x00c2, 0x4944: 0x00c3, 0x4945: 0x00c3, + 0x4946: 0x00c3, 0x4947: 0x00c3, 0x4948: 0x00c3, 0x4949: 0x00c3, 0x494a: 0x00c3, + 0x4950: 0x00c0, 0x4951: 0x00c0, + 0x4952: 0x00c0, 0x4953: 0x00c0, 0x4954: 0x00c0, 0x4955: 0x00c0, 0x4956: 0x00c0, 0x4957: 0x00c0, + 0x4958: 0x00c0, 0x4959: 0x00c0, + 0x495e: 0x0080, 0x495f: 0x0080, + // Block 0x126, offset 0x4980 + 0x4980: 0x0080, 0x4981: 0x0080, 0x4982: 0x0080, 0x4983: 0x0080, 0x4985: 0x0080, + 0x4986: 0x0080, 0x4987: 0x0080, 0x4988: 0x0080, 0x4989: 0x0080, 0x498a: 0x0080, 0x498b: 0x0080, + 0x498c: 0x0080, 0x498d: 0x0080, 0x498e: 0x0080, 0x498f: 0x0080, 0x4990: 0x0080, 0x4991: 0x0080, + 0x4992: 0x0080, 0x4993: 0x0080, 0x4994: 0x0080, 0x4995: 0x0080, 0x4996: 0x0080, 0x4997: 0x0080, + 0x4998: 0x0080, 0x4999: 0x0080, 0x499a: 0x0080, 0x499b: 0x0080, 0x499c: 0x0080, 0x499d: 0x0080, + 0x499e: 0x0080, 0x499f: 0x0080, 0x49a1: 0x0080, 0x49a2: 0x0080, + 0x49a4: 0x0080, 0x49a7: 0x0080, 0x49a9: 0x0080, + 0x49aa: 0x0080, 0x49ab: 0x0080, 0x49ac: 0x0080, 0x49ad: 0x0080, 0x49ae: 0x0080, 0x49af: 0x0080, + 0x49b0: 0x0080, 0x49b1: 0x0080, 0x49b2: 0x0080, 0x49b4: 0x0080, 0x49b5: 0x0080, + 0x49b6: 0x0080, 0x49b7: 0x0080, 0x49b9: 0x0080, 0x49bb: 0x0080, + // Block 0x127, offset 0x49c0 + 0x49c2: 0x0080, + 0x49c7: 0x0080, 0x49c9: 0x0080, 0x49cb: 0x0080, + 0x49cd: 0x0080, 0x49ce: 0x0080, 0x49cf: 0x0080, 0x49d1: 0x0080, + 0x49d2: 0x0080, 0x49d4: 0x0080, 0x49d7: 0x0080, + 0x49d9: 0x0080, 0x49db: 0x0080, 0x49dd: 0x0080, + 0x49df: 0x0080, 0x49e1: 0x0080, 0x49e2: 0x0080, + 0x49e4: 0x0080, 0x49e7: 0x0080, 0x49e8: 0x0080, 0x49e9: 0x0080, + 0x49ea: 0x0080, 0x49ec: 0x0080, 0x49ed: 0x0080, 0x49ee: 0x0080, 0x49ef: 0x0080, + 0x49f0: 0x0080, 0x49f1: 0x0080, 0x49f2: 0x0080, 0x49f4: 0x0080, 0x49f5: 0x0080, + 0x49f6: 0x0080, 0x49f7: 0x0080, 0x49f9: 0x0080, 0x49fa: 0x0080, 0x49fb: 0x0080, + 0x49fc: 0x0080, 0x49fe: 0x0080, + // Block 0x128, offset 0x4a00 + 0x4a00: 0x0080, 0x4a01: 0x0080, 0x4a02: 0x0080, 0x4a03: 0x0080, 0x4a04: 0x0080, 0x4a05: 0x0080, + 0x4a06: 0x0080, 0x4a07: 0x0080, 0x4a08: 0x0080, 0x4a09: 0x0080, 0x4a0b: 0x0080, + 0x4a0c: 0x0080, 0x4a0d: 0x0080, 0x4a0e: 0x0080, 0x4a0f: 0x0080, 0x4a10: 0x0080, 0x4a11: 0x0080, + 0x4a12: 0x0080, 0x4a13: 0x0080, 0x4a14: 0x0080, 0x4a15: 0x0080, 0x4a16: 0x0080, 0x4a17: 0x0080, + 0x4a18: 0x0080, 0x4a19: 0x0080, 0x4a1a: 0x0080, 0x4a1b: 0x0080, + 0x4a21: 0x0080, 0x4a22: 0x0080, 0x4a23: 0x0080, + 0x4a25: 0x0080, 0x4a26: 0x0080, 0x4a27: 0x0080, 0x4a28: 0x0080, 0x4a29: 0x0080, + 0x4a2b: 0x0080, 0x4a2c: 0x0080, 0x4a2d: 0x0080, 0x4a2e: 0x0080, 0x4a2f: 0x0080, + 0x4a30: 0x0080, 0x4a31: 0x0080, 0x4a32: 0x0080, 0x4a33: 0x0080, 0x4a34: 0x0080, 0x4a35: 0x0080, + 0x4a36: 0x0080, 0x4a37: 0x0080, 0x4a38: 0x0080, 0x4a39: 0x0080, 0x4a3a: 0x0080, 0x4a3b: 0x0080, + // Block 0x129, offset 0x4a40 + 0x4a70: 0x0080, 0x4a71: 0x0080, + // Block 0x12a, offset 0x4a80 + 0x4a80: 0x0080, 0x4a81: 0x0080, 0x4a82: 0x0080, 0x4a83: 0x0080, 0x4a84: 0x0080, 0x4a85: 0x0080, + 0x4a86: 0x0080, 0x4a87: 0x0080, 0x4a88: 0x0080, 0x4a89: 0x0080, 0x4a8a: 0x0080, 0x4a8b: 0x0080, + 0x4a8c: 0x0080, 0x4a8d: 0x0080, 0x4a8e: 0x0080, 0x4a8f: 0x0080, 0x4a90: 0x0080, 0x4a91: 0x0080, + 0x4a92: 0x0080, 0x4a93: 0x0080, 0x4a94: 0x0080, 0x4a95: 0x0080, 0x4a96: 0x0080, 0x4a97: 0x0080, + 0x4a98: 0x0080, 0x4a99: 0x0080, 0x4a9a: 0x0080, 0x4a9b: 0x0080, 0x4a9c: 0x0080, 0x4a9d: 0x0080, + 0x4a9e: 0x0080, 0x4a9f: 0x0080, 0x4aa0: 0x0080, 0x4aa1: 0x0080, 0x4aa2: 0x0080, 0x4aa3: 0x0080, + 0x4aa4: 0x0080, 0x4aa5: 0x0080, 0x4aa6: 0x0080, 0x4aa7: 0x0080, 0x4aa8: 0x0080, 0x4aa9: 0x0080, + 0x4aaa: 0x0080, 0x4aab: 0x0080, + 0x4ab0: 0x0080, 0x4ab1: 0x0080, 0x4ab2: 0x0080, 0x4ab3: 0x0080, 0x4ab4: 0x0080, 0x4ab5: 0x0080, + 0x4ab6: 0x0080, 0x4ab7: 0x0080, 0x4ab8: 0x0080, 0x4ab9: 0x0080, 0x4aba: 0x0080, 0x4abb: 0x0080, + 0x4abc: 0x0080, 0x4abd: 0x0080, 0x4abe: 0x0080, 0x4abf: 0x0080, + // Block 0x12b, offset 0x4ac0 + 0x4ac0: 0x0080, 0x4ac1: 0x0080, 0x4ac2: 0x0080, 0x4ac3: 0x0080, 0x4ac4: 0x0080, 0x4ac5: 0x0080, + 0x4ac6: 0x0080, 0x4ac7: 0x0080, 0x4ac8: 0x0080, 0x4ac9: 0x0080, 0x4aca: 0x0080, 0x4acb: 0x0080, + 0x4acc: 0x0080, 0x4acd: 0x0080, 0x4ace: 0x0080, 0x4acf: 0x0080, 0x4ad0: 0x0080, 0x4ad1: 0x0080, + 0x4ad2: 0x0080, 0x4ad3: 0x0080, + 0x4ae0: 0x0080, 0x4ae1: 0x0080, 0x4ae2: 0x0080, 0x4ae3: 0x0080, + 0x4ae4: 0x0080, 0x4ae5: 0x0080, 0x4ae6: 0x0080, 0x4ae7: 0x0080, 0x4ae8: 0x0080, 0x4ae9: 0x0080, + 0x4aea: 0x0080, 0x4aeb: 0x0080, 0x4aec: 0x0080, 0x4aed: 0x0080, 0x4aee: 0x0080, + 0x4af1: 0x0080, 0x4af2: 0x0080, 0x4af3: 0x0080, 0x4af4: 0x0080, 0x4af5: 0x0080, + 0x4af6: 0x0080, 0x4af7: 0x0080, 0x4af8: 0x0080, 0x4af9: 0x0080, 0x4afa: 0x0080, 0x4afb: 0x0080, + 0x4afc: 0x0080, 0x4afd: 0x0080, 0x4afe: 0x0080, 0x4aff: 0x0080, + // Block 0x12c, offset 0x4b00 + 0x4b01: 0x0080, 0x4b02: 0x0080, 0x4b03: 0x0080, 0x4b04: 0x0080, 0x4b05: 0x0080, + 0x4b06: 0x0080, 0x4b07: 0x0080, 0x4b08: 0x0080, 0x4b09: 0x0080, 0x4b0a: 0x0080, 0x4b0b: 0x0080, + 0x4b0c: 0x0080, 0x4b0d: 0x0080, 0x4b0e: 0x0080, 0x4b0f: 0x0080, 0x4b11: 0x0080, + 0x4b12: 0x0080, 0x4b13: 0x0080, 0x4b14: 0x0080, 0x4b15: 0x0080, 0x4b16: 0x0080, 0x4b17: 0x0080, + 0x4b18: 0x0080, 0x4b19: 0x0080, 0x4b1a: 0x0080, 0x4b1b: 0x0080, 0x4b1c: 0x0080, 0x4b1d: 0x0080, + 0x4b1e: 0x0080, 0x4b1f: 0x0080, 0x4b20: 0x0080, 0x4b21: 0x0080, 0x4b22: 0x0080, 0x4b23: 0x0080, + 0x4b24: 0x0080, 0x4b25: 0x0080, 0x4b26: 0x0080, 0x4b27: 0x0080, 0x4b28: 0x0080, 0x4b29: 0x0080, + 0x4b2a: 0x0080, 0x4b2b: 0x0080, 0x4b2c: 0x0080, 0x4b2d: 0x0080, 0x4b2e: 0x0080, 0x4b2f: 0x0080, + 0x4b30: 0x0080, 0x4b31: 0x0080, 0x4b32: 0x0080, 0x4b33: 0x0080, 0x4b34: 0x0080, 0x4b35: 0x0080, + // Block 0x12d, offset 0x4b40 + 0x4b40: 0x0080, 0x4b41: 0x0080, 0x4b42: 0x0080, 0x4b43: 0x0080, 0x4b44: 0x0080, 0x4b45: 0x0080, + 0x4b46: 0x0080, 0x4b47: 0x0080, 0x4b48: 0x0080, 0x4b49: 0x0080, 0x4b4a: 0x0080, 0x4b4b: 0x0080, + 0x4b4c: 0x0080, 0x4b50: 0x0080, 0x4b51: 0x0080, + 0x4b52: 0x0080, 0x4b53: 0x0080, 0x4b54: 0x0080, 0x4b55: 0x0080, 0x4b56: 0x0080, 0x4b57: 0x0080, + 0x4b58: 0x0080, 0x4b59: 0x0080, 0x4b5a: 0x0080, 0x4b5b: 0x0080, 0x4b5c: 0x0080, 0x4b5d: 0x0080, + 0x4b5e: 0x0080, 0x4b5f: 0x0080, 0x4b60: 0x0080, 0x4b61: 0x0080, 0x4b62: 0x0080, 0x4b63: 0x0080, + 0x4b64: 0x0080, 0x4b65: 0x0080, 0x4b66: 0x0080, 0x4b67: 0x0080, 0x4b68: 0x0080, 0x4b69: 0x0080, + 0x4b6a: 0x0080, 0x4b6b: 0x0080, 0x4b6c: 0x0080, 0x4b6d: 0x0080, 0x4b6e: 0x0080, + 0x4b70: 0x0080, 0x4b71: 0x0080, 0x4b72: 0x0080, 0x4b73: 0x0080, 0x4b74: 0x0080, 0x4b75: 0x0080, + 0x4b76: 0x0080, 0x4b77: 0x0080, 0x4b78: 0x0080, 0x4b79: 0x0080, 0x4b7a: 0x0080, 0x4b7b: 0x0080, + 0x4b7c: 0x0080, 0x4b7d: 0x0080, 0x4b7e: 0x0080, 0x4b7f: 0x0080, + // Block 0x12e, offset 0x4b80 + 0x4b80: 0x0080, 0x4b81: 0x0080, 0x4b82: 0x0080, 0x4b83: 0x0080, 0x4b84: 0x0080, 0x4b85: 0x0080, + 0x4b86: 0x0080, 0x4b87: 0x0080, 0x4b88: 0x0080, 0x4b89: 0x0080, 0x4b8a: 0x0080, 0x4b8b: 0x0080, + 0x4b8c: 0x0080, 0x4b8d: 0x0080, 0x4b8e: 0x0080, 0x4b8f: 0x0080, 0x4b90: 0x0080, 0x4b91: 0x0080, + 0x4b92: 0x0080, 0x4b93: 0x0080, 0x4b94: 0x0080, 0x4b95: 0x0080, 0x4b96: 0x0080, 0x4b97: 0x0080, + 0x4b98: 0x0080, 0x4b99: 0x0080, 0x4b9a: 0x0080, 0x4b9b: 0x0080, 0x4b9c: 0x0080, 0x4b9d: 0x0080, + 0x4b9e: 0x0080, 0x4b9f: 0x0080, 0x4ba0: 0x0080, 0x4ba1: 0x0080, 0x4ba2: 0x0080, 0x4ba3: 0x0080, + 0x4ba4: 0x0080, 0x4ba5: 0x0080, 0x4ba6: 0x0080, 0x4ba7: 0x0080, 0x4ba8: 0x0080, 0x4ba9: 0x0080, + 0x4baa: 0x0080, 0x4bab: 0x0080, 0x4bac: 0x0080, + // Block 0x12f, offset 0x4bc0 + 0x4be6: 0x0080, 0x4be7: 0x0080, 0x4be8: 0x0080, 0x4be9: 0x0080, + 0x4bea: 0x0080, 0x4beb: 0x0080, 0x4bec: 0x0080, 0x4bed: 0x0080, 0x4bee: 0x0080, 0x4bef: 0x0080, + 0x4bf0: 0x0080, 0x4bf1: 0x0080, 0x4bf2: 0x0080, 0x4bf3: 0x0080, 0x4bf4: 0x0080, 0x4bf5: 0x0080, + 0x4bf6: 0x0080, 0x4bf7: 0x0080, 0x4bf8: 0x0080, 0x4bf9: 0x0080, 0x4bfa: 0x0080, 0x4bfb: 0x0080, + 0x4bfc: 0x0080, 0x4bfd: 0x0080, 0x4bfe: 0x0080, 0x4bff: 0x0080, + // Block 0x130, offset 0x4c00 + 0x4c00: 0x008c, 0x4c01: 0x0080, 0x4c02: 0x0080, + 0x4c10: 0x0080, 0x4c11: 0x0080, + 0x4c12: 0x0080, 0x4c13: 0x0080, 0x4c14: 0x0080, 0x4c15: 0x0080, 0x4c16: 0x0080, 0x4c17: 0x0080, + 0x4c18: 0x0080, 0x4c19: 0x0080, 0x4c1a: 0x0080, 0x4c1b: 0x0080, 0x4c1c: 0x0080, 0x4c1d: 0x0080, + 0x4c1e: 0x0080, 0x4c1f: 0x0080, 0x4c20: 0x0080, 0x4c21: 0x0080, 0x4c22: 0x0080, 0x4c23: 0x0080, + 0x4c24: 0x0080, 0x4c25: 0x0080, 0x4c26: 0x0080, 0x4c27: 0x0080, 0x4c28: 0x0080, 0x4c29: 0x0080, + 0x4c2a: 0x0080, 0x4c2b: 0x0080, 0x4c2c: 0x0080, 0x4c2d: 0x0080, 0x4c2e: 0x0080, 0x4c2f: 0x0080, + 0x4c30: 0x0080, 0x4c31: 0x0080, 0x4c32: 0x0080, 0x4c33: 0x0080, 0x4c34: 0x0080, 0x4c35: 0x0080, + 0x4c36: 0x0080, 0x4c37: 0x0080, 0x4c38: 0x0080, 0x4c39: 0x0080, 0x4c3a: 0x0080, 0x4c3b: 0x0080, + // Block 0x131, offset 0x4c40 + 0x4c40: 0x0080, 0x4c41: 0x0080, 0x4c42: 0x0080, 0x4c43: 0x0080, 0x4c44: 0x0080, 0x4c45: 0x0080, + 0x4c46: 0x0080, 0x4c47: 0x0080, 0x4c48: 0x0080, + 0x4c50: 0x0080, 0x4c51: 0x0080, + // Block 0x132, offset 0x4c80 + 0x4c80: 0x0080, 0x4c81: 0x0080, 0x4c82: 0x0080, 0x4c83: 0x0080, 0x4c84: 0x0080, 0x4c85: 0x0080, + 0x4c86: 0x0080, 0x4c87: 0x0080, 0x4c88: 0x0080, 0x4c89: 0x0080, 0x4c8a: 0x0080, 0x4c8b: 0x0080, + 0x4c8c: 0x0080, 0x4c8d: 0x0080, 0x4c8e: 0x0080, 0x4c8f: 0x0080, 0x4c90: 0x0080, 0x4c91: 0x0080, + 0x4c92: 0x0080, + 0x4ca0: 0x0080, 0x4ca1: 0x0080, 0x4ca2: 0x0080, 0x4ca3: 0x0080, + 0x4ca4: 0x0080, 0x4ca5: 0x0080, 0x4ca6: 0x0080, 0x4ca7: 0x0080, 0x4ca8: 0x0080, 0x4ca9: 0x0080, + 0x4caa: 0x0080, 0x4cab: 0x0080, 0x4cac: 0x0080, + 0x4cb0: 0x0080, 0x4cb1: 0x0080, 0x4cb2: 0x0080, 0x4cb3: 0x0080, 0x4cb4: 0x0080, 0x4cb5: 0x0080, + 0x4cb6: 0x0080, + // Block 0x133, offset 0x4cc0 + 0x4cc0: 0x0080, 0x4cc1: 0x0080, 0x4cc2: 0x0080, 0x4cc3: 0x0080, 0x4cc4: 0x0080, 0x4cc5: 0x0080, + 0x4cc6: 0x0080, 0x4cc7: 0x0080, 0x4cc8: 0x0080, 0x4cc9: 0x0080, 0x4cca: 0x0080, 0x4ccb: 0x0080, + 0x4ccc: 0x0080, 0x4ccd: 0x0080, 0x4cce: 0x0080, 0x4ccf: 0x0080, 0x4cd0: 0x0080, 0x4cd1: 0x0080, + 0x4cd2: 0x0080, 0x4cd3: 0x0080, 0x4cd4: 0x0080, 0x4cd5: 0x0080, 0x4cd6: 0x0080, 0x4cd7: 0x0080, + 0x4cd8: 0x0080, 0x4cd9: 0x0080, 0x4cda: 0x0080, 0x4cdb: 0x0080, 0x4cdc: 0x0080, 0x4cdd: 0x0080, + 0x4cde: 0x0080, 0x4cdf: 0x0080, 0x4ce0: 0x0080, 0x4ce1: 0x0080, 0x4ce2: 0x0080, 0x4ce3: 0x0080, + 0x4ce4: 0x0080, 0x4ce5: 0x0080, 0x4ce6: 0x0080, 0x4ce7: 0x0080, 0x4ce8: 0x0080, 0x4ce9: 0x0080, + 0x4cea: 0x0080, 0x4ceb: 0x0080, 0x4cec: 0x0080, 0x4ced: 0x0080, 0x4cee: 0x0080, 0x4cef: 0x0080, + 0x4cf0: 0x0080, 0x4cf1: 0x0080, 0x4cf2: 0x0080, 0x4cf3: 0x0080, + // Block 0x134, offset 0x4d00 + 0x4d00: 0x0080, 0x4d01: 0x0080, 0x4d02: 0x0080, 0x4d03: 0x0080, 0x4d04: 0x0080, 0x4d05: 0x0080, + 0x4d06: 0x0080, 0x4d07: 0x0080, 0x4d08: 0x0080, 0x4d09: 0x0080, 0x4d0a: 0x0080, 0x4d0b: 0x0080, + 0x4d0c: 0x0080, 0x4d0d: 0x0080, 0x4d0e: 0x0080, 0x4d0f: 0x0080, 0x4d10: 0x0080, 0x4d11: 0x0080, + 0x4d12: 0x0080, 0x4d13: 0x0080, 0x4d14: 0x0080, + // Block 0x135, offset 0x4d40 + 0x4d40: 0x0080, 0x4d41: 0x0080, 0x4d42: 0x0080, 0x4d43: 0x0080, 0x4d44: 0x0080, 0x4d45: 0x0080, + 0x4d46: 0x0080, 0x4d47: 0x0080, 0x4d48: 0x0080, 0x4d49: 0x0080, 0x4d4a: 0x0080, 0x4d4b: 0x0080, + 0x4d50: 0x0080, 0x4d51: 0x0080, + 0x4d52: 0x0080, 0x4d53: 0x0080, 0x4d54: 0x0080, 0x4d55: 0x0080, 0x4d56: 0x0080, 0x4d57: 0x0080, + 0x4d58: 0x0080, 0x4d59: 0x0080, 0x4d5a: 0x0080, 0x4d5b: 0x0080, 0x4d5c: 0x0080, 0x4d5d: 0x0080, + 0x4d5e: 0x0080, 0x4d5f: 0x0080, 0x4d60: 0x0080, 0x4d61: 0x0080, 0x4d62: 0x0080, 0x4d63: 0x0080, + 0x4d64: 0x0080, 0x4d65: 0x0080, 0x4d66: 0x0080, 0x4d67: 0x0080, 0x4d68: 0x0080, 0x4d69: 0x0080, + 0x4d6a: 0x0080, 0x4d6b: 0x0080, 0x4d6c: 0x0080, 0x4d6d: 0x0080, 0x4d6e: 0x0080, 0x4d6f: 0x0080, + 0x4d70: 0x0080, 0x4d71: 0x0080, 0x4d72: 0x0080, 0x4d73: 0x0080, 0x4d74: 0x0080, 0x4d75: 0x0080, + 0x4d76: 0x0080, 0x4d77: 0x0080, 0x4d78: 0x0080, 0x4d79: 0x0080, 0x4d7a: 0x0080, 0x4d7b: 0x0080, + 0x4d7c: 0x0080, 0x4d7d: 0x0080, 0x4d7e: 0x0080, 0x4d7f: 0x0080, + // Block 0x136, offset 0x4d80 + 0x4d80: 0x0080, 0x4d81: 0x0080, 0x4d82: 0x0080, 0x4d83: 0x0080, 0x4d84: 0x0080, 0x4d85: 0x0080, + 0x4d86: 0x0080, 0x4d87: 0x0080, + 0x4d90: 0x0080, 0x4d91: 0x0080, + 0x4d92: 0x0080, 0x4d93: 0x0080, 0x4d94: 0x0080, 0x4d95: 0x0080, 0x4d96: 0x0080, 0x4d97: 0x0080, + 0x4d98: 0x0080, 0x4d99: 0x0080, + 0x4da0: 0x0080, 0x4da1: 0x0080, 0x4da2: 0x0080, 0x4da3: 0x0080, + 0x4da4: 0x0080, 0x4da5: 0x0080, 0x4da6: 0x0080, 0x4da7: 0x0080, 0x4da8: 0x0080, 0x4da9: 0x0080, + 0x4daa: 0x0080, 0x4dab: 0x0080, 0x4dac: 0x0080, 0x4dad: 0x0080, 0x4dae: 0x0080, 0x4daf: 0x0080, + 0x4db0: 0x0080, 0x4db1: 0x0080, 0x4db2: 0x0080, 0x4db3: 0x0080, 0x4db4: 0x0080, 0x4db5: 0x0080, + 0x4db6: 0x0080, 0x4db7: 0x0080, 0x4db8: 0x0080, 0x4db9: 0x0080, 0x4dba: 0x0080, 0x4dbb: 0x0080, + 0x4dbc: 0x0080, 0x4dbd: 0x0080, 0x4dbe: 0x0080, 0x4dbf: 0x0080, + // Block 0x137, offset 0x4dc0 + 0x4dc0: 0x0080, 0x4dc1: 0x0080, 0x4dc2: 0x0080, 0x4dc3: 0x0080, 0x4dc4: 0x0080, 0x4dc5: 0x0080, + 0x4dc6: 0x0080, 0x4dc7: 0x0080, + 0x4dd0: 0x0080, 0x4dd1: 0x0080, + 0x4dd2: 0x0080, 0x4dd3: 0x0080, 0x4dd4: 0x0080, 0x4dd5: 0x0080, 0x4dd6: 0x0080, 0x4dd7: 0x0080, + 0x4dd8: 0x0080, 0x4dd9: 0x0080, 0x4dda: 0x0080, 0x4ddb: 0x0080, 0x4ddc: 0x0080, 0x4ddd: 0x0080, + 0x4dde: 0x0080, 0x4ddf: 0x0080, 0x4de0: 0x0080, 0x4de1: 0x0080, 0x4de2: 0x0080, 0x4de3: 0x0080, + 0x4de4: 0x0080, 0x4de5: 0x0080, 0x4de6: 0x0080, 0x4de7: 0x0080, 0x4de8: 0x0080, 0x4de9: 0x0080, + 0x4dea: 0x0080, 0x4deb: 0x0080, 0x4dec: 0x0080, 0x4ded: 0x0080, + // Block 0x138, offset 0x4e00 + 0x4e10: 0x0080, 0x4e11: 0x0080, + 0x4e12: 0x0080, 0x4e13: 0x0080, 0x4e14: 0x0080, 0x4e15: 0x0080, 0x4e16: 0x0080, 0x4e17: 0x0080, + 0x4e18: 0x0080, 0x4e19: 0x0080, 0x4e1a: 0x0080, 0x4e1b: 0x0080, 0x4e1c: 0x0080, 0x4e1d: 0x0080, + 0x4e1e: 0x0080, 0x4e20: 0x0080, 0x4e21: 0x0080, 0x4e22: 0x0080, 0x4e23: 0x0080, + 0x4e24: 0x0080, 0x4e25: 0x0080, 0x4e26: 0x0080, 0x4e27: 0x0080, + 0x4e30: 0x0080, 0x4e33: 0x0080, 0x4e34: 0x0080, 0x4e35: 0x0080, + 0x4e36: 0x0080, 0x4e37: 0x0080, 0x4e38: 0x0080, 0x4e39: 0x0080, 0x4e3a: 0x0080, 0x4e3b: 0x0080, + 0x4e3c: 0x0080, 0x4e3d: 0x0080, 0x4e3e: 0x0080, + // Block 0x139, offset 0x4e40 + 0x4e40: 0x0080, 0x4e41: 0x0080, 0x4e42: 0x0080, 0x4e43: 0x0080, 0x4e44: 0x0080, 0x4e45: 0x0080, + 0x4e46: 0x0080, 0x4e47: 0x0080, 0x4e48: 0x0080, 0x4e49: 0x0080, 0x4e4a: 0x0080, 0x4e4b: 0x0080, + 0x4e50: 0x0080, 0x4e51: 0x0080, + 0x4e52: 0x0080, 0x4e53: 0x0080, 0x4e54: 0x0080, 0x4e55: 0x0080, 0x4e56: 0x0080, 0x4e57: 0x0080, + 0x4e58: 0x0080, 0x4e59: 0x0080, 0x4e5a: 0x0080, 0x4e5b: 0x0080, 0x4e5c: 0x0080, 0x4e5d: 0x0080, + 0x4e5e: 0x0080, + // Block 0x13a, offset 0x4e80 + 0x4e80: 0x0080, 0x4e81: 0x0080, 0x4e82: 0x0080, 0x4e83: 0x0080, 0x4e84: 0x0080, 0x4e85: 0x0080, + 0x4e86: 0x0080, 0x4e87: 0x0080, 0x4e88: 0x0080, 0x4e89: 0x0080, 0x4e8a: 0x0080, 0x4e8b: 0x0080, + 0x4e8c: 0x0080, 0x4e8d: 0x0080, 0x4e8e: 0x0080, 0x4e8f: 0x0080, 0x4e90: 0x0080, 0x4e91: 0x0080, + // Block 0x13b, offset 0x4ec0 + 0x4ec0: 0x0080, + // Block 0x13c, offset 0x4f00 + 0x4f00: 0x00cc, 0x4f01: 0x00cc, 0x4f02: 0x00cc, 0x4f03: 0x00cc, 0x4f04: 0x00cc, 0x4f05: 0x00cc, + 0x4f06: 0x00cc, 0x4f07: 0x00cc, 0x4f08: 0x00cc, 0x4f09: 0x00cc, 0x4f0a: 0x00cc, 0x4f0b: 0x00cc, + 0x4f0c: 0x00cc, 0x4f0d: 0x00cc, 0x4f0e: 0x00cc, 0x4f0f: 0x00cc, 0x4f10: 0x00cc, 0x4f11: 0x00cc, + 0x4f12: 0x00cc, 0x4f13: 0x00cc, 0x4f14: 0x00cc, 0x4f15: 0x00cc, 0x4f16: 0x00cc, + // Block 0x13d, offset 0x4f40 + 0x4f40: 0x00cc, 0x4f41: 0x00cc, 0x4f42: 0x00cc, 0x4f43: 0x00cc, 0x4f44: 0x00cc, 0x4f45: 0x00cc, + 0x4f46: 0x00cc, 0x4f47: 0x00cc, 0x4f48: 0x00cc, 0x4f49: 0x00cc, 0x4f4a: 0x00cc, 0x4f4b: 0x00cc, + 0x4f4c: 0x00cc, 0x4f4d: 0x00cc, 0x4f4e: 0x00cc, 0x4f4f: 0x00cc, 0x4f50: 0x00cc, 0x4f51: 0x00cc, + 0x4f52: 0x00cc, 0x4f53: 0x00cc, 0x4f54: 0x00cc, 0x4f55: 0x00cc, 0x4f56: 0x00cc, 0x4f57: 0x00cc, + 0x4f58: 0x00cc, 0x4f59: 0x00cc, 0x4f5a: 0x00cc, 0x4f5b: 0x00cc, 0x4f5c: 0x00cc, 0x4f5d: 0x00cc, + 0x4f5e: 0x00cc, 0x4f5f: 0x00cc, 0x4f60: 0x00cc, 0x4f61: 0x00cc, 0x4f62: 0x00cc, 0x4f63: 0x00cc, + 0x4f64: 0x00cc, 0x4f65: 0x00cc, 0x4f66: 0x00cc, 0x4f67: 0x00cc, 0x4f68: 0x00cc, 0x4f69: 0x00cc, + 0x4f6a: 0x00cc, 0x4f6b: 0x00cc, 0x4f6c: 0x00cc, 0x4f6d: 0x00cc, 0x4f6e: 0x00cc, 0x4f6f: 0x00cc, + 0x4f70: 0x00cc, 0x4f71: 0x00cc, 0x4f72: 0x00cc, 0x4f73: 0x00cc, 0x4f74: 0x00cc, + // Block 0x13e, offset 0x4f80 + 0x4f80: 0x00cc, 0x4f81: 0x00cc, 0x4f82: 0x00cc, 0x4f83: 0x00cc, 0x4f84: 0x00cc, 0x4f85: 0x00cc, + 0x4f86: 0x00cc, 0x4f87: 0x00cc, 0x4f88: 0x00cc, 0x4f89: 0x00cc, 0x4f8a: 0x00cc, 0x4f8b: 0x00cc, + 0x4f8c: 0x00cc, 0x4f8d: 0x00cc, 0x4f8e: 0x00cc, 0x4f8f: 0x00cc, 0x4f90: 0x00cc, 0x4f91: 0x00cc, + 0x4f92: 0x00cc, 0x4f93: 0x00cc, 0x4f94: 0x00cc, 0x4f95: 0x00cc, 0x4f96: 0x00cc, 0x4f97: 0x00cc, + 0x4f98: 0x00cc, 0x4f99: 0x00cc, 0x4f9a: 0x00cc, 0x4f9b: 0x00cc, 0x4f9c: 0x00cc, 0x4f9d: 0x00cc, + 0x4fa0: 0x00cc, 0x4fa1: 0x00cc, 0x4fa2: 0x00cc, 0x4fa3: 0x00cc, + 0x4fa4: 0x00cc, 0x4fa5: 0x00cc, 0x4fa6: 0x00cc, 0x4fa7: 0x00cc, 0x4fa8: 0x00cc, 0x4fa9: 0x00cc, + 0x4faa: 0x00cc, 0x4fab: 0x00cc, 0x4fac: 0x00cc, 0x4fad: 0x00cc, 0x4fae: 0x00cc, 0x4faf: 0x00cc, + 0x4fb0: 0x00cc, 0x4fb1: 0x00cc, 0x4fb2: 0x00cc, 0x4fb3: 0x00cc, 0x4fb4: 0x00cc, 0x4fb5: 0x00cc, + 0x4fb6: 0x00cc, 0x4fb7: 0x00cc, 0x4fb8: 0x00cc, 0x4fb9: 0x00cc, 0x4fba: 0x00cc, 0x4fbb: 0x00cc, + 0x4fbc: 0x00cc, 0x4fbd: 0x00cc, 0x4fbe: 0x00cc, 0x4fbf: 0x00cc, + // Block 0x13f, offset 0x4fc0 + 0x4fc0: 0x00cc, 0x4fc1: 0x00cc, 0x4fc2: 0x00cc, 0x4fc3: 0x00cc, 0x4fc4: 0x00cc, 0x4fc5: 0x00cc, + 0x4fc6: 0x00cc, 0x4fc7: 0x00cc, 0x4fc8: 0x00cc, 0x4fc9: 0x00cc, 0x4fca: 0x00cc, 0x4fcb: 0x00cc, + 0x4fcc: 0x00cc, 0x4fcd: 0x00cc, 0x4fce: 0x00cc, 0x4fcf: 0x00cc, 0x4fd0: 0x00cc, 0x4fd1: 0x00cc, + 0x4fd2: 0x00cc, 0x4fd3: 0x00cc, 0x4fd4: 0x00cc, 0x4fd5: 0x00cc, 0x4fd6: 0x00cc, 0x4fd7: 0x00cc, + 0x4fd8: 0x00cc, 0x4fd9: 0x00cc, 0x4fda: 0x00cc, 0x4fdb: 0x00cc, 0x4fdc: 0x00cc, 0x4fdd: 0x00cc, + 0x4fde: 0x00cc, 0x4fdf: 0x00cc, 0x4fe0: 0x00cc, 0x4fe1: 0x00cc, + // Block 0x140, offset 0x5000 + 0x5000: 0x008c, 0x5001: 0x008c, 0x5002: 0x008c, 0x5003: 0x008c, 0x5004: 0x008c, 0x5005: 0x008c, + 0x5006: 0x008c, 0x5007: 0x008c, 0x5008: 0x008c, 0x5009: 0x008c, 0x500a: 0x008c, 0x500b: 0x008c, + 0x500c: 0x008c, 0x500d: 0x008c, 0x500e: 0x008c, 0x500f: 0x008c, 0x5010: 0x008c, 0x5011: 0x008c, + 0x5012: 0x008c, 0x5013: 0x008c, 0x5014: 0x008c, 0x5015: 0x008c, 0x5016: 0x008c, 0x5017: 0x008c, + 0x5018: 0x008c, 0x5019: 0x008c, 0x501a: 0x008c, 0x501b: 0x008c, 0x501c: 0x008c, 0x501d: 0x008c, + // Block 0x141, offset 0x5040 + 0x5041: 0x0040, + 0x5060: 0x0040, 0x5061: 0x0040, 0x5062: 0x0040, 0x5063: 0x0040, + 0x5064: 0x0040, 0x5065: 0x0040, 0x5066: 0x0040, 0x5067: 0x0040, 0x5068: 0x0040, 0x5069: 0x0040, + 0x506a: 0x0040, 0x506b: 0x0040, 0x506c: 0x0040, 0x506d: 0x0040, 0x506e: 0x0040, 0x506f: 0x0040, + 0x5070: 0x0040, 0x5071: 0x0040, 0x5072: 0x0040, 0x5073: 0x0040, 0x5074: 0x0040, 0x5075: 0x0040, + 0x5076: 0x0040, 0x5077: 0x0040, 0x5078: 0x0040, 0x5079: 0x0040, 0x507a: 0x0040, 0x507b: 0x0040, + 0x507c: 0x0040, 0x507d: 0x0040, 0x507e: 0x0040, 0x507f: 0x0040, + // Block 0x142, offset 0x5080 + 0x5080: 0x0040, 0x5081: 0x0040, 0x5082: 0x0040, 0x5083: 0x0040, 0x5084: 0x0040, 0x5085: 0x0040, + 0x5086: 0x0040, 0x5087: 0x0040, 0x5088: 0x0040, 0x5089: 0x0040, 0x508a: 0x0040, 0x508b: 0x0040, + 0x508c: 0x0040, 0x508d: 0x0040, 0x508e: 0x0040, 0x508f: 0x0040, 0x5090: 0x0040, 0x5091: 0x0040, + 0x5092: 0x0040, 0x5093: 0x0040, 0x5094: 0x0040, 0x5095: 0x0040, 0x5096: 0x0040, 0x5097: 0x0040, + 0x5098: 0x0040, 0x5099: 0x0040, 0x509a: 0x0040, 0x509b: 0x0040, 0x509c: 0x0040, 0x509d: 0x0040, + 0x509e: 0x0040, 0x509f: 0x0040, 0x50a0: 0x0040, 0x50a1: 0x0040, 0x50a2: 0x0040, 0x50a3: 0x0040, + 0x50a4: 0x0040, 0x50a5: 0x0040, 0x50a6: 0x0040, 0x50a7: 0x0040, 0x50a8: 0x0040, 0x50a9: 0x0040, + 0x50aa: 0x0040, 0x50ab: 0x0040, 0x50ac: 0x0040, 0x50ad: 0x0040, 0x50ae: 0x0040, 0x50af: 0x0040, + // Block 0x143, offset 0x50c0 + 0x50c0: 0x0040, 0x50c1: 0x0040, 0x50c2: 0x0040, 0x50c3: 0x0040, 0x50c4: 0x0040, 0x50c5: 0x0040, + 0x50c6: 0x0040, 0x50c7: 0x0040, 0x50c8: 0x0040, 0x50c9: 0x0040, 0x50ca: 0x0040, 0x50cb: 0x0040, + 0x50cc: 0x0040, 0x50cd: 0x0040, 0x50ce: 0x0040, 0x50cf: 0x0040, 0x50d0: 0x0040, 0x50d1: 0x0040, + 0x50d2: 0x0040, 0x50d3: 0x0040, 0x50d4: 0x0040, 0x50d5: 0x0040, 0x50d6: 0x0040, 0x50d7: 0x0040, + 0x50d8: 0x0040, 0x50d9: 0x0040, 0x50da: 0x0040, 0x50db: 0x0040, 0x50dc: 0x0040, 0x50dd: 0x0040, + 0x50de: 0x0040, 0x50df: 0x0040, 0x50e0: 0x0040, 0x50e1: 0x0040, 0x50e2: 0x0040, 0x50e3: 0x0040, + 0x50e4: 0x0040, 0x50e5: 0x0040, 0x50e6: 0x0040, 0x50e7: 0x0040, 0x50e8: 0x0040, 0x50e9: 0x0040, + 0x50ea: 0x0040, 0x50eb: 0x0040, 0x50ec: 0x0040, 0x50ed: 0x0040, 0x50ee: 0x0040, 0x50ef: 0x0040, + 0x50f0: 0x0040, 0x50f1: 0x0040, 0x50f2: 0x0040, 0x50f3: 0x0040, 0x50f4: 0x0040, 0x50f5: 0x0040, + 0x50f6: 0x0040, 0x50f7: 0x0040, 0x50f8: 0x0040, 0x50f9: 0x0040, 0x50fa: 0x0040, 0x50fb: 0x0040, + 0x50fc: 0x0040, 0x50fd: 0x0040, +} + +// derivedPropertiesIndex: 36 blocks, 2304 entries, 4608 bytes +// Block 0 is the zero block. +var derivedPropertiesIndex = [2304]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, 0xc4: 0x03, 0xc5: 0x04, 0xc6: 0x05, 0xc7: 0x06, + 0xc8: 0x05, 0xc9: 0x05, 0xca: 0x07, 0xcb: 0x08, 0xcc: 0x09, 0xcd: 0x0a, 0xce: 0x0b, 0xcf: 0x0c, + 0xd0: 0x05, 0xd1: 0x05, 0xd2: 0x0d, 0xd3: 0x05, 0xd4: 0x0e, 0xd5: 0x0f, 0xd6: 0x10, 0xd7: 0x11, + 0xd8: 0x12, 0xd9: 0x13, 0xda: 0x14, 0xdb: 0x15, 0xdc: 0x16, 0xdd: 0x17, 0xde: 0x18, 0xdf: 0x19, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, 0xe5: 0x07, 0xe6: 0x07, 0xe7: 0x07, + 0xe8: 0x07, 0xe9: 0x08, 0xea: 0x09, 0xeb: 0x0a, 0xec: 0x0a, 0xed: 0x0b, 0xee: 0x0c, 0xef: 0x0d, + 0xf0: 0x1d, 0xf3: 0x20, 0xf4: 0x21, + // Block 0x4, offset 0x100 + 0x120: 0x1a, 0x121: 0x1b, 0x122: 0x1c, 0x123: 0x1d, 0x124: 0x1e, 0x125: 0x1f, 0x126: 0x20, 0x127: 0x21, + 0x128: 0x22, 0x129: 0x23, 0x12a: 0x24, 0x12b: 0x25, 0x12c: 0x26, 0x12d: 0x27, 0x12e: 0x28, 0x12f: 0x29, + 0x130: 0x2a, 0x131: 0x2b, 0x132: 0x2c, 0x133: 0x2d, 0x134: 0x2e, 0x135: 0x2f, 0x136: 0x30, 0x137: 0x31, + 0x138: 0x32, 0x139: 0x33, 0x13a: 0x34, 0x13b: 0x35, 0x13c: 0x36, 0x13d: 0x37, 0x13e: 0x38, 0x13f: 0x39, + // Block 0x5, offset 0x140 + 0x140: 0x3a, 0x141: 0x3b, 0x142: 0x3c, 0x143: 0x3d, 0x144: 0x3e, 0x145: 0x3e, 0x146: 0x3e, 0x147: 0x3e, + 0x148: 0x05, 0x149: 0x3f, 0x14a: 0x40, 0x14b: 0x41, 0x14c: 0x42, 0x14d: 0x43, 0x14e: 0x44, 0x14f: 0x45, + 0x150: 0x46, 0x151: 0x05, 0x152: 0x05, 0x153: 0x05, 0x154: 0x05, 0x155: 0x05, 0x156: 0x05, 0x157: 0x05, + 0x158: 0x05, 0x159: 0x47, 0x15a: 0x48, 0x15b: 0x49, 0x15c: 0x4a, 0x15d: 0x4b, 0x15e: 0x4c, 0x15f: 0x4d, + 0x160: 0x4e, 0x161: 0x4f, 0x162: 0x50, 0x163: 0x51, 0x164: 0x52, 0x165: 0x53, 0x166: 0x54, 0x167: 0x55, + 0x168: 0x56, 0x169: 0x57, 0x16a: 0x58, 0x16c: 0x59, 0x16d: 0x5a, 0x16e: 0x5b, 0x16f: 0x5c, + 0x170: 0x5d, 0x171: 0x5e, 0x172: 0x5f, 0x173: 0x60, 0x174: 0x61, 0x175: 0x62, 0x176: 0x63, 0x177: 0x64, + 0x178: 0x05, 0x179: 0x05, 0x17a: 0x65, 0x17b: 0x05, 0x17c: 0x66, 0x17d: 0x67, 0x17e: 0x68, 0x17f: 0x69, + // Block 0x6, offset 0x180 + 0x180: 0x6a, 0x181: 0x6b, 0x182: 0x6c, 0x183: 0x6d, 0x184: 0x6e, 0x185: 0x6f, 0x186: 0x70, 0x187: 0x71, + 0x188: 0x71, 0x189: 0x71, 0x18a: 0x71, 0x18b: 0x71, 0x18c: 0x71, 0x18d: 0x71, 0x18e: 0x71, 0x18f: 0x72, + 0x190: 0x73, 0x191: 0x74, 0x192: 0x71, 0x193: 0x71, 0x194: 0x71, 0x195: 0x71, 0x196: 0x71, 0x197: 0x71, + 0x198: 0x71, 0x199: 0x71, 0x19a: 0x71, 0x19b: 0x71, 0x19c: 0x71, 0x19d: 0x71, 0x19e: 0x71, 0x19f: 0x71, + 0x1a0: 0x71, 0x1a1: 0x71, 0x1a2: 0x71, 0x1a3: 0x71, 0x1a4: 0x71, 0x1a5: 0x71, 0x1a6: 0x71, 0x1a7: 0x71, + 0x1a8: 0x71, 0x1a9: 0x71, 0x1aa: 0x71, 0x1ab: 0x71, 0x1ac: 0x71, 0x1ad: 0x75, 0x1ae: 0x76, 0x1af: 0x77, + 0x1b0: 0x78, 0x1b1: 0x79, 0x1b2: 0x05, 0x1b3: 0x7a, 0x1b4: 0x7b, 0x1b5: 0x7c, 0x1b6: 0x7d, 0x1b7: 0x7e, + 0x1b8: 0x7f, 0x1b9: 0x80, 0x1ba: 0x81, 0x1bb: 0x82, 0x1bc: 0x83, 0x1bd: 0x83, 0x1be: 0x83, 0x1bf: 0x84, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x85, 0x1c1: 0x86, 0x1c2: 0x87, 0x1c3: 0x88, 0x1c4: 0x89, 0x1c5: 0x8a, 0x1c6: 0x8b, 0x1c7: 0x8c, + 0x1c8: 0x8d, 0x1c9: 0x71, 0x1ca: 0x71, 0x1cb: 0x8e, 0x1cc: 0x83, 0x1cd: 0x8f, 0x1ce: 0x71, 0x1cf: 0x71, + 0x1d0: 0x90, 0x1d1: 0x90, 0x1d2: 0x90, 0x1d3: 0x90, 0x1d4: 0x90, 0x1d5: 0x90, 0x1d6: 0x90, 0x1d7: 0x90, + 0x1d8: 0x90, 0x1d9: 0x90, 0x1da: 0x90, 0x1db: 0x90, 0x1dc: 0x90, 0x1dd: 0x90, 0x1de: 0x90, 0x1df: 0x90, + 0x1e0: 0x90, 0x1e1: 0x90, 0x1e2: 0x90, 0x1e3: 0x90, 0x1e4: 0x90, 0x1e5: 0x90, 0x1e6: 0x90, 0x1e7: 0x90, + 0x1e8: 0x90, 0x1e9: 0x90, 0x1ea: 0x90, 0x1eb: 0x90, 0x1ec: 0x90, 0x1ed: 0x90, 0x1ee: 0x90, 0x1ef: 0x90, + 0x1f0: 0x90, 0x1f1: 0x90, 0x1f2: 0x90, 0x1f3: 0x90, 0x1f4: 0x90, 0x1f5: 0x90, 0x1f6: 0x90, 0x1f7: 0x90, + 0x1f8: 0x90, 0x1f9: 0x90, 0x1fa: 0x90, 0x1fb: 0x90, 0x1fc: 0x90, 0x1fd: 0x90, 0x1fe: 0x90, 0x1ff: 0x90, + // Block 0x8, offset 0x200 + 0x200: 0x90, 0x201: 0x90, 0x202: 0x90, 0x203: 0x90, 0x204: 0x90, 0x205: 0x90, 0x206: 0x90, 0x207: 0x90, + 0x208: 0x90, 0x209: 0x90, 0x20a: 0x90, 0x20b: 0x90, 0x20c: 0x90, 0x20d: 0x90, 0x20e: 0x90, 0x20f: 0x90, + 0x210: 0x90, 0x211: 0x90, 0x212: 0x90, 0x213: 0x90, 0x214: 0x90, 0x215: 0x90, 0x216: 0x90, 0x217: 0x90, + 0x218: 0x90, 0x219: 0x90, 0x21a: 0x90, 0x21b: 0x90, 0x21c: 0x90, 0x21d: 0x90, 0x21e: 0x90, 0x21f: 0x90, + 0x220: 0x90, 0x221: 0x90, 0x222: 0x90, 0x223: 0x90, 0x224: 0x90, 0x225: 0x90, 0x226: 0x90, 0x227: 0x90, + 0x228: 0x90, 0x229: 0x90, 0x22a: 0x90, 0x22b: 0x90, 0x22c: 0x90, 0x22d: 0x90, 0x22e: 0x90, 0x22f: 0x90, + 0x230: 0x90, 0x231: 0x90, 0x232: 0x90, 0x233: 0x90, 0x234: 0x90, 0x235: 0x90, 0x236: 0x91, 0x237: 0x71, + 0x238: 0x90, 0x239: 0x90, 0x23a: 0x90, 0x23b: 0x90, 0x23c: 0x90, 0x23d: 0x90, 0x23e: 0x90, 0x23f: 0x90, + // Block 0x9, offset 0x240 + 0x240: 0x90, 0x241: 0x90, 0x242: 0x90, 0x243: 0x90, 0x244: 0x90, 0x245: 0x90, 0x246: 0x90, 0x247: 0x90, + 0x248: 0x90, 0x249: 0x90, 0x24a: 0x90, 0x24b: 0x90, 0x24c: 0x90, 0x24d: 0x90, 0x24e: 0x90, 0x24f: 0x90, + 0x250: 0x90, 0x251: 0x90, 0x252: 0x90, 0x253: 0x90, 0x254: 0x90, 0x255: 0x90, 0x256: 0x90, 0x257: 0x90, + 0x258: 0x90, 0x259: 0x90, 0x25a: 0x90, 0x25b: 0x90, 0x25c: 0x90, 0x25d: 0x90, 0x25e: 0x90, 0x25f: 0x90, + 0x260: 0x90, 0x261: 0x90, 0x262: 0x90, 0x263: 0x90, 0x264: 0x90, 0x265: 0x90, 0x266: 0x90, 0x267: 0x90, + 0x268: 0x90, 0x269: 0x90, 0x26a: 0x90, 0x26b: 0x90, 0x26c: 0x90, 0x26d: 0x90, 0x26e: 0x90, 0x26f: 0x90, + 0x270: 0x90, 0x271: 0x90, 0x272: 0x90, 0x273: 0x90, 0x274: 0x90, 0x275: 0x90, 0x276: 0x90, 0x277: 0x90, + 0x278: 0x90, 0x279: 0x90, 0x27a: 0x90, 0x27b: 0x90, 0x27c: 0x90, 0x27d: 0x90, 0x27e: 0x90, 0x27f: 0x90, + // Block 0xa, offset 0x280 + 0x280: 0x90, 0x281: 0x90, 0x282: 0x90, 0x283: 0x90, 0x284: 0x90, 0x285: 0x90, 0x286: 0x90, 0x287: 0x90, + 0x288: 0x90, 0x289: 0x90, 0x28a: 0x90, 0x28b: 0x90, 0x28c: 0x90, 0x28d: 0x90, 0x28e: 0x90, 0x28f: 0x90, + 0x290: 0x90, 0x291: 0x90, 0x292: 0x90, 0x293: 0x90, 0x294: 0x90, 0x295: 0x90, 0x296: 0x90, 0x297: 0x90, + 0x298: 0x90, 0x299: 0x90, 0x29a: 0x90, 0x29b: 0x90, 0x29c: 0x90, 0x29d: 0x90, 0x29e: 0x90, 0x29f: 0x90, + 0x2a0: 0x90, 0x2a1: 0x90, 0x2a2: 0x90, 0x2a3: 0x90, 0x2a4: 0x90, 0x2a5: 0x90, 0x2a6: 0x90, 0x2a7: 0x90, + 0x2a8: 0x90, 0x2a9: 0x90, 0x2aa: 0x90, 0x2ab: 0x90, 0x2ac: 0x90, 0x2ad: 0x90, 0x2ae: 0x90, 0x2af: 0x90, + 0x2b0: 0x90, 0x2b1: 0x90, 0x2b2: 0x90, 0x2b3: 0x90, 0x2b4: 0x90, 0x2b5: 0x90, 0x2b6: 0x90, 0x2b7: 0x90, + 0x2b8: 0x90, 0x2b9: 0x90, 0x2ba: 0x90, 0x2bb: 0x90, 0x2bc: 0x90, 0x2bd: 0x90, 0x2be: 0x90, 0x2bf: 0x92, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x05, 0x2c1: 0x05, 0x2c2: 0x05, 0x2c3: 0x05, 0x2c4: 0x05, 0x2c5: 0x05, 0x2c6: 0x05, 0x2c7: 0x05, + 0x2c8: 0x05, 0x2c9: 0x05, 0x2ca: 0x05, 0x2cb: 0x05, 0x2cc: 0x05, 0x2cd: 0x05, 0x2ce: 0x05, 0x2cf: 0x05, + 0x2d0: 0x05, 0x2d1: 0x05, 0x2d2: 0x93, 0x2d3: 0x94, 0x2d4: 0x05, 0x2d5: 0x05, 0x2d6: 0x05, 0x2d7: 0x05, + 0x2d8: 0x95, 0x2d9: 0x96, 0x2da: 0x97, 0x2db: 0x98, 0x2dc: 0x99, 0x2dd: 0x9a, 0x2de: 0x9b, 0x2df: 0x9c, + 0x2e0: 0x9d, 0x2e1: 0x9e, 0x2e2: 0x05, 0x2e3: 0x9f, 0x2e4: 0xa0, 0x2e5: 0xa1, 0x2e6: 0xa2, 0x2e7: 0xa3, + 0x2e8: 0xa4, 0x2e9: 0xa5, 0x2ea: 0xa6, 0x2eb: 0xa7, 0x2ec: 0xa8, 0x2ed: 0xa9, 0x2ee: 0x05, 0x2ef: 0xaa, + 0x2f0: 0x05, 0x2f1: 0x05, 0x2f2: 0x05, 0x2f3: 0x05, 0x2f4: 0x05, 0x2f5: 0x05, 0x2f6: 0x05, 0x2f7: 0x05, + 0x2f8: 0x05, 0x2f9: 0x05, 0x2fa: 0x05, 0x2fb: 0x05, 0x2fc: 0x05, 0x2fd: 0x05, 0x2fe: 0x05, 0x2ff: 0x05, + // Block 0xc, offset 0x300 + 0x300: 0x05, 0x301: 0x05, 0x302: 0x05, 0x303: 0x05, 0x304: 0x05, 0x305: 0x05, 0x306: 0x05, 0x307: 0x05, + 0x308: 0x05, 0x309: 0x05, 0x30a: 0x05, 0x30b: 0x05, 0x30c: 0x05, 0x30d: 0x05, 0x30e: 0x05, 0x30f: 0x05, + 0x310: 0x05, 0x311: 0x05, 0x312: 0x05, 0x313: 0x05, 0x314: 0x05, 0x315: 0x05, 0x316: 0x05, 0x317: 0x05, + 0x318: 0x05, 0x319: 0x05, 0x31a: 0x05, 0x31b: 0x05, 0x31c: 0x05, 0x31d: 0x05, 0x31e: 0x05, 0x31f: 0x05, + 0x320: 0x05, 0x321: 0x05, 0x322: 0x05, 0x323: 0x05, 0x324: 0x05, 0x325: 0x05, 0x326: 0x05, 0x327: 0x05, + 0x328: 0x05, 0x329: 0x05, 0x32a: 0x05, 0x32b: 0x05, 0x32c: 0x05, 0x32d: 0x05, 0x32e: 0x05, 0x32f: 0x05, + 0x330: 0x05, 0x331: 0x05, 0x332: 0x05, 0x333: 0x05, 0x334: 0x05, 0x335: 0x05, 0x336: 0x05, 0x337: 0x05, + 0x338: 0x05, 0x339: 0x05, 0x33a: 0x05, 0x33b: 0x05, 0x33c: 0x05, 0x33d: 0x05, 0x33e: 0x05, 0x33f: 0x05, + // Block 0xd, offset 0x340 + 0x340: 0x05, 0x341: 0x05, 0x342: 0x05, 0x343: 0x05, 0x344: 0x05, 0x345: 0x05, 0x346: 0x05, 0x347: 0x05, + 0x348: 0x05, 0x349: 0x05, 0x34a: 0x05, 0x34b: 0x05, 0x34c: 0x05, 0x34d: 0x05, 0x34e: 0x05, 0x34f: 0x05, + 0x350: 0x05, 0x351: 0x05, 0x352: 0x05, 0x353: 0x05, 0x354: 0x05, 0x355: 0x05, 0x356: 0x05, 0x357: 0x05, + 0x358: 0x05, 0x359: 0x05, 0x35a: 0x05, 0x35b: 0x05, 0x35c: 0x05, 0x35d: 0x05, 0x35e: 0xab, 0x35f: 0xac, + // Block 0xe, offset 0x380 + 0x380: 0x3e, 0x381: 0x3e, 0x382: 0x3e, 0x383: 0x3e, 0x384: 0x3e, 0x385: 0x3e, 0x386: 0x3e, 0x387: 0x3e, + 0x388: 0x3e, 0x389: 0x3e, 0x38a: 0x3e, 0x38b: 0x3e, 0x38c: 0x3e, 0x38d: 0x3e, 0x38e: 0x3e, 0x38f: 0x3e, + 0x390: 0x3e, 0x391: 0x3e, 0x392: 0x3e, 0x393: 0x3e, 0x394: 0x3e, 0x395: 0x3e, 0x396: 0x3e, 0x397: 0x3e, + 0x398: 0x3e, 0x399: 0x3e, 0x39a: 0x3e, 0x39b: 0x3e, 0x39c: 0x3e, 0x39d: 0x3e, 0x39e: 0x3e, 0x39f: 0x3e, + 0x3a0: 0x3e, 0x3a1: 0x3e, 0x3a2: 0x3e, 0x3a3: 0x3e, 0x3a4: 0x3e, 0x3a5: 0x3e, 0x3a6: 0x3e, 0x3a7: 0x3e, + 0x3a8: 0x3e, 0x3a9: 0x3e, 0x3aa: 0x3e, 0x3ab: 0x3e, 0x3ac: 0x3e, 0x3ad: 0x3e, 0x3ae: 0x3e, 0x3af: 0x3e, + 0x3b0: 0x3e, 0x3b1: 0x3e, 0x3b2: 0x3e, 0x3b3: 0x3e, 0x3b4: 0x3e, 0x3b5: 0x3e, 0x3b6: 0x3e, 0x3b7: 0x3e, + 0x3b8: 0x3e, 0x3b9: 0x3e, 0x3ba: 0x3e, 0x3bb: 0x3e, 0x3bc: 0x3e, 0x3bd: 0x3e, 0x3be: 0x3e, 0x3bf: 0x3e, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x3e, 0x3c1: 0x3e, 0x3c2: 0x3e, 0x3c3: 0x3e, 0x3c4: 0x3e, 0x3c5: 0x3e, 0x3c6: 0x3e, 0x3c7: 0x3e, + 0x3c8: 0x3e, 0x3c9: 0x3e, 0x3ca: 0x3e, 0x3cb: 0x3e, 0x3cc: 0x3e, 0x3cd: 0x3e, 0x3ce: 0x3e, 0x3cf: 0x3e, + 0x3d0: 0x3e, 0x3d1: 0x3e, 0x3d2: 0x3e, 0x3d3: 0x3e, 0x3d4: 0x3e, 0x3d5: 0x3e, 0x3d6: 0x3e, 0x3d7: 0x3e, + 0x3d8: 0x3e, 0x3d9: 0x3e, 0x3da: 0x3e, 0x3db: 0x3e, 0x3dc: 0x3e, 0x3dd: 0x3e, 0x3de: 0x3e, 0x3df: 0x3e, + 0x3e0: 0x3e, 0x3e1: 0x3e, 0x3e2: 0x3e, 0x3e3: 0x3e, 0x3e4: 0x83, 0x3e5: 0x83, 0x3e6: 0x83, 0x3e7: 0x83, + 0x3e8: 0xad, 0x3e9: 0xae, 0x3ea: 0x83, 0x3eb: 0xaf, 0x3ec: 0xb0, 0x3ed: 0xb1, 0x3ee: 0x71, 0x3ef: 0xb2, + 0x3f0: 0x71, 0x3f1: 0x71, 0x3f2: 0x71, 0x3f3: 0x71, 0x3f4: 0x71, 0x3f5: 0xb3, 0x3f6: 0xb4, 0x3f7: 0xb5, + 0x3f8: 0xb6, 0x3f9: 0xb7, 0x3fa: 0x71, 0x3fb: 0xb8, 0x3fc: 0xb9, 0x3fd: 0xba, 0x3fe: 0xbb, 0x3ff: 0xbc, + // Block 0x10, offset 0x400 + 0x400: 0xbd, 0x401: 0xbe, 0x402: 0x05, 0x403: 0xbf, 0x404: 0xc0, 0x405: 0xc1, 0x406: 0xc2, 0x407: 0xc3, + 0x40a: 0xc4, 0x40b: 0xc5, 0x40c: 0xc6, 0x40d: 0xc7, 0x40e: 0xc8, 0x40f: 0xc9, + 0x410: 0x05, 0x411: 0x05, 0x412: 0xca, 0x413: 0xcb, 0x414: 0xcc, 0x415: 0xcd, + 0x418: 0x05, 0x419: 0x05, 0x41a: 0x05, 0x41b: 0x05, 0x41c: 0xce, 0x41d: 0xcf, + 0x420: 0xd0, 0x421: 0xd1, 0x422: 0xd2, 0x423: 0xd3, 0x424: 0xd4, 0x426: 0xd5, 0x427: 0xb4, + 0x428: 0xd6, 0x429: 0xd7, 0x42a: 0xd8, 0x42b: 0xd9, 0x42c: 0xda, 0x42d: 0xdb, 0x42e: 0xdc, + 0x430: 0x05, 0x431: 0x5f, 0x432: 0xdd, 0x433: 0xde, + 0x439: 0xdf, + // Block 0x11, offset 0x440 + 0x440: 0xe0, 0x441: 0xe1, 0x442: 0xe2, 0x443: 0xe3, 0x444: 0xe4, 0x445: 0xe5, 0x446: 0xe6, 0x447: 0xe7, + 0x448: 0xe8, 0x44a: 0xe9, 0x44b: 0xea, 0x44c: 0xeb, 0x44d: 0xec, + 0x450: 0xed, 0x451: 0xee, 0x452: 0xef, 0x453: 0xf0, 0x456: 0xf1, 0x457: 0xf2, + 0x458: 0xf3, 0x459: 0xf4, 0x45a: 0xf5, 0x45b: 0xf6, 0x45c: 0xf7, + 0x462: 0xf8, 0x463: 0xf9, + 0x46b: 0xfa, + 0x470: 0xfb, 0x471: 0xfc, 0x472: 0xfd, + // Block 0x12, offset 0x480 + 0x480: 0x05, 0x481: 0x05, 0x482: 0x05, 0x483: 0x05, 0x484: 0x05, 0x485: 0x05, 0x486: 0x05, 0x487: 0x05, + 0x488: 0x05, 0x489: 0x05, 0x48a: 0x05, 0x48b: 0x05, 0x48c: 0x05, 0x48d: 0x05, 0x48e: 0xfe, + 0x490: 0x71, 0x491: 0xff, 0x492: 0x05, 0x493: 0x05, 0x494: 0x05, 0x495: 0x100, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x05, 0x4c1: 0x05, 0x4c2: 0x05, 0x4c3: 0x05, 0x4c4: 0x05, 0x4c5: 0x05, 0x4c6: 0x05, 0x4c7: 0x05, + 0x4c8: 0x05, 0x4c9: 0x05, 0x4ca: 0x05, 0x4cb: 0x05, 0x4cc: 0x05, 0x4cd: 0x05, 0x4ce: 0x05, 0x4cf: 0x05, + 0x4d0: 0x101, + // Block 0x14, offset 0x500 + 0x510: 0x05, 0x511: 0x05, 0x512: 0x05, 0x513: 0x05, 0x514: 0x05, 0x515: 0x05, 0x516: 0x05, 0x517: 0x05, + 0x518: 0x05, 0x519: 0x102, + // Block 0x15, offset 0x540 + 0x560: 0x05, 0x561: 0x05, 0x562: 0x05, 0x563: 0x05, 0x564: 0x05, 0x565: 0x05, 0x566: 0x05, 0x567: 0x05, + 0x568: 0xfa, 0x569: 0x103, 0x56b: 0x104, 0x56c: 0x105, 0x56d: 0x106, 0x56e: 0x107, + 0x57c: 0x05, 0x57d: 0x108, 0x57e: 0x109, 0x57f: 0x10a, + // Block 0x16, offset 0x580 + 0x580: 0x05, 0x581: 0x05, 0x582: 0x05, 0x583: 0x05, 0x584: 0x05, 0x585: 0x05, 0x586: 0x05, 0x587: 0x05, + 0x588: 0x05, 0x589: 0x05, 0x58a: 0x05, 0x58b: 0x05, 0x58c: 0x05, 0x58d: 0x05, 0x58e: 0x05, 0x58f: 0x05, + 0x590: 0x05, 0x591: 0x05, 0x592: 0x05, 0x593: 0x05, 0x594: 0x05, 0x595: 0x05, 0x596: 0x05, 0x597: 0x05, + 0x598: 0x05, 0x599: 0x05, 0x59a: 0x05, 0x59b: 0x05, 0x59c: 0x05, 0x59d: 0x05, 0x59e: 0x05, 0x59f: 0x10b, + 0x5a0: 0x05, 0x5a1: 0x05, 0x5a2: 0x05, 0x5a3: 0x05, 0x5a4: 0x05, 0x5a5: 0x05, 0x5a6: 0x05, 0x5a7: 0x05, + 0x5a8: 0x05, 0x5a9: 0x05, 0x5aa: 0x05, 0x5ab: 0xdd, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x10c, + 0x5f0: 0x05, 0x5f1: 0x10d, 0x5f2: 0x10e, + // Block 0x18, offset 0x600 + 0x600: 0x71, 0x601: 0x71, 0x602: 0x71, 0x603: 0x10f, 0x604: 0x110, 0x605: 0x111, 0x606: 0x112, 0x607: 0x113, + 0x608: 0xc1, 0x609: 0x114, 0x60c: 0x71, 0x60d: 0x115, + 0x610: 0x71, 0x611: 0x116, 0x612: 0x117, 0x613: 0x118, 0x614: 0x119, 0x615: 0x11a, 0x616: 0x71, 0x617: 0x71, + 0x618: 0x71, 0x619: 0x71, 0x61a: 0x11b, 0x61b: 0x71, 0x61c: 0x71, 0x61d: 0x71, 0x61e: 0x71, 0x61f: 0x11c, + 0x620: 0x71, 0x621: 0x71, 0x622: 0x71, 0x623: 0x71, 0x624: 0x71, 0x625: 0x71, 0x626: 0x71, 0x627: 0x71, + 0x628: 0x11d, 0x629: 0x11e, 0x62a: 0x11f, + // Block 0x19, offset 0x640 + 0x640: 0x120, + 0x660: 0x05, 0x661: 0x05, 0x662: 0x05, 0x663: 0x121, 0x664: 0x122, 0x665: 0x123, + 0x678: 0x124, 0x679: 0x125, 0x67a: 0x126, 0x67b: 0x127, + // Block 0x1a, offset 0x680 + 0x680: 0x128, 0x681: 0x71, 0x682: 0x129, 0x683: 0x12a, 0x684: 0x12b, 0x685: 0x128, 0x686: 0x12c, 0x687: 0x12d, + 0x688: 0x12e, 0x689: 0x12f, 0x68c: 0x71, 0x68d: 0x71, 0x68e: 0x71, 0x68f: 0x71, + 0x690: 0x71, 0x691: 0x71, 0x692: 0x71, 0x693: 0x71, 0x694: 0x71, 0x695: 0x71, 0x696: 0x71, 0x697: 0x71, + 0x698: 0x71, 0x699: 0x71, 0x69a: 0x71, 0x69b: 0x130, 0x69c: 0x71, 0x69d: 0x131, 0x69e: 0x71, 0x69f: 0x132, + 0x6a0: 0x133, 0x6a1: 0x134, 0x6a2: 0x135, 0x6a4: 0x136, 0x6a5: 0x137, 0x6a6: 0x138, 0x6a7: 0x139, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x90, 0x6c1: 0x90, 0x6c2: 0x90, 0x6c3: 0x90, 0x6c4: 0x90, 0x6c5: 0x90, 0x6c6: 0x90, 0x6c7: 0x90, + 0x6c8: 0x90, 0x6c9: 0x90, 0x6ca: 0x90, 0x6cb: 0x90, 0x6cc: 0x90, 0x6cd: 0x90, 0x6ce: 0x90, 0x6cf: 0x90, + 0x6d0: 0x90, 0x6d1: 0x90, 0x6d2: 0x90, 0x6d3: 0x90, 0x6d4: 0x90, 0x6d5: 0x90, 0x6d6: 0x90, 0x6d7: 0x90, + 0x6d8: 0x90, 0x6d9: 0x90, 0x6da: 0x90, 0x6db: 0x13a, 0x6dc: 0x90, 0x6dd: 0x90, 0x6de: 0x90, 0x6df: 0x90, + 0x6e0: 0x90, 0x6e1: 0x90, 0x6e2: 0x90, 0x6e3: 0x90, 0x6e4: 0x90, 0x6e5: 0x90, 0x6e6: 0x90, 0x6e7: 0x90, + 0x6e8: 0x90, 0x6e9: 0x90, 0x6ea: 0x90, 0x6eb: 0x90, 0x6ec: 0x90, 0x6ed: 0x90, 0x6ee: 0x90, 0x6ef: 0x90, + 0x6f0: 0x90, 0x6f1: 0x90, 0x6f2: 0x90, 0x6f3: 0x90, 0x6f4: 0x90, 0x6f5: 0x90, 0x6f6: 0x90, 0x6f7: 0x90, + 0x6f8: 0x90, 0x6f9: 0x90, 0x6fa: 0x90, 0x6fb: 0x90, 0x6fc: 0x90, 0x6fd: 0x90, 0x6fe: 0x90, 0x6ff: 0x90, + // Block 0x1c, offset 0x700 + 0x700: 0x90, 0x701: 0x90, 0x702: 0x90, 0x703: 0x90, 0x704: 0x90, 0x705: 0x90, 0x706: 0x90, 0x707: 0x90, + 0x708: 0x90, 0x709: 0x90, 0x70a: 0x90, 0x70b: 0x90, 0x70c: 0x90, 0x70d: 0x90, 0x70e: 0x90, 0x70f: 0x90, + 0x710: 0x90, 0x711: 0x90, 0x712: 0x90, 0x713: 0x90, 0x714: 0x90, 0x715: 0x90, 0x716: 0x90, 0x717: 0x90, + 0x718: 0x90, 0x719: 0x90, 0x71a: 0x90, 0x71b: 0x90, 0x71c: 0x13b, 0x71d: 0x90, 0x71e: 0x90, 0x71f: 0x90, + 0x720: 0x13c, 0x721: 0x90, 0x722: 0x90, 0x723: 0x90, 0x724: 0x90, 0x725: 0x90, 0x726: 0x90, 0x727: 0x90, + 0x728: 0x90, 0x729: 0x90, 0x72a: 0x90, 0x72b: 0x90, 0x72c: 0x90, 0x72d: 0x90, 0x72e: 0x90, 0x72f: 0x90, + 0x730: 0x90, 0x731: 0x90, 0x732: 0x90, 0x733: 0x90, 0x734: 0x90, 0x735: 0x90, 0x736: 0x90, 0x737: 0x90, + 0x738: 0x90, 0x739: 0x90, 0x73a: 0x90, 0x73b: 0x90, 0x73c: 0x90, 0x73d: 0x90, 0x73e: 0x90, 0x73f: 0x90, + // Block 0x1d, offset 0x740 + 0x740: 0x90, 0x741: 0x90, 0x742: 0x90, 0x743: 0x90, 0x744: 0x90, 0x745: 0x90, 0x746: 0x90, 0x747: 0x90, + 0x748: 0x90, 0x749: 0x90, 0x74a: 0x90, 0x74b: 0x90, 0x74c: 0x90, 0x74d: 0x90, 0x74e: 0x90, 0x74f: 0x90, + 0x750: 0x90, 0x751: 0x90, 0x752: 0x90, 0x753: 0x90, 0x754: 0x90, 0x755: 0x90, 0x756: 0x90, 0x757: 0x90, + 0x758: 0x90, 0x759: 0x90, 0x75a: 0x90, 0x75b: 0x90, 0x75c: 0x90, 0x75d: 0x90, 0x75e: 0x90, 0x75f: 0x90, + 0x760: 0x90, 0x761: 0x90, 0x762: 0x90, 0x763: 0x90, 0x764: 0x90, 0x765: 0x90, 0x766: 0x90, 0x767: 0x90, + 0x768: 0x90, 0x769: 0x90, 0x76a: 0x90, 0x76b: 0x90, 0x76c: 0x90, 0x76d: 0x90, 0x76e: 0x90, 0x76f: 0x90, + 0x770: 0x90, 0x771: 0x90, 0x772: 0x90, 0x773: 0x90, 0x774: 0x90, 0x775: 0x90, 0x776: 0x90, 0x777: 0x90, + 0x778: 0x90, 0x779: 0x90, 0x77a: 0x13d, + // Block 0x1e, offset 0x780 + 0x7a0: 0x83, 0x7a1: 0x83, 0x7a2: 0x83, 0x7a3: 0x83, 0x7a4: 0x83, 0x7a5: 0x83, 0x7a6: 0x83, 0x7a7: 0x83, + 0x7a8: 0x13e, + // Block 0x1f, offset 0x7c0 + 0x7d0: 0x0e, 0x7d1: 0x0f, 0x7d2: 0x10, 0x7d3: 0x11, 0x7d4: 0x12, 0x7d6: 0x13, 0x7d7: 0x0a, + 0x7d8: 0x14, 0x7db: 0x15, 0x7dd: 0x16, 0x7de: 0x17, 0x7df: 0x18, + 0x7e0: 0x07, 0x7e1: 0x07, 0x7e2: 0x07, 0x7e3: 0x07, 0x7e4: 0x07, 0x7e5: 0x07, 0x7e6: 0x07, 0x7e7: 0x07, + 0x7e8: 0x07, 0x7e9: 0x07, 0x7ea: 0x19, 0x7eb: 0x1a, 0x7ec: 0x1b, 0x7ef: 0x1c, + // Block 0x20, offset 0x800 + 0x800: 0x13f, 0x801: 0x3e, 0x804: 0x3e, 0x805: 0x3e, 0x806: 0x3e, 0x807: 0x140, + // Block 0x21, offset 0x840 + 0x840: 0x3e, 0x841: 0x3e, 0x842: 0x3e, 0x843: 0x3e, 0x844: 0x3e, 0x845: 0x3e, 0x846: 0x3e, 0x847: 0x3e, + 0x848: 0x3e, 0x849: 0x3e, 0x84a: 0x3e, 0x84b: 0x3e, 0x84c: 0x3e, 0x84d: 0x3e, 0x84e: 0x3e, 0x84f: 0x3e, + 0x850: 0x3e, 0x851: 0x3e, 0x852: 0x3e, 0x853: 0x3e, 0x854: 0x3e, 0x855: 0x3e, 0x856: 0x3e, 0x857: 0x3e, + 0x858: 0x3e, 0x859: 0x3e, 0x85a: 0x3e, 0x85b: 0x3e, 0x85c: 0x3e, 0x85d: 0x3e, 0x85e: 0x3e, 0x85f: 0x3e, + 0x860: 0x3e, 0x861: 0x3e, 0x862: 0x3e, 0x863: 0x3e, 0x864: 0x3e, 0x865: 0x3e, 0x866: 0x3e, 0x867: 0x3e, + 0x868: 0x3e, 0x869: 0x3e, 0x86a: 0x3e, 0x86b: 0x3e, 0x86c: 0x3e, 0x86d: 0x3e, 0x86e: 0x3e, 0x86f: 0x3e, + 0x870: 0x3e, 0x871: 0x3e, 0x872: 0x3e, 0x873: 0x3e, 0x874: 0x3e, 0x875: 0x3e, 0x876: 0x3e, 0x877: 0x3e, + 0x878: 0x3e, 0x879: 0x3e, 0x87a: 0x3e, 0x87b: 0x3e, 0x87c: 0x3e, 0x87d: 0x3e, 0x87e: 0x3e, 0x87f: 0x141, + // Block 0x22, offset 0x880 + 0x8a0: 0x1e, + 0x8b0: 0x0c, 0x8b1: 0x0c, 0x8b2: 0x0c, 0x8b3: 0x0c, 0x8b4: 0x0c, 0x8b5: 0x0c, 0x8b6: 0x0c, 0x8b7: 0x0c, + 0x8b8: 0x0c, 0x8b9: 0x0c, 0x8ba: 0x0c, 0x8bb: 0x0c, 0x8bc: 0x0c, 0x8bd: 0x0c, 0x8be: 0x0c, 0x8bf: 0x1f, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0c, 0x8c1: 0x0c, 0x8c2: 0x0c, 0x8c3: 0x0c, 0x8c4: 0x0c, 0x8c5: 0x0c, 0x8c6: 0x0c, 0x8c7: 0x0c, + 0x8c8: 0x0c, 0x8c9: 0x0c, 0x8ca: 0x0c, 0x8cb: 0x0c, 0x8cc: 0x0c, 0x8cd: 0x0c, 0x8ce: 0x0c, 0x8cf: 0x1f, +} + +// Total table size 25344 bytes (24KiB); checksum: 811C9DC5 diff --git a/vendor/golang.org/x/text/secure/precis/transformer.go b/vendor/golang.org/x/text/secure/precis/transformer.go new file mode 100644 index 000000000..97ce5e757 --- /dev/null +++ b/vendor/golang.org/x/text/secure/precis/transformer.go @@ -0,0 +1,32 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package precis + +import "golang.org/x/text/transform" + +// Transformer implements the transform.Transformer interface. +type Transformer struct { + t transform.Transformer +} + +// Reset implements the transform.Transformer interface. +func (t Transformer) Reset() { t.t.Reset() } + +// Transform implements the transform.Transformer interface. +func (t Transformer) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + return t.t.Transform(dst, src, atEOF) +} + +// Bytes returns a new byte slice with the result of applying t to b. +func (t Transformer) Bytes(b []byte) []byte { + b, _, _ = transform.Bytes(t, b) + return b +} + +// String returns a string with the result of applying t to s. +func (t Transformer) String(s string) string { + s, _, _ = transform.String(t, s) + return s +} diff --git a/vendor/golang.org/x/text/secure/precis/trieval.go b/vendor/golang.org/x/text/secure/precis/trieval.go new file mode 100644 index 000000000..fed7d7595 --- /dev/null +++ b/vendor/golang.org/x/text/secure/precis/trieval.go @@ -0,0 +1,64 @@ +// This file was generated by go generate; DO NOT EDIT + +package precis + +// entry is the entry of a trie table +// 7..6 property (unassigned, disallowed, maybe, valid) +// 5..0 category +type entry uint8 + +const ( + propShift = 6 + propMask = 0xc0 + catMask = 0x3f +) + +func (e entry) property() property { return property(e & propMask) } +func (e entry) category() category { return category(e & catMask) } + +type property uint8 + +// The order of these constants matter. A Profile may consider runes to be +// allowed either from pValid or idDisOrFreePVal. +const ( + unassigned property = iota << propShift + disallowed + idDisOrFreePVal // disallowed for Identifier, pValid for FreeForm + pValid +) + +// compute permutations of all properties and specialCategories. +type category uint8 + +const ( + other category = iota + + // Special rune types + joiningL + joiningD + joiningT + joiningR + viramaModifier + viramaJoinT // Virama + JoiningT + latinSmallL // U+006c + greek + greekJoinT // Greek + JoiningT + hebrew + hebrewJoinT // Hebrew + JoiningT + japanese // hirigana, katakana, han + + // Special rune types associated with contextual rules defined in + // https://tools.ietf.org/html/rfc5892#appendix-A. + // ContextO + zeroWidthNonJoiner // rule 1 + zeroWidthJoiner // rule 2 + // ContextJ + middleDot // rule 3 + greekLowerNumeralSign // rule 4 + hebrewPreceding // rule 5 and 6 + katakanaMiddleDot // rule 7 + arabicIndicDigit // rule 8 + extendedArabicIndicDigit // rule 9 + + numCategories +) diff --git a/vendor/golang.org/x/text/unicode/bidi/bidi.go b/vendor/golang.org/x/text/unicode/bidi/bidi.go new file mode 100644 index 000000000..3fc4a6252 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/bidi.go @@ -0,0 +1,198 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_trieval.go gen_ranges.go + +// Package bidi contains functionality for bidirectional text support. +// +// See http://www.unicode.org/reports/tr9. +// +// NOTE: UNDER CONSTRUCTION. This API may change in backwards incompatible ways +// and without notice. +package bidi // import "golang.org/x/text/unicode/bidi" + +// TODO: +// The following functionality would not be hard to implement, but hinges on +// the definition of a Segmenter interface. For now this is up to the user. +// - Iterate over paragraphs +// - Segmenter to iterate over runs directly from a given text. +// Also: +// - Transformer for reordering? +// - Transformer (validator, really) for Bidi Rule. + +// This API tries to avoid dealing with embedding levels for now. Under the hood +// these will be computed, but the question is to which extent the user should +// know they exist. We should at some point allow the user to specify an +// embedding hierarchy, though. + +// A Direction indicates the overall flow of text. +type Direction int + +const ( + // LeftToRight indicates the text contains no right-to-left characters and + // that either there are some left-to-right characters or the option + // DefaultDirection(LeftToRight) was passed. + LeftToRight Direction = iota + + // RightToLeft indicates the text contains no left-to-right characters and + // that either there are some right-to-left characters or the option + // DefaultDirection(RightToLeft) was passed. + RightToLeft + + // Mixed indicates text contains both left-to-right and right-to-left + // characters. + Mixed + + // Neutral means that text contains no left-to-right and right-to-left + // characters and that no default direction has been set. + Neutral +) + +type options struct{} + +// An Option is an option for Bidi processing. +type Option func(*options) + +// ICU allows the user to define embedding levels. This may be used, for example, +// to use hierarchical structure of markup languages to define embeddings. +// The following option may be a way to expose this functionality in this API. +// // LevelFunc sets a function that associates nesting levels with the given text. +// // The levels function will be called with monotonically increasing values for p. +// func LevelFunc(levels func(p int) int) Option { +// panic("unimplemented") +// } + +// DefaultDirection sets the default direction for a Paragraph. The direction is +// overridden if the text contains directional characters. +func DefaultDirection(d Direction) Option { + panic("unimplemented") +} + +// A Paragraph holds a single Paragraph for Bidi processing. +type Paragraph struct { + // buffers +} + +// SetBytes configures p for the given paragraph text. It replaces text +// previously set by SetBytes or SetString. If b contains a paragraph separator +// it will only process the first paragraph and report the number of bytes +// consumed from b including this separator. Error may be non-nil if options are +// given. +func (p *Paragraph) SetBytes(b []byte, opts ...Option) (n int, err error) { + panic("unimplemented") +} + +// SetString configures p for the given paragraph text. It replaces text +// previously set by SetBytes or SetString. If b contains a paragraph separator +// it will only process the first paragraph and report the number of bytes +// consumed from b including this separator. Error may be non-nil if options are +// given. +func (p *Paragraph) SetString(s string, opts ...Option) (n int, err error) { + panic("unimplemented") +} + +// IsLeftToRight reports whether the principle direction of rendering for this +// paragraphs is left-to-right. If this returns false, the principle direction +// of rendering is right-to-left. +func (p *Paragraph) IsLeftToRight() bool { + panic("unimplemented") +} + +// Direction returns the direction of the text of this paragraph. +// +// The direction may be LeftToRight, RightToLeft, Mixed, or Neutral. +func (p *Paragraph) Direction() Direction { + panic("unimplemented") +} + +// RunAt reports the Run at the given position of the input text. +// +// This method can be used for computing line breaks on paragraphs. +func (p *Paragraph) RunAt(pos int) Run { + panic("unimplemented") +} + +// Order computes the visual ordering of all the runs in a Paragraph. +func (p *Paragraph) Order() (Ordering, error) { + panic("unimplemented") +} + +// Line computes the visual ordering of runs for a single line starting and +// ending at the given positions in the original text. +func (p *Paragraph) Line(start, end int) (Ordering, error) { + panic("unimplemented") +} + +// An Ordering holds the computed visual order of runs of a Paragraph. Calling +// SetBytes or SetString on the originating Paragraph invalidates an Ordering. +// The methods of an Ordering should only be called by one goroutine at a time. +type Ordering struct{} + +// Direction reports the directionality of the runs. +// +// The direction may be LeftToRight, RightToLeft, Mixed, or Neutral. +func (o *Ordering) Direction() Direction { + panic("unimplemented") +} + +// NumRuns returns the number of runs. +func (o *Ordering) NumRuns() int { + panic("unimplemented") +} + +// Run returns the ith run within the ordering. +func (o *Ordering) Run(i int) Run { + panic("unimplemented") +} + +// TODO: perhaps with options. +// // Reorder creates a reader that reads the runes in visual order per character. +// // Modifiers remain after the runes they modify. +// func (l *Runs) Reorder() io.Reader { +// panic("unimplemented") +// } + +// A Run is a continuous sequence of characters of a single direction. +type Run struct { +} + +// String returns the text of the run in its original order. +func (r *Run) String() string { + panic("unimplemented") +} + +// Bytes returns the text of the run in its original order. +func (r *Run) Bytes() []byte { + panic("unimplemented") +} + +// TODO: methods for +// - Display order +// - headers and footers +// - bracket replacement. + +// Direction reports the direction of the run. +func (r *Run) Direction() Direction { + panic("unimplemented") +} + +// Position of the Run within the text passed to SetBytes or SetString of the +// originating Paragraph value. +func (r *Run) Pos() (start, end int) { + panic("unimplemented") +} + +// AppendReverse reverses the order of characters of in, appends them to out, +// and returns the result. Modifiers will still follow the runes they modify. +// Brackets are replaced with their counterparts. +func AppendReverse(out, in []byte) []byte { + panic("unimplemented") +} + +// ReverseString reverses the order of characters in s and returns a new string. +// Modifiers will still follow the runes they modify. Brackets are replaced with +// their counterparts. +func ReverseString(s string) string { + panic("unimplemented") +} diff --git a/vendor/golang.org/x/text/unicode/bidi/bracket.go b/vendor/golang.org/x/text/unicode/bidi/bracket.go new file mode 100644 index 000000000..601e25920 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/bracket.go @@ -0,0 +1,335 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package bidi + +import ( + "container/list" + "fmt" + "sort" +) + +// This file contains a port of the reference implementation of the +// Bidi Parentheses Algorithm: +// http://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/BidiPBAReference.java +// +// The implementation in this file covers definitions BD14-BD16 and rule N0 +// of UAX#9. +// +// Some preprocessing is done for each rune before data is passed to this +// algorithm: +// - opening and closing brackets are identified +// - a bracket pair type, like '(' and ')' is assigned a unique identifier that +// is identical for the opening and closing bracket. It is left to do these +// mappings. +// - The BPA algorithm requires that bracket characters that are canonical +// equivalents of each other be able to be substituted for each other. +// It is the responsibility of the caller to do this canonicalization. +// +// In implementing BD16, this implementation departs slightly from the "logical" +// algorithm defined in UAX#9. In particular, the stack referenced there +// supports operations that go beyond a "basic" stack. An equivalent +// implementation based on a linked list is used here. + +// Bidi_Paired_Bracket_Type +// BD14. An opening paired bracket is a character whose +// Bidi_Paired_Bracket_Type property value is Open. +// +// BD15. A closing paired bracket is a character whose +// Bidi_Paired_Bracket_Type property value is Close. +type bracketType byte + +const ( + bpNone bracketType = iota + bpOpen + bpClose +) + +// bracketPair holds a pair of index values for opening and closing bracket +// location of a bracket pair. +type bracketPair struct { + opener int + closer int +} + +func (b *bracketPair) String() string { + return fmt.Sprintf("(%v, %v)", b.opener, b.closer) +} + +// bracketPairs is a slice of bracketPairs with a sort.Interface implementation. +type bracketPairs []bracketPair + +func (b bracketPairs) Len() int { return len(b) } +func (b bracketPairs) Swap(i, j int) { b[i], b[j] = b[j], b[i] } +func (b bracketPairs) Less(i, j int) bool { return b[i].opener < b[j].opener } + +// resolvePairedBrackets runs the paired bracket part of the UBA algorithm. +// +// For each rune, it takes the indexes into the original string, the class the +// bracket type (in pairTypes) and the bracket identifier (pairValues). It also +// takes the direction type for the start-of-sentence and the embedding level. +// +// The identifiers for bracket types are the rune of the canonicalized opening +// bracket for brackets (open or close) or 0 for runes that are not brackets. +func resolvePairedBrackets(s *isolatingRunSequence) { + p := bracketPairer{ + sos: s.sos, + openers: list.New(), + codesIsolatedRun: s.types, + indexes: s.indexes, + } + dirEmbed := L + if s.level&1 != 0 { + dirEmbed = R + } + p.locateBrackets(s.p.pairTypes, s.p.pairValues) + p.resolveBrackets(dirEmbed, s.p.initialTypes) +} + +type bracketPairer struct { + sos Class // direction corresponding to start of sequence + + // The following is a restatement of BD 16 using non-algorithmic language. + // + // A bracket pair is a pair of characters consisting of an opening + // paired bracket and a closing paired bracket such that the + // Bidi_Paired_Bracket property value of the former equals the latter, + // subject to the following constraints. + // - both characters of a pair occur in the same isolating run sequence + // - the closing character of a pair follows the opening character + // - any bracket character can belong at most to one pair, the earliest possible one + // - any bracket character not part of a pair is treated like an ordinary character + // - pairs may nest properly, but their spans may not overlap otherwise + + // Bracket characters with canonical decompositions are supposed to be + // treated as if they had been normalized, to allow normalized and non- + // normalized text to give the same result. In this implementation that step + // is pushed out to the caller. The caller has to ensure that the pairValue + // slices contain the rune of the opening bracket after normalization for + // any opening or closing bracket. + + openers *list.List // list of positions for opening brackets + + // bracket pair positions sorted by location of opening bracket + pairPositions bracketPairs + + codesIsolatedRun []Class // directional bidi codes for an isolated run + indexes []int // array of index values into the original string + +} + +// matchOpener reports whether characters at given positions form a matching +// bracket pair. +func (p *bracketPairer) matchOpener(pairValues []rune, opener, closer int) bool { + return pairValues[p.indexes[opener]] == pairValues[p.indexes[closer]] +} + +const maxPairingDepth = 63 + +// locateBrackets locates matching bracket pairs according to BD16. +// +// This implementation uses a linked list instead of a stack, because, while +// elements are added at the front (like a push) they are not generally removed +// in atomic 'pop' operations, reducing the benefit of the stack archetype. +func (p *bracketPairer) locateBrackets(pairTypes []bracketType, pairValues []rune) { + // traverse the run + // do that explicitly (not in a for-each) so we can record position + for i, index := range p.indexes { + + // look at the bracket type for each character + if pairTypes[index] == bpNone || p.codesIsolatedRun[i] != ON { + // continue scanning + continue + } + switch pairTypes[index] { + case bpOpen: + // check if maximum pairing depth reached + if p.openers.Len() == maxPairingDepth { + p.openers.Init() + return + } + // remember opener location, most recent first + p.openers.PushFront(i) + + case bpClose: + // see if there is a match + count := 0 + for elem := p.openers.Front(); elem != nil; elem = elem.Next() { + count++ + opener := elem.Value.(int) + if p.matchOpener(pairValues, opener, i) { + // if the opener matches, add nested pair to the ordered list + p.pairPositions = append(p.pairPositions, bracketPair{opener, i}) + // remove up to and including matched opener + for ; count > 0; count-- { + p.openers.Remove(p.openers.Front()) + } + break + } + } + sort.Sort(p.pairPositions) + // if we get here, the closing bracket matched no openers + // and gets ignored + } + } +} + +// Bracket pairs within an isolating run sequence are processed as units so +// that both the opening and the closing paired bracket in a pair resolve to +// the same direction. +// +// N0. Process bracket pairs in an isolating run sequence sequentially in +// the logical order of the text positions of the opening paired brackets +// using the logic given below. Within this scope, bidirectional types EN +// and AN are treated as R. +// +// Identify the bracket pairs in the current isolating run sequence +// according to BD16. For each bracket-pair element in the list of pairs of +// text positions: +// +// a Inspect the bidirectional types of the characters enclosed within the +// bracket pair. +// +// b If any strong type (either L or R) matching the embedding direction is +// found, set the type for both brackets in the pair to match the embedding +// direction. +// +// o [ e ] o -> o e e e o +// +// o [ o e ] -> o e o e e +// +// o [ NI e ] -> o e NI e e +// +// c Otherwise, if a strong type (opposite the embedding direction) is +// found, test for adjacent strong types as follows: 1 First, check +// backwards before the opening paired bracket until the first strong type +// (L, R, or sos) is found. If that first preceding strong type is opposite +// the embedding direction, then set the type for both brackets in the pair +// to that type. 2 Otherwise, set the type for both brackets in the pair to +// the embedding direction. +// +// o [ o ] e -> o o o o e +// +// o [ o NI ] o -> o o o NI o o +// +// e [ o ] o -> e e o e o +// +// e [ o ] e -> e e o e e +// +// e ( o [ o ] NI ) e -> e e o o o o NI e e +// +// d Otherwise, do not set the type for the current bracket pair. Note that +// if the enclosed text contains no strong types the paired brackets will +// both resolve to the same level when resolved individually using rules N1 +// and N2. +// +// e ( NI ) o -> e ( NI ) o + +// getStrongTypeN0 maps character's directional code to strong type as required +// by rule N0. +// +// TODO: have separate type for "strong" directionality. +func (p *bracketPairer) getStrongTypeN0(index int) Class { + switch p.codesIsolatedRun[index] { + // in the scope of N0, number types are treated as R + case EN, AN, AL, R: + return R + case L: + return L + default: + return ON + } +} + +// classifyPairContent reports the strong types contained inside a Bracket Pair, +// assuming the given embedding direction. +// +// It returns ON if no strong type is found. If a single strong type is found, +// it returns this this type. Otherwise it returns the embedding direction. +// +// TODO: use separate type for "strong" directionality. +func (p *bracketPairer) classifyPairContent(loc bracketPair, dirEmbed Class) Class { + dirOpposite := ON + for i := loc.opener + 1; i < loc.closer; i++ { + dir := p.getStrongTypeN0(i) + if dir == ON { + continue + } + if dir == dirEmbed { + return dir // type matching embedding direction found + } + dirOpposite = dir + } + // return ON if no strong type found, or class opposite to dirEmbed + return dirOpposite +} + +// classBeforePair determines which strong types are present before a Bracket +// Pair. Return R or L if strong type found, otherwise ON. +func (p *bracketPairer) classBeforePair(loc bracketPair) Class { + for i := loc.opener - 1; i >= 0; i-- { + if dir := p.getStrongTypeN0(i); dir != ON { + return dir + } + } + // no strong types found, return sos + return p.sos +} + +// assignBracketType implements rule N0 for a single bracket pair. +func (p *bracketPairer) assignBracketType(loc bracketPair, dirEmbed Class, initialTypes []Class) { + // rule "N0, a", inspect contents of pair + dirPair := p.classifyPairContent(loc, dirEmbed) + + // dirPair is now L, R, or N (no strong type found) + + // the following logical tests are performed out of order compared to + // the statement of the rules but yield the same results + if dirPair == ON { + return // case "d" - nothing to do + } + + if dirPair != dirEmbed { + // case "c": strong type found, opposite - check before (c.1) + dirPair = p.classBeforePair(loc) + if dirPair == dirEmbed || dirPair == ON { + // no strong opposite type found before - use embedding (c.2) + dirPair = dirEmbed + } + } + // else: case "b", strong type found matching embedding, + // no explicit action needed, as dirPair is already set to embedding + // direction + + // set the bracket types to the type found + p.setBracketsToType(loc, dirPair, initialTypes) +} + +func (p *bracketPairer) setBracketsToType(loc bracketPair, dirPair Class, initialTypes []Class) { + p.codesIsolatedRun[loc.opener] = dirPair + p.codesIsolatedRun[loc.closer] = dirPair + + for i := loc.opener + 1; i < loc.closer; i++ { + index := p.indexes[i] + if initialTypes[index] != NSM { + break + } + p.codesIsolatedRun[i] = dirPair + } + + for i := loc.closer + 1; i < len(p.indexes); i++ { + index := p.indexes[i] + if initialTypes[index] != NSM { + break + } + p.codesIsolatedRun[i] = dirPair + } +} + +// resolveBrackets implements rule N0 for a list of pairs. +func (p *bracketPairer) resolveBrackets(dirEmbed Class, initialTypes []Class) { + for _, loc := range p.pairPositions { + p.assignBracketType(loc, dirEmbed, initialTypes) + } +} diff --git a/vendor/golang.org/x/text/unicode/bidi/core.go b/vendor/golang.org/x/text/unicode/bidi/core.go new file mode 100644 index 000000000..ec52f1448 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/core.go @@ -0,0 +1,1058 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package bidi + +import "log" + +// This implementation is a port based on the reference implementation found at: +// http://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/ +// +// described in Unicode Bidirectional Algorithm (UAX #9). +// +// Input: +// There are two levels of input to the algorithm, since clients may prefer to +// supply some information from out-of-band sources rather than relying on the +// default behavior. +// +// - Bidi class array +// - Bidi class array, with externally supplied base line direction +// +// Output: +// Output is separated into several stages: +// +// - levels array over entire paragraph +// - reordering array over entire paragraph +// - levels array over line +// - reordering array over line +// +// Note that for conformance to the Unicode Bidirectional Algorithm, +// implementations are only required to generate correct reordering and +// character directionality (odd or even levels) over a line. Generating +// identical level arrays over a line is not required. Bidi explicit format +// codes (LRE, RLE, LRO, RLO, PDF) and BN can be assigned arbitrary levels and +// positions as long as the rest of the input is properly reordered. +// +// As the algorithm is defined to operate on a single paragraph at a time, this +// implementation is written to handle single paragraphs. Thus rule P1 is +// presumed by this implementation-- the data provided to the implementation is +// assumed to be a single paragraph, and either contains no 'B' codes, or a +// single 'B' code at the end of the input. 'B' is allowed as input to +// illustrate how the algorithm assigns it a level. +// +// Also note that rules L3 and L4 depend on the rendering engine that uses the +// result of the bidi algorithm. This implementation assumes that the rendering +// engine expects combining marks in visual order (e.g. to the left of their +// base character in RTL runs) and that it adjusts the glyphs used to render +// mirrored characters that are in RTL runs so that they render appropriately. + +// level is the embedding level of a character. Even embedding levels indicate +// left-to-right order and odd levels indicate right-to-left order. The special +// level of -1 is reserved for undefined order. +type level int8 + +const implicitLevel level = -1 + +// in returns if x is equal to any of the values in set. +func (c Class) in(set ...Class) bool { + for _, s := range set { + if c == s { + return true + } + } + return false +} + +// A paragraph contains the state of a paragraph. +type paragraph struct { + initialTypes []Class + + // Arrays of properties needed for paired bracket evaluation in N0 + pairTypes []bracketType // paired Bracket types for paragraph + pairValues []rune // rune for opening bracket or pbOpen and pbClose; 0 for pbNone + + embeddingLevel level // default: = implicitLevel; + + // at the paragraph levels + resultTypes []Class + resultLevels []level + + // Index of matching PDI for isolate initiator characters. For other + // characters, the value of matchingPDI will be set to -1. For isolate + // initiators with no matching PDI, matchingPDI will be set to the length of + // the input string. + matchingPDI []int + + // Index of matching isolate initiator for PDI characters. For other + // characters, and for PDIs with no matching isolate initiator, the value of + // matchingIsolateInitiator will be set to -1. + matchingIsolateInitiator []int +} + +// newParagraph initializes a paragraph. The user needs to supply a few arrays +// corresponding to the preprocessed text input. The types correspond to the +// Unicode BiDi classes for each rune. pairTypes indicates the bracket type for +// each rune. pairValues provides a unique bracket class identifier for each +// rune (suggested is the rune of the open bracket for opening and matching +// close brackets, after normalization). The embedding levels are optional, but +// may be supplied to encode embedding levels of styled text. +// +// TODO: return an error. +func newParagraph(types []Class, pairTypes []bracketType, pairValues []rune, levels level) *paragraph { + validateTypes(types) + validatePbTypes(pairTypes) + validatePbValues(pairValues, pairTypes) + validateParagraphEmbeddingLevel(levels) + + p := ¶graph{ + initialTypes: append([]Class(nil), types...), + embeddingLevel: levels, + + pairTypes: pairTypes, + pairValues: pairValues, + + resultTypes: append([]Class(nil), types...), + } + p.run() + return p +} + +func (p *paragraph) Len() int { return len(p.initialTypes) } + +// The algorithm. Does not include line-based processing (Rules L1, L2). +// These are applied later in the line-based phase of the algorithm. +func (p *paragraph) run() { + p.determineMatchingIsolates() + + // 1) determining the paragraph level + // Rule P1 is the requirement for entering this algorithm. + // Rules P2, P3. + // If no externally supplied paragraph embedding level, use default. + if p.embeddingLevel == implicitLevel { + p.embeddingLevel = p.determineParagraphEmbeddingLevel(0, p.Len()) + } + + // Initialize result levels to paragraph embedding level. + p.resultLevels = make([]level, p.Len()) + setLevels(p.resultLevels, p.embeddingLevel) + + // 2) Explicit levels and directions + // Rules X1-X8. + p.determineExplicitEmbeddingLevels() + + // Rule X9. + // We do not remove the embeddings, the overrides, the PDFs, and the BNs + // from the string explicitly. But they are not copied into isolating run + // sequences when they are created, so they are removed for all + // practical purposes. + + // Rule X10. + // Run remainder of algorithm one isolating run sequence at a time + for _, seq := range p.determineIsolatingRunSequences() { + // 3) resolving weak types + // Rules W1-W7. + seq.resolveWeakTypes() + + // 4a) resolving paired brackets + // Rule N0 + resolvePairedBrackets(seq) + + // 4b) resolving neutral types + // Rules N1-N3. + seq.resolveNeutralTypes() + + // 5) resolving implicit embedding levels + // Rules I1, I2. + seq.resolveImplicitLevels() + + // Apply the computed levels and types + seq.applyLevelsAndTypes() + } + + // Assign appropriate levels to 'hide' LREs, RLEs, LROs, RLOs, PDFs, and + // BNs. This is for convenience, so the resulting level array will have + // a value for every character. + p.assignLevelsToCharactersRemovedByX9() +} + +// determineMatchingIsolates determines the matching PDI for each isolate +// initiator and vice versa. +// +// Definition BD9. +// +// At the end of this function: +// +// - The member variable matchingPDI is set to point to the index of the +// matching PDI character for each isolate initiator character. If there is +// no matching PDI, it is set to the length of the input text. For other +// characters, it is set to -1. +// - The member variable matchingIsolateInitiator is set to point to the +// index of the matching isolate initiator character for each PDI character. +// If there is no matching isolate initiator, or the character is not a PDI, +// it is set to -1. +func (p *paragraph) determineMatchingIsolates() { + p.matchingPDI = make([]int, p.Len()) + p.matchingIsolateInitiator = make([]int, p.Len()) + + for i := range p.matchingIsolateInitiator { + p.matchingIsolateInitiator[i] = -1 + } + + for i := range p.matchingPDI { + p.matchingPDI[i] = -1 + + if t := p.resultTypes[i]; t.in(LRI, RLI, FSI) { + depthCounter := 1 + for j := i + 1; j < p.Len(); j++ { + if u := p.resultTypes[j]; u.in(LRI, RLI, FSI) { + depthCounter++ + } else if u == PDI { + if depthCounter--; depthCounter == 0 { + p.matchingPDI[i] = j + p.matchingIsolateInitiator[j] = i + break + } + } + } + if p.matchingPDI[i] == -1 { + p.matchingPDI[i] = p.Len() + } + } + } +} + +// determineParagraphEmbeddingLevel reports the resolved paragraph direction of +// the substring limited by the given range [start, end). +// +// Determines the paragraph level based on rules P2, P3. This is also used +// in rule X5c to find if an FSI should resolve to LRI or RLI. +func (p *paragraph) determineParagraphEmbeddingLevel(start, end int) level { + var strongType Class = unknownClass + + // Rule P2. + for i := start; i < end; i++ { + if t := p.resultTypes[i]; t.in(L, AL, R) { + strongType = t + break + } else if t.in(FSI, LRI, RLI) { + i = p.matchingPDI[i] // skip over to the matching PDI + if i > end { + log.Panic("assert (i <= end)") + } + } + } + // Rule P3. + switch strongType { + case unknownClass: // none found + // default embedding level when no strong types found is 0. + return 0 + case L: + return 0 + default: // AL, R + return 1 + } +} + +const maxDepth = 125 + +// This stack will store the embedding levels and override and isolated +// statuses +type directionalStatusStack struct { + stackCounter int + embeddingLevelStack [maxDepth + 1]level + overrideStatusStack [maxDepth + 1]Class + isolateStatusStack [maxDepth + 1]bool +} + +func (s *directionalStatusStack) empty() { s.stackCounter = 0 } +func (s *directionalStatusStack) pop() { s.stackCounter-- } +func (s *directionalStatusStack) depth() int { return s.stackCounter } + +func (s *directionalStatusStack) push(level level, overrideStatus Class, isolateStatus bool) { + s.embeddingLevelStack[s.stackCounter] = level + s.overrideStatusStack[s.stackCounter] = overrideStatus + s.isolateStatusStack[s.stackCounter] = isolateStatus + s.stackCounter++ +} + +func (s *directionalStatusStack) lastEmbeddingLevel() level { + return s.embeddingLevelStack[s.stackCounter-1] +} + +func (s *directionalStatusStack) lastDirectionalOverrideStatus() Class { + return s.overrideStatusStack[s.stackCounter-1] +} + +func (s *directionalStatusStack) lastDirectionalIsolateStatus() bool { + return s.isolateStatusStack[s.stackCounter-1] +} + +// Determine explicit levels using rules X1 - X8 +func (p *paragraph) determineExplicitEmbeddingLevels() { + var stack directionalStatusStack + var overflowIsolateCount, overflowEmbeddingCount, validIsolateCount int + + // Rule X1. + stack.push(p.embeddingLevel, ON, false) + + for i, t := range p.resultTypes { + // Rules X2, X3, X4, X5, X5a, X5b, X5c + switch t { + case RLE, LRE, RLO, LRO, RLI, LRI, FSI: + isIsolate := t.in(RLI, LRI, FSI) + isRTL := t.in(RLE, RLO, RLI) + + // override if this is an FSI that resolves to RLI + if t == FSI { + isRTL = (p.determineParagraphEmbeddingLevel(i+1, p.matchingPDI[i]) == 1) + } + if isIsolate { + p.resultLevels[i] = stack.lastEmbeddingLevel() + if stack.lastDirectionalOverrideStatus() != ON { + p.resultTypes[i] = stack.lastDirectionalOverrideStatus() + } + } + + var newLevel level + if isRTL { + // least greater odd + newLevel = (stack.lastEmbeddingLevel() + 1) | 1 + } else { + // least greater even + newLevel = (stack.lastEmbeddingLevel() + 2) &^ 1 + } + + if newLevel <= maxDepth && overflowIsolateCount == 0 && overflowEmbeddingCount == 0 { + if isIsolate { + validIsolateCount++ + } + // Push new embedding level, override status, and isolated + // status. + // No check for valid stack counter, since the level check + // suffices. + switch t { + case LRO: + stack.push(newLevel, L, isIsolate) + case RLO: + stack.push(newLevel, R, isIsolate) + default: + stack.push(newLevel, ON, isIsolate) + } + // Not really part of the spec + if !isIsolate { + p.resultLevels[i] = newLevel + } + } else { + // This is an invalid explicit formatting character, + // so apply the "Otherwise" part of rules X2-X5b. + if isIsolate { + overflowIsolateCount++ + } else { // !isIsolate + if overflowIsolateCount == 0 { + overflowEmbeddingCount++ + } + } + } + + // Rule X6a + case PDI: + if overflowIsolateCount > 0 { + overflowIsolateCount-- + } else if validIsolateCount == 0 { + // do nothing + } else { + overflowEmbeddingCount = 0 + for !stack.lastDirectionalIsolateStatus() { + stack.pop() + } + stack.pop() + validIsolateCount-- + } + p.resultLevels[i] = stack.lastEmbeddingLevel() + + // Rule X7 + case PDF: + // Not really part of the spec + p.resultLevels[i] = stack.lastEmbeddingLevel() + + if overflowIsolateCount > 0 { + // do nothing + } else if overflowEmbeddingCount > 0 { + overflowEmbeddingCount-- + } else if !stack.lastDirectionalIsolateStatus() && stack.depth() >= 2 { + stack.pop() + } + + case B: // paragraph separator. + // Rule X8. + + // These values are reset for clarity, in this implementation B + // can only occur as the last code in the array. + stack.empty() + overflowIsolateCount = 0 + overflowEmbeddingCount = 0 + validIsolateCount = 0 + p.resultLevels[i] = p.embeddingLevel + + default: + p.resultLevels[i] = stack.lastEmbeddingLevel() + if stack.lastDirectionalOverrideStatus() != ON { + p.resultTypes[i] = stack.lastDirectionalOverrideStatus() + } + } + } +} + +type isolatingRunSequence struct { + p *paragraph + + indexes []int // indexes to the original string + + types []Class // type of each character using the index + resolvedLevels []level // resolved levels after application of rules + level level + sos, eos Class +} + +func (i *isolatingRunSequence) Len() int { return len(i.indexes) } + +func maxLevel(a, b level) level { + if a > b { + return a + } + return b +} + +// Rule X10, second bullet: Determine the start-of-sequence (sos) and end-of-sequence (eos) types, +// either L or R, for each isolating run sequence. +func (p *paragraph) isolatingRunSequence(indexes []int) *isolatingRunSequence { + length := len(indexes) + types := make([]Class, length) + for i, x := range indexes { + types[i] = p.resultTypes[x] + } + + // assign level, sos and eos + prevChar := indexes[0] - 1 + for prevChar >= 0 && isRemovedByX9(p.initialTypes[prevChar]) { + prevChar-- + } + prevLevel := p.embeddingLevel + if prevChar >= 0 { + prevLevel = p.resultLevels[prevChar] + } + + var succLevel level + lastType := types[length-1] + if lastType.in(LRI, RLI, FSI) { + succLevel = p.embeddingLevel + } else { + // the first character after the end of run sequence + limit := indexes[length-1] + 1 + for ; limit < p.Len() && isRemovedByX9(p.initialTypes[limit]); limit++ { + + } + succLevel = p.embeddingLevel + if limit < p.Len() { + succLevel = p.resultLevels[limit] + } + } + level := p.resultLevels[indexes[0]] + return &isolatingRunSequence{ + p: p, + indexes: indexes, + types: types, + level: level, + sos: typeForLevel(maxLevel(prevLevel, level)), + eos: typeForLevel(maxLevel(succLevel, level)), + } +} + +// Resolving weak types Rules W1-W7. +// +// Note that some weak types (EN, AN) remain after this processing is +// complete. +func (s *isolatingRunSequence) resolveWeakTypes() { + + // on entry, only these types remain + s.assertOnly(L, R, AL, EN, ES, ET, AN, CS, B, S, WS, ON, NSM, LRI, RLI, FSI, PDI) + + // Rule W1. + // Changes all NSMs. + preceedingCharacterType := s.sos + for i, t := range s.types { + if t == NSM { + s.types[i] = preceedingCharacterType + } else { + if t.in(LRI, RLI, FSI, PDI) { + preceedingCharacterType = ON + } + preceedingCharacterType = t + } + } + + // Rule W2. + // EN does not change at the start of the run, because sos != AL. + for i, t := range s.types { + if t == EN { + for j := i - 1; j >= 0; j-- { + if t := s.types[j]; t.in(L, R, AL) { + if t == AL { + s.types[i] = AN + } + break + } + } + } + } + + // Rule W3. + for i, t := range s.types { + if t == AL { + s.types[i] = R + } + } + + // Rule W4. + // Since there must be values on both sides for this rule to have an + // effect, the scan skips the first and last value. + // + // Although the scan proceeds left to right, and changes the type + // values in a way that would appear to affect the computations + // later in the scan, there is actually no problem. A change in the + // current value can only affect the value to its immediate right, + // and only affect it if it is ES or CS. But the current value can + // only change if the value to its right is not ES or CS. Thus + // either the current value will not change, or its change will have + // no effect on the remainder of the analysis. + + for i := 1; i < s.Len()-1; i++ { + t := s.types[i] + if t == ES || t == CS { + prevSepType := s.types[i-1] + succSepType := s.types[i+1] + if prevSepType == EN && succSepType == EN { + s.types[i] = EN + } else if s.types[i] == CS && prevSepType == AN && succSepType == AN { + s.types[i] = AN + } + } + } + + // Rule W5. + for i, t := range s.types { + if t == ET { + // locate end of sequence + runStart := i + runEnd := s.findRunLimit(runStart, ET) + + // check values at ends of sequence + t := s.sos + if runStart > 0 { + t = s.types[runStart-1] + } + if t != EN { + t = s.eos + if runEnd < len(s.types) { + t = s.types[runEnd] + } + } + if t == EN { + setTypes(s.types[runStart:runEnd], EN) + } + // continue at end of sequence + i = runEnd + } + } + + // Rule W6. + for i, t := range s.types { + if t.in(ES, ET, CS) { + s.types[i] = ON + } + } + + // Rule W7. + for i, t := range s.types { + if t == EN { + // set default if we reach start of run + prevStrongType := s.sos + for j := i - 1; j >= 0; j-- { + t = s.types[j] + if t == L || t == R { // AL's have been changed to R + prevStrongType = t + break + } + } + if prevStrongType == L { + s.types[i] = L + } + } + } +} + +// 6) resolving neutral types Rules N1-N2. +func (s *isolatingRunSequence) resolveNeutralTypes() { + + // on entry, only these types can be in resultTypes + s.assertOnly(L, R, EN, AN, B, S, WS, ON, RLI, LRI, FSI, PDI) + + for i, t := range s.types { + switch t { + case WS, ON, B, S, RLI, LRI, FSI, PDI: + // find bounds of run of neutrals + runStart := i + runEnd := s.findRunLimit(runStart, B, S, WS, ON, RLI, LRI, FSI, PDI) + + // determine effective types at ends of run + var leadType, trailType Class + + // Note that the character found can only be L, R, AN, or + // EN. + if runStart == 0 { + leadType = s.sos + } else { + leadType = s.types[runStart-1] + if leadType.in(AN, EN) { + leadType = R + } + } + if runEnd == len(s.types) { + trailType = s.eos + } else { + trailType = s.types[runEnd] + if trailType.in(AN, EN) { + trailType = R + } + } + + var resolvedType Class + if leadType == trailType { + // Rule N1. + resolvedType = leadType + } else { + // Rule N2. + // Notice the embedding level of the run is used, not + // the paragraph embedding level. + resolvedType = typeForLevel(s.level) + } + + setTypes(s.types[runStart:runEnd], resolvedType) + + // skip over run of (former) neutrals + i = runEnd + } + } +} + +func setLevels(levels []level, newLevel level) { + for i := range levels { + levels[i] = newLevel + } +} + +func setTypes(types []Class, newType Class) { + for i := range types { + types[i] = newType + } +} + +// 7) resolving implicit embedding levels Rules I1, I2. +func (s *isolatingRunSequence) resolveImplicitLevels() { + + // on entry, only these types can be in resultTypes + s.assertOnly(L, R, EN, AN) + + s.resolvedLevels = make([]level, len(s.types)) + setLevels(s.resolvedLevels, s.level) + + if (s.level & 1) == 0 { // even level + for i, t := range s.types { + // Rule I1. + if t == L { + // no change + } else if t == R { + s.resolvedLevels[i] += 1 + } else { // t == AN || t == EN + s.resolvedLevels[i] += 2 + } + } + } else { // odd level + for i, t := range s.types { + // Rule I2. + if t == R { + // no change + } else { // t == L || t == AN || t == EN + s.resolvedLevels[i] += 1 + } + } + } +} + +// Applies the levels and types resolved in rules W1-I2 to the +// resultLevels array. +func (s *isolatingRunSequence) applyLevelsAndTypes() { + for i, x := range s.indexes { + s.p.resultTypes[x] = s.types[i] + s.p.resultLevels[x] = s.resolvedLevels[i] + } +} + +// Return the limit of the run consisting only of the types in validSet +// starting at index. This checks the value at index, and will return +// index if that value is not in validSet. +func (s *isolatingRunSequence) findRunLimit(index int, validSet ...Class) int { +loop: + for ; index < len(s.types); index++ { + t := s.types[index] + for _, valid := range validSet { + if t == valid { + continue loop + } + } + return index // didn't find a match in validSet + } + return len(s.types) +} + +// Algorithm validation. Assert that all values in types are in the +// provided set. +func (s *isolatingRunSequence) assertOnly(codes ...Class) { +loop: + for i, t := range s.types { + for _, c := range codes { + if t == c { + continue loop + } + } + log.Panicf("invalid bidi code %s present in assertOnly at position %d", t, s.indexes[i]) + } +} + +// determineLevelRuns returns an array of level runs. Each level run is +// described as an array of indexes into the input string. +// +// Determines the level runs. Rule X9 will be applied in determining the +// runs, in the way that makes sure the characters that are supposed to be +// removed are not included in the runs. +func (p *paragraph) determineLevelRuns() [][]int { + run := []int{} + allRuns := [][]int{} + currentLevel := implicitLevel + + for i := range p.initialTypes { + if !isRemovedByX9(p.initialTypes[i]) { + if p.resultLevels[i] != currentLevel { + // we just encountered a new run; wrap up last run + if currentLevel >= 0 { // only wrap it up if there was a run + allRuns = append(allRuns, run) + run = nil + } + // Start new run + currentLevel = p.resultLevels[i] + } + run = append(run, i) + } + } + // Wrap up the final run, if any + if len(run) > 0 { + allRuns = append(allRuns, run) + } + return allRuns +} + +// Definition BD13. Determine isolating run sequences. +func (p *paragraph) determineIsolatingRunSequences() []*isolatingRunSequence { + levelRuns := p.determineLevelRuns() + + // Compute the run that each character belongs to + runForCharacter := make([]int, p.Len()) + for i, run := range levelRuns { + for _, index := range run { + runForCharacter[index] = i + } + } + + sequences := []*isolatingRunSequence{} + + var currentRunSequence []int + + for _, run := range levelRuns { + first := run[0] + if p.initialTypes[first] != PDI || p.matchingIsolateInitiator[first] == -1 { + currentRunSequence = nil + // int run = i; + for { + // Copy this level run into currentRunSequence + currentRunSequence = append(currentRunSequence, run...) + + last := currentRunSequence[len(currentRunSequence)-1] + lastT := p.initialTypes[last] + if lastT.in(LRI, RLI, FSI) && p.matchingPDI[last] != p.Len() { + run = levelRuns[runForCharacter[p.matchingPDI[last]]] + } else { + break + } + } + sequences = append(sequences, p.isolatingRunSequence(currentRunSequence)) + } + } + return sequences +} + +// Assign level information to characters removed by rule X9. This is for +// ease of relating the level information to the original input data. Note +// that the levels assigned to these codes are arbitrary, they're chosen so +// as to avoid breaking level runs. +func (p *paragraph) assignLevelsToCharactersRemovedByX9() { + for i, t := range p.initialTypes { + if t.in(LRE, RLE, LRO, RLO, PDF, BN) { + p.resultTypes[i] = t + p.resultLevels[i] = -1 + } + } + // now propagate forward the levels information (could have + // propagated backward, the main thing is not to introduce a level + // break where one doesn't already exist). + + if p.resultLevels[0] == -1 { + p.resultLevels[0] = p.embeddingLevel + } + for i := 1; i < len(p.initialTypes); i++ { + if p.resultLevels[i] == -1 { + p.resultLevels[i] = p.resultLevels[i-1] + } + } + // Embedding information is for informational purposes only so need not be + // adjusted. +} + +// +// Output +// + +// getLevels computes levels array breaking lines at offsets in linebreaks. +// Rule L1. +// +// The linebreaks array must include at least one value. The values must be +// in strictly increasing order (no duplicates) between 1 and the length of +// the text, inclusive. The last value must be the length of the text. +func (p *paragraph) getLevels(linebreaks []int) []level { + // Note that since the previous processing has removed all + // P, S, and WS values from resultTypes, the values referred to + // in these rules are the initial types, before any processing + // has been applied (including processing of overrides). + // + // This example implementation has reinserted explicit format codes + // and BN, in order that the levels array correspond to the + // initial text. Their final placement is not normative. + // These codes are treated like WS in this implementation, + // so they don't interrupt sequences of WS. + + validateLineBreaks(linebreaks, p.Len()) + + result := append([]level(nil), p.resultLevels...) + + // don't worry about linebreaks since if there is a break within + // a series of WS values preceding S, the linebreak itself + // causes the reset. + for i, t := range p.initialTypes { + if t.in(B, S) { + // Rule L1, clauses one and two. + result[i] = p.embeddingLevel + + // Rule L1, clause three. + for j := i - 1; j >= 0; j-- { + if isWhitespace(p.initialTypes[j]) { // including format codes + result[j] = p.embeddingLevel + } else { + break + } + } + } + } + + // Rule L1, clause four. + start := 0 + for _, limit := range linebreaks { + for j := limit - 1; j >= start; j-- { + if isWhitespace(p.initialTypes[j]) { // including format codes + result[j] = p.embeddingLevel + } else { + break + } + } + start = limit + } + + return result +} + +// getReordering returns the reordering of lines from a visual index to a +// logical index for line breaks at the given offsets. +// +// Lines are concatenated from left to right. So for example, the fifth +// character from the left on the third line is +// +// getReordering(linebreaks)[linebreaks[1] + 4] +// +// (linebreaks[1] is the position after the last character of the second +// line, which is also the index of the first character on the third line, +// and adding four gets the fifth character from the left). +// +// The linebreaks array must include at least one value. The values must be +// in strictly increasing order (no duplicates) between 1 and the length of +// the text, inclusive. The last value must be the length of the text. +func (p *paragraph) getReordering(linebreaks []int) []int { + validateLineBreaks(linebreaks, p.Len()) + + return computeMultilineReordering(p.getLevels(linebreaks), linebreaks) +} + +// Return multiline reordering array for a given level array. Reordering +// does not occur across a line break. +func computeMultilineReordering(levels []level, linebreaks []int) []int { + result := make([]int, len(levels)) + + start := 0 + for _, limit := range linebreaks { + tempLevels := make([]level, limit-start) + copy(tempLevels, levels[start:]) + + for j, order := range computeReordering(tempLevels) { + result[start+j] = order + start + } + start = limit + } + return result +} + +// Return reordering array for a given level array. This reorders a single +// line. The reordering is a visual to logical map. For example, the +// leftmost char is string.charAt(order[0]). Rule L2. +func computeReordering(levels []level) []int { + result := make([]int, len(levels)) + // initialize order + for i := range result { + result[i] = i + } + + // locate highest level found on line. + // Note the rules say text, but no reordering across line bounds is + // performed, so this is sufficient. + highestLevel := level(0) + lowestOddLevel := level(maxDepth + 2) + for _, level := range levels { + if level > highestLevel { + highestLevel = level + } + if level&1 != 0 && level < lowestOddLevel { + lowestOddLevel = level + } + } + + for level := highestLevel; level >= lowestOddLevel; level-- { + for i := 0; i < len(levels); i++ { + if levels[i] >= level { + // find range of text at or above this level + start := i + limit := i + 1 + for limit < len(levels) && levels[limit] >= level { + limit++ + } + + for j, k := start, limit-1; j < k; j, k = j+1, k-1 { + result[j], result[k] = result[k], result[j] + } + // skip to end of level run + i = limit + } + } + } + + return result +} + +// isWhitespace reports whether the type is considered a whitespace type for the +// line break rules. +func isWhitespace(c Class) bool { + switch c { + case LRE, RLE, LRO, RLO, PDF, LRI, RLI, FSI, PDI, BN, WS: + return true + } + return false +} + +// isRemovedByX9 reports whether the type is one of the types removed in X9. +func isRemovedByX9(c Class) bool { + switch c { + case LRE, RLE, LRO, RLO, PDF, BN: + return true + } + return false +} + +// typeForLevel reports the strong type (L or R) corresponding to the level. +func typeForLevel(level level) Class { + if (level & 0x1) == 0 { + return L + } + return R +} + +// TODO: change validation to not panic + +func validateTypes(types []Class) { + if len(types) == 0 { + log.Panic("types is null") + } + for i, t := range types[:len(types)-1] { + if t == B { + log.Panicf("B type before end of paragraph at index: %d", i) + } + } +} + +func validateParagraphEmbeddingLevel(embeddingLevel level) { + if embeddingLevel != implicitLevel && + embeddingLevel != 0 && + embeddingLevel != 1 { + log.Panicf("illegal paragraph embedding level: %d", embeddingLevel) + } +} + +func validateLineBreaks(linebreaks []int, textLength int) { + prev := 0 + for i, next := range linebreaks { + if next <= prev { + log.Panicf("bad linebreak: %d at index: %d", next, i) + } + prev = next + } + if prev != textLength { + log.Panicf("last linebreak was %d, want %d", prev, textLength) + } +} + +func validatePbTypes(pairTypes []bracketType) { + if len(pairTypes) == 0 { + log.Panic("pairTypes is null") + } + for i, pt := range pairTypes { + switch pt { + case bpNone, bpOpen, bpClose: + default: + log.Panicf("illegal pairType value at %d: %v", i, pairTypes[i]) + } + } +} + +func validatePbValues(pairValues []rune, pairTypes []bracketType) { + if pairValues == nil { + log.Panic("pairValues is null") + } + if len(pairTypes) != len(pairValues) { + log.Panic("pairTypes is different length from pairValues") + } +} diff --git a/vendor/golang.org/x/text/unicode/bidi/gen.go b/vendor/golang.org/x/text/unicode/bidi/gen.go new file mode 100644 index 000000000..040f3013d --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/gen.go @@ -0,0 +1,133 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +import ( + "flag" + "log" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/internal/triegen" + "golang.org/x/text/internal/ucd" +) + +var outputFile = flag.String("out", "tables.go", "output file") + +func main() { + gen.Init() + gen.Repackage("gen_trieval.go", "trieval.go", "bidi") + gen.Repackage("gen_ranges.go", "ranges_test.go", "bidi") + + genTables() +} + +// bidiClass names and codes taken from class "bc" in +// http://www.unicode.org/Public/8.0.0/ucd/PropertyValueAliases.txt +var bidiClass = map[string]Class{ + "AL": AL, // ArabicLetter + "AN": AN, // ArabicNumber + "B": B, // ParagraphSeparator + "BN": BN, // BoundaryNeutral + "CS": CS, // CommonSeparator + "EN": EN, // EuropeanNumber + "ES": ES, // EuropeanSeparator + "ET": ET, // EuropeanTerminator + "L": L, // LeftToRight + "NSM": NSM, // NonspacingMark + "ON": ON, // OtherNeutral + "R": R, // RightToLeft + "S": S, // SegmentSeparator + "WS": WS, // WhiteSpace + + "FSI": Control, + "PDF": Control, + "PDI": Control, + "LRE": Control, + "LRI": Control, + "LRO": Control, + "RLE": Control, + "RLI": Control, + "RLO": Control, +} + +func genTables() { + if numClass > 0x0F { + log.Fatalf("Too many Class constants (%#x > 0x0F).", numClass) + } + w := gen.NewCodeWriter() + defer w.WriteGoFile(*outputFile, "bidi") + + gen.WriteUnicodeVersion(w) + + t := triegen.NewTrie("bidi") + + // Build data about bracket mapping. These bits need to be or-ed with + // any other bits. + orMask := map[rune]uint64{} + + xorMap := map[rune]int{} + xorMasks := []rune{0} // First value is no-op. + + ucd.Parse(gen.OpenUCDFile("BidiBrackets.txt"), func(p *ucd.Parser) { + r1 := p.Rune(0) + r2 := p.Rune(1) + xor := r1 ^ r2 + if _, ok := xorMap[xor]; !ok { + xorMap[xor] = len(xorMasks) + xorMasks = append(xorMasks, xor) + } + entry := uint64(xorMap[xor]) << xorMaskShift + switch p.String(2) { + case "o": + entry |= openMask + case "c", "n": + default: + log.Fatalf("Unknown bracket class %q.", p.String(2)) + } + orMask[r1] = entry + }) + + w.WriteComment(` + xorMasks contains masks to be xor-ed with brackets to get the reverse + version.`) + w.WriteVar("xorMasks", xorMasks) + + done := map[rune]bool{} + + insert := func(r rune, c Class) { + if !done[r] { + t.Insert(r, orMask[r]|uint64(c)) + done[r] = true + } + } + + // Insert the derived BiDi properties. + ucd.Parse(gen.OpenUCDFile("extracted/DerivedBidiClass.txt"), func(p *ucd.Parser) { + r := p.Rune(0) + class, ok := bidiClass[p.String(1)] + if !ok { + log.Fatalf("%U: Unknown BiDi class %q", r, p.String(1)) + } + insert(r, class) + }) + visitDefaults(insert) + + // TODO: use sparse blocks. This would reduce table size considerably + // from the looks of it. + + sz, err := t.Gen(w) + if err != nil { + log.Fatal(err) + } + w.Size += sz +} + +// dummy values to make methods in gen_common compile. The real versions +// will be generated by this file to tables.go. +var ( + xorMasks []rune +) diff --git a/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go b/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go new file mode 100644 index 000000000..51bd68fa7 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go @@ -0,0 +1,57 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +import ( + "unicode" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/internal/ucd" + "golang.org/x/text/unicode/rangetable" +) + +// These tables are hand-extracted from: +// http://www.unicode.org/Public/8.0.0/ucd/extracted/DerivedBidiClass.txt +func visitDefaults(fn func(r rune, c Class)) { + // first write default values for ranges listed above. + visitRunes(fn, AL, []rune{ + 0x0600, 0x07BF, // Arabic + 0x08A0, 0x08FF, // Arabic Extended-A + 0xFB50, 0xFDCF, // Arabic Presentation Forms + 0xFDF0, 0xFDFF, + 0xFE70, 0xFEFF, + 0x0001EE00, 0x0001EEFF, // Arabic Mathematical Alpha Symbols + }) + visitRunes(fn, R, []rune{ + 0x0590, 0x05FF, // Hebrew + 0x07C0, 0x089F, // Nko et al. + 0xFB1D, 0xFB4F, + 0x00010800, 0x00010FFF, // Cypriot Syllabary et. al. + 0x0001E800, 0x0001EDFF, + 0x0001EF00, 0x0001EFFF, + }) + visitRunes(fn, ET, []rune{ // European Terminator + 0x20A0, 0x20Cf, // Currency symbols + }) + rangetable.Visit(unicode.Noncharacter_Code_Point, func(r rune) { + fn(r, BN) // Boundary Neutral + }) + ucd.Parse(gen.OpenUCDFile("DerivedCoreProperties.txt"), func(p *ucd.Parser) { + if p.String(1) == "Default_Ignorable_Code_Point" { + fn(p.Rune(0), BN) // Boundary Neutral + } + }) +} + +func visitRunes(fn func(r rune, c Class), c Class, runes []rune) { + for i := 0; i < len(runes); i += 2 { + lo, hi := runes[i], runes[i+1] + for j := lo; j <= hi; j++ { + fn(j, c) + } + } +} diff --git a/vendor/golang.org/x/text/unicode/bidi/gen_trieval.go b/vendor/golang.org/x/text/unicode/bidi/gen_trieval.go new file mode 100644 index 000000000..9cb994289 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/gen_trieval.go @@ -0,0 +1,64 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +// Class is the Unicode BiDi class. Each rune has a single class. +type Class uint + +const ( + L Class = iota // LeftToRight + R // RightToLeft + EN // EuropeanNumber + ES // EuropeanSeparator + ET // EuropeanTerminator + AN // ArabicNumber + CS // CommonSeparator + B // ParagraphSeparator + S // SegmentSeparator + WS // WhiteSpace + ON // OtherNeutral + BN // BoundaryNeutral + NSM // NonspacingMark + AL // ArabicLetter + Control // Control LRO - PDI + + numClass + + LRO // LeftToRightOverride + RLO // RightToLeftOverride + LRE // LeftToRightEmbedding + RLE // RightToLeftEmbedding + PDF // PopDirectionalFormat + LRI // LeftToRightIsolate + RLI // RightToLeftIsolate + FSI // FirstStrongIsolate + PDI // PopDirectionalIsolate + + unknownClass = ^Class(0) +) + +var controlToClass = map[rune]Class{ + 0x202D: LRO, // LeftToRightOverride, + 0x202E: RLO, // RightToLeftOverride, + 0x202A: LRE, // LeftToRightEmbedding, + 0x202B: RLE, // RightToLeftEmbedding, + 0x202C: PDF, // PopDirectionalFormat, + 0x2066: LRI, // LeftToRightIsolate, + 0x2067: RLI, // RightToLeftIsolate, + 0x2068: FSI, // FirstStrongIsolate, + 0x2069: PDI, // PopDirectionalIsolate, +} + +// A trie entry has the following bits: +// 7..5 XOR mask for brackets +// 4 1: Bracket open, 0: Bracket close +// 3..0 Class type + +const ( + openMask = 0x10 + xorMaskShift = 5 +) diff --git a/vendor/golang.org/x/text/unicode/bidi/prop.go b/vendor/golang.org/x/text/unicode/bidi/prop.go new file mode 100644 index 000000000..7c9484e1f --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/prop.go @@ -0,0 +1,206 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package bidi + +import "unicode/utf8" + +// Properties provides access to BiDi properties of runes. +type Properties struct { + entry uint8 + last uint8 +} + +var trie = newBidiTrie(0) + +// TODO: using this for bidirule reduces the running time by about 5%. Consider +// if this is worth exposing or if we can find a way to speed up the Class +// method. +// +// // CompactClass is like Class, but maps all of the BiDi control classes +// // (LRO, RLO, LRE, RLE, PDF, LRI, RLI, FSI, PDI) to the class Control. +// func (p Properties) CompactClass() Class { +// return Class(p.entry & 0x0F) +// } + +// Class returns the Bidi class for p. +func (p Properties) Class() Class { + c := Class(p.entry & 0x0F) + if c == Control { + c = controlByteToClass[p.last&0xF] + } + return c +} + +// IsBracket reports whether the rune is a bracket. +func (p Properties) IsBracket() bool { return p.entry&0xF0 != 0 } + +// IsOpeningBracket reports whether the rune is an opening bracket. +// IsBracket must return true. +func (p Properties) IsOpeningBracket() bool { return p.entry&openMask != 0 } + +// TODO: find a better API and expose. +func (p Properties) reverseBracket(r rune) rune { + return xorMasks[p.entry>>xorMaskShift] ^ r +} + +var controlByteToClass = [16]Class{ + 0xD: LRO, // U+202D LeftToRightOverride, + 0xE: RLO, // U+202E RightToLeftOverride, + 0xA: LRE, // U+202A LeftToRightEmbedding, + 0xB: RLE, // U+202B RightToLeftEmbedding, + 0xC: PDF, // U+202C PopDirectionalFormat, + 0x6: LRI, // U+2066 LeftToRightIsolate, + 0x7: RLI, // U+2067 RightToLeftIsolate, + 0x8: FSI, // U+2068 FirstStrongIsolate, + 0x9: PDI, // U+2069 PopDirectionalIsolate, +} + +// LookupRune returns properties for r. +func LookupRune(r rune) (p Properties, size int) { + var buf [4]byte + n := utf8.EncodeRune(buf[:], r) + return Lookup(buf[:n]) +} + +// TODO: these lookup methods are based on the generated trie code. The returned +// sizes have slightly different semantics from the generated code, in that it +// always returns size==1 for an illegal UTF-8 byte (instead of the length +// of the maximum invalid subsequence). Most Transformers, like unicode/norm, +// leave invalid UTF-8 untouched, in which case it has performance benefits to +// do so (without changing the semantics). Bidi requires the semantics used here +// for the bidirule implementation to be compatible with the Go semantics. +// They ultimately should perhaps be adopted by all trie implementations, for +// convenience sake. +// This unrolled code also boosts performance of the secure/bidirule package by +// about 30%. +// So, to remove this code: +// - add option to trie generator to define return type. +// - always return 1 byte size for ill-formed UTF-8 runes. + +// Lookup returns properties for the first rune in s and the width in bytes of +// its encoding. The size will be 0 if s does not hold enough bytes to complete +// the encoding. +func Lookup(s []byte) (p Properties, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return Properties{entry: bidiValues[c0]}, 1 + case c0 < 0xC2: + return Properties{}, 1 + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return Properties{}, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return Properties{}, 1 + } + return Properties{entry: trie.lookupValue(uint32(i), c1)}, 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return Properties{}, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return Properties{}, 1 + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return Properties{}, 1 + } + return Properties{entry: trie.lookupValue(uint32(i), c2), last: c2}, 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return Properties{}, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return Properties{}, 1 + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return Properties{}, 1 + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return Properties{}, 1 + } + return Properties{entry: trie.lookupValue(uint32(i), c3)}, 4 + } + // Illegal rune + return Properties{}, 1 +} + +// LookupString returns properties for the first rune in s and the width in +// bytes of its encoding. The size will be 0 if s does not hold enough bytes to +// complete the encoding. +func LookupString(s string) (p Properties, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return Properties{entry: bidiValues[c0]}, 1 + case c0 < 0xC2: + return Properties{}, 1 + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return Properties{}, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return Properties{}, 1 + } + return Properties{entry: trie.lookupValue(uint32(i), c1)}, 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return Properties{}, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return Properties{}, 1 + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return Properties{}, 1 + } + return Properties{entry: trie.lookupValue(uint32(i), c2), last: c2}, 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return Properties{}, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return Properties{}, 1 + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return Properties{}, 1 + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return Properties{}, 1 + } + return Properties{entry: trie.lookupValue(uint32(i), c3)}, 4 + } + // Illegal rune + return Properties{}, 1 +} diff --git a/vendor/golang.org/x/text/unicode/bidi/tables.go b/vendor/golang.org/x/text/unicode/bidi/tables.go new file mode 100644 index 000000000..2d4dde07c --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/tables.go @@ -0,0 +1,1779 @@ +// This file was generated by go generate; DO NOT EDIT + +package bidi + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "9.0.0" + +// xorMasks contains masks to be xor-ed with brackets to get the reverse +// version. +var xorMasks = []int32{ // 8 elements + 0, 1, 6, 7, 3, 15, 29, 63, +} // Size: 56 bytes + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookup(s []byte) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupUnsafe(s []byte) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookupString(s string) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupStringUnsafe(s string) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// bidiTrie. Total size: 15744 bytes (15.38 KiB). Checksum: b4c3b70954803b86. +type bidiTrie struct{} + +func newBidiTrie(i int) *bidiTrie { + return &bidiTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *bidiTrie) lookupValue(n uint32, b byte) uint8 { + switch { + default: + return uint8(bidiValues[n<<6+uint32(b)]) + } +} + +// bidiValues: 222 blocks, 14208 entries, 14208 bytes +// The third block is the zero block. +var bidiValues = [14208]uint8{ + // Block 0x0, offset 0x0 + 0x00: 0x000b, 0x01: 0x000b, 0x02: 0x000b, 0x03: 0x000b, 0x04: 0x000b, 0x05: 0x000b, + 0x06: 0x000b, 0x07: 0x000b, 0x08: 0x000b, 0x09: 0x0008, 0x0a: 0x0007, 0x0b: 0x0008, + 0x0c: 0x0009, 0x0d: 0x0007, 0x0e: 0x000b, 0x0f: 0x000b, 0x10: 0x000b, 0x11: 0x000b, + 0x12: 0x000b, 0x13: 0x000b, 0x14: 0x000b, 0x15: 0x000b, 0x16: 0x000b, 0x17: 0x000b, + 0x18: 0x000b, 0x19: 0x000b, 0x1a: 0x000b, 0x1b: 0x000b, 0x1c: 0x0007, 0x1d: 0x0007, + 0x1e: 0x0007, 0x1f: 0x0008, 0x20: 0x0009, 0x21: 0x000a, 0x22: 0x000a, 0x23: 0x0004, + 0x24: 0x0004, 0x25: 0x0004, 0x26: 0x000a, 0x27: 0x000a, 0x28: 0x003a, 0x29: 0x002a, + 0x2a: 0x000a, 0x2b: 0x0003, 0x2c: 0x0006, 0x2d: 0x0003, 0x2e: 0x0006, 0x2f: 0x0006, + 0x30: 0x0002, 0x31: 0x0002, 0x32: 0x0002, 0x33: 0x0002, 0x34: 0x0002, 0x35: 0x0002, + 0x36: 0x0002, 0x37: 0x0002, 0x38: 0x0002, 0x39: 0x0002, 0x3a: 0x0006, 0x3b: 0x000a, + 0x3c: 0x000a, 0x3d: 0x000a, 0x3e: 0x000a, 0x3f: 0x000a, + // Block 0x1, offset 0x40 + 0x40: 0x000a, + 0x5b: 0x005a, 0x5c: 0x000a, 0x5d: 0x004a, + 0x5e: 0x000a, 0x5f: 0x000a, 0x60: 0x000a, + 0x7b: 0x005a, + 0x7c: 0x000a, 0x7d: 0x004a, 0x7e: 0x000a, 0x7f: 0x000b, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x000b, 0xc1: 0x000b, 0xc2: 0x000b, 0xc3: 0x000b, 0xc4: 0x000b, 0xc5: 0x0007, + 0xc6: 0x000b, 0xc7: 0x000b, 0xc8: 0x000b, 0xc9: 0x000b, 0xca: 0x000b, 0xcb: 0x000b, + 0xcc: 0x000b, 0xcd: 0x000b, 0xce: 0x000b, 0xcf: 0x000b, 0xd0: 0x000b, 0xd1: 0x000b, + 0xd2: 0x000b, 0xd3: 0x000b, 0xd4: 0x000b, 0xd5: 0x000b, 0xd6: 0x000b, 0xd7: 0x000b, + 0xd8: 0x000b, 0xd9: 0x000b, 0xda: 0x000b, 0xdb: 0x000b, 0xdc: 0x000b, 0xdd: 0x000b, + 0xde: 0x000b, 0xdf: 0x000b, 0xe0: 0x0006, 0xe1: 0x000a, 0xe2: 0x0004, 0xe3: 0x0004, + 0xe4: 0x0004, 0xe5: 0x0004, 0xe6: 0x000a, 0xe7: 0x000a, 0xe8: 0x000a, 0xe9: 0x000a, + 0xeb: 0x000a, 0xec: 0x000a, 0xed: 0x000b, 0xee: 0x000a, 0xef: 0x000a, + 0xf0: 0x0004, 0xf1: 0x0004, 0xf2: 0x0002, 0xf3: 0x0002, 0xf4: 0x000a, + 0xf6: 0x000a, 0xf7: 0x000a, 0xf8: 0x000a, 0xf9: 0x0002, 0xfb: 0x000a, + 0xfc: 0x000a, 0xfd: 0x000a, 0xfe: 0x000a, 0xff: 0x000a, + // Block 0x4, offset 0x100 + 0x117: 0x000a, + 0x137: 0x000a, + // Block 0x5, offset 0x140 + 0x179: 0x000a, 0x17a: 0x000a, + // Block 0x6, offset 0x180 + 0x182: 0x000a, 0x183: 0x000a, 0x184: 0x000a, 0x185: 0x000a, + 0x186: 0x000a, 0x187: 0x000a, 0x188: 0x000a, 0x189: 0x000a, 0x18a: 0x000a, 0x18b: 0x000a, + 0x18c: 0x000a, 0x18d: 0x000a, 0x18e: 0x000a, 0x18f: 0x000a, + 0x192: 0x000a, 0x193: 0x000a, 0x194: 0x000a, 0x195: 0x000a, 0x196: 0x000a, 0x197: 0x000a, + 0x198: 0x000a, 0x199: 0x000a, 0x19a: 0x000a, 0x19b: 0x000a, 0x19c: 0x000a, 0x19d: 0x000a, + 0x19e: 0x000a, 0x19f: 0x000a, + 0x1a5: 0x000a, 0x1a6: 0x000a, 0x1a7: 0x000a, 0x1a8: 0x000a, 0x1a9: 0x000a, + 0x1aa: 0x000a, 0x1ab: 0x000a, 0x1ac: 0x000a, 0x1ad: 0x000a, 0x1af: 0x000a, + 0x1b0: 0x000a, 0x1b1: 0x000a, 0x1b2: 0x000a, 0x1b3: 0x000a, 0x1b4: 0x000a, 0x1b5: 0x000a, + 0x1b6: 0x000a, 0x1b7: 0x000a, 0x1b8: 0x000a, 0x1b9: 0x000a, 0x1ba: 0x000a, 0x1bb: 0x000a, + 0x1bc: 0x000a, 0x1bd: 0x000a, 0x1be: 0x000a, 0x1bf: 0x000a, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x000c, 0x1c1: 0x000c, 0x1c2: 0x000c, 0x1c3: 0x000c, 0x1c4: 0x000c, 0x1c5: 0x000c, + 0x1c6: 0x000c, 0x1c7: 0x000c, 0x1c8: 0x000c, 0x1c9: 0x000c, 0x1ca: 0x000c, 0x1cb: 0x000c, + 0x1cc: 0x000c, 0x1cd: 0x000c, 0x1ce: 0x000c, 0x1cf: 0x000c, 0x1d0: 0x000c, 0x1d1: 0x000c, + 0x1d2: 0x000c, 0x1d3: 0x000c, 0x1d4: 0x000c, 0x1d5: 0x000c, 0x1d6: 0x000c, 0x1d7: 0x000c, + 0x1d8: 0x000c, 0x1d9: 0x000c, 0x1da: 0x000c, 0x1db: 0x000c, 0x1dc: 0x000c, 0x1dd: 0x000c, + 0x1de: 0x000c, 0x1df: 0x000c, 0x1e0: 0x000c, 0x1e1: 0x000c, 0x1e2: 0x000c, 0x1e3: 0x000c, + 0x1e4: 0x000c, 0x1e5: 0x000c, 0x1e6: 0x000c, 0x1e7: 0x000c, 0x1e8: 0x000c, 0x1e9: 0x000c, + 0x1ea: 0x000c, 0x1eb: 0x000c, 0x1ec: 0x000c, 0x1ed: 0x000c, 0x1ee: 0x000c, 0x1ef: 0x000c, + 0x1f0: 0x000c, 0x1f1: 0x000c, 0x1f2: 0x000c, 0x1f3: 0x000c, 0x1f4: 0x000c, 0x1f5: 0x000c, + 0x1f6: 0x000c, 0x1f7: 0x000c, 0x1f8: 0x000c, 0x1f9: 0x000c, 0x1fa: 0x000c, 0x1fb: 0x000c, + 0x1fc: 0x000c, 0x1fd: 0x000c, 0x1fe: 0x000c, 0x1ff: 0x000c, + // Block 0x8, offset 0x200 + 0x200: 0x000c, 0x201: 0x000c, 0x202: 0x000c, 0x203: 0x000c, 0x204: 0x000c, 0x205: 0x000c, + 0x206: 0x000c, 0x207: 0x000c, 0x208: 0x000c, 0x209: 0x000c, 0x20a: 0x000c, 0x20b: 0x000c, + 0x20c: 0x000c, 0x20d: 0x000c, 0x20e: 0x000c, 0x20f: 0x000c, 0x210: 0x000c, 0x211: 0x000c, + 0x212: 0x000c, 0x213: 0x000c, 0x214: 0x000c, 0x215: 0x000c, 0x216: 0x000c, 0x217: 0x000c, + 0x218: 0x000c, 0x219: 0x000c, 0x21a: 0x000c, 0x21b: 0x000c, 0x21c: 0x000c, 0x21d: 0x000c, + 0x21e: 0x000c, 0x21f: 0x000c, 0x220: 0x000c, 0x221: 0x000c, 0x222: 0x000c, 0x223: 0x000c, + 0x224: 0x000c, 0x225: 0x000c, 0x226: 0x000c, 0x227: 0x000c, 0x228: 0x000c, 0x229: 0x000c, + 0x22a: 0x000c, 0x22b: 0x000c, 0x22c: 0x000c, 0x22d: 0x000c, 0x22e: 0x000c, 0x22f: 0x000c, + 0x234: 0x000a, 0x235: 0x000a, + 0x23e: 0x000a, + // Block 0x9, offset 0x240 + 0x244: 0x000a, 0x245: 0x000a, + 0x247: 0x000a, + // Block 0xa, offset 0x280 + 0x2b6: 0x000a, + // Block 0xb, offset 0x2c0 + 0x2c3: 0x000c, 0x2c4: 0x000c, 0x2c5: 0x000c, + 0x2c6: 0x000c, 0x2c7: 0x000c, 0x2c8: 0x000c, 0x2c9: 0x000c, + // Block 0xc, offset 0x300 + 0x30a: 0x000a, + 0x30d: 0x000a, 0x30e: 0x000a, 0x30f: 0x0004, 0x310: 0x0001, 0x311: 0x000c, + 0x312: 0x000c, 0x313: 0x000c, 0x314: 0x000c, 0x315: 0x000c, 0x316: 0x000c, 0x317: 0x000c, + 0x318: 0x000c, 0x319: 0x000c, 0x31a: 0x000c, 0x31b: 0x000c, 0x31c: 0x000c, 0x31d: 0x000c, + 0x31e: 0x000c, 0x31f: 0x000c, 0x320: 0x000c, 0x321: 0x000c, 0x322: 0x000c, 0x323: 0x000c, + 0x324: 0x000c, 0x325: 0x000c, 0x326: 0x000c, 0x327: 0x000c, 0x328: 0x000c, 0x329: 0x000c, + 0x32a: 0x000c, 0x32b: 0x000c, 0x32c: 0x000c, 0x32d: 0x000c, 0x32e: 0x000c, 0x32f: 0x000c, + 0x330: 0x000c, 0x331: 0x000c, 0x332: 0x000c, 0x333: 0x000c, 0x334: 0x000c, 0x335: 0x000c, + 0x336: 0x000c, 0x337: 0x000c, 0x338: 0x000c, 0x339: 0x000c, 0x33a: 0x000c, 0x33b: 0x000c, + 0x33c: 0x000c, 0x33d: 0x000c, 0x33e: 0x0001, 0x33f: 0x000c, + // Block 0xd, offset 0x340 + 0x340: 0x0001, 0x341: 0x000c, 0x342: 0x000c, 0x343: 0x0001, 0x344: 0x000c, 0x345: 0x000c, + 0x346: 0x0001, 0x347: 0x000c, 0x348: 0x0001, 0x349: 0x0001, 0x34a: 0x0001, 0x34b: 0x0001, + 0x34c: 0x0001, 0x34d: 0x0001, 0x34e: 0x0001, 0x34f: 0x0001, 0x350: 0x0001, 0x351: 0x0001, + 0x352: 0x0001, 0x353: 0x0001, 0x354: 0x0001, 0x355: 0x0001, 0x356: 0x0001, 0x357: 0x0001, + 0x358: 0x0001, 0x359: 0x0001, 0x35a: 0x0001, 0x35b: 0x0001, 0x35c: 0x0001, 0x35d: 0x0001, + 0x35e: 0x0001, 0x35f: 0x0001, 0x360: 0x0001, 0x361: 0x0001, 0x362: 0x0001, 0x363: 0x0001, + 0x364: 0x0001, 0x365: 0x0001, 0x366: 0x0001, 0x367: 0x0001, 0x368: 0x0001, 0x369: 0x0001, + 0x36a: 0x0001, 0x36b: 0x0001, 0x36c: 0x0001, 0x36d: 0x0001, 0x36e: 0x0001, 0x36f: 0x0001, + 0x370: 0x0001, 0x371: 0x0001, 0x372: 0x0001, 0x373: 0x0001, 0x374: 0x0001, 0x375: 0x0001, + 0x376: 0x0001, 0x377: 0x0001, 0x378: 0x0001, 0x379: 0x0001, 0x37a: 0x0001, 0x37b: 0x0001, + 0x37c: 0x0001, 0x37d: 0x0001, 0x37e: 0x0001, 0x37f: 0x0001, + // Block 0xe, offset 0x380 + 0x380: 0x0005, 0x381: 0x0005, 0x382: 0x0005, 0x383: 0x0005, 0x384: 0x0005, 0x385: 0x0005, + 0x386: 0x000a, 0x387: 0x000a, 0x388: 0x000d, 0x389: 0x0004, 0x38a: 0x0004, 0x38b: 0x000d, + 0x38c: 0x0006, 0x38d: 0x000d, 0x38e: 0x000a, 0x38f: 0x000a, 0x390: 0x000c, 0x391: 0x000c, + 0x392: 0x000c, 0x393: 0x000c, 0x394: 0x000c, 0x395: 0x000c, 0x396: 0x000c, 0x397: 0x000c, + 0x398: 0x000c, 0x399: 0x000c, 0x39a: 0x000c, 0x39b: 0x000d, 0x39c: 0x000d, 0x39d: 0x000d, + 0x39e: 0x000d, 0x39f: 0x000d, 0x3a0: 0x000d, 0x3a1: 0x000d, 0x3a2: 0x000d, 0x3a3: 0x000d, + 0x3a4: 0x000d, 0x3a5: 0x000d, 0x3a6: 0x000d, 0x3a7: 0x000d, 0x3a8: 0x000d, 0x3a9: 0x000d, + 0x3aa: 0x000d, 0x3ab: 0x000d, 0x3ac: 0x000d, 0x3ad: 0x000d, 0x3ae: 0x000d, 0x3af: 0x000d, + 0x3b0: 0x000d, 0x3b1: 0x000d, 0x3b2: 0x000d, 0x3b3: 0x000d, 0x3b4: 0x000d, 0x3b5: 0x000d, + 0x3b6: 0x000d, 0x3b7: 0x000d, 0x3b8: 0x000d, 0x3b9: 0x000d, 0x3ba: 0x000d, 0x3bb: 0x000d, + 0x3bc: 0x000d, 0x3bd: 0x000d, 0x3be: 0x000d, 0x3bf: 0x000d, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x000d, 0x3c1: 0x000d, 0x3c2: 0x000d, 0x3c3: 0x000d, 0x3c4: 0x000d, 0x3c5: 0x000d, + 0x3c6: 0x000d, 0x3c7: 0x000d, 0x3c8: 0x000d, 0x3c9: 0x000d, 0x3ca: 0x000d, 0x3cb: 0x000c, + 0x3cc: 0x000c, 0x3cd: 0x000c, 0x3ce: 0x000c, 0x3cf: 0x000c, 0x3d0: 0x000c, 0x3d1: 0x000c, + 0x3d2: 0x000c, 0x3d3: 0x000c, 0x3d4: 0x000c, 0x3d5: 0x000c, 0x3d6: 0x000c, 0x3d7: 0x000c, + 0x3d8: 0x000c, 0x3d9: 0x000c, 0x3da: 0x000c, 0x3db: 0x000c, 0x3dc: 0x000c, 0x3dd: 0x000c, + 0x3de: 0x000c, 0x3df: 0x000c, 0x3e0: 0x0005, 0x3e1: 0x0005, 0x3e2: 0x0005, 0x3e3: 0x0005, + 0x3e4: 0x0005, 0x3e5: 0x0005, 0x3e6: 0x0005, 0x3e7: 0x0005, 0x3e8: 0x0005, 0x3e9: 0x0005, + 0x3ea: 0x0004, 0x3eb: 0x0005, 0x3ec: 0x0005, 0x3ed: 0x000d, 0x3ee: 0x000d, 0x3ef: 0x000d, + 0x3f0: 0x000c, 0x3f1: 0x000d, 0x3f2: 0x000d, 0x3f3: 0x000d, 0x3f4: 0x000d, 0x3f5: 0x000d, + 0x3f6: 0x000d, 0x3f7: 0x000d, 0x3f8: 0x000d, 0x3f9: 0x000d, 0x3fa: 0x000d, 0x3fb: 0x000d, + 0x3fc: 0x000d, 0x3fd: 0x000d, 0x3fe: 0x000d, 0x3ff: 0x000d, + // Block 0x10, offset 0x400 + 0x400: 0x000d, 0x401: 0x000d, 0x402: 0x000d, 0x403: 0x000d, 0x404: 0x000d, 0x405: 0x000d, + 0x406: 0x000d, 0x407: 0x000d, 0x408: 0x000d, 0x409: 0x000d, 0x40a: 0x000d, 0x40b: 0x000d, + 0x40c: 0x000d, 0x40d: 0x000d, 0x40e: 0x000d, 0x40f: 0x000d, 0x410: 0x000d, 0x411: 0x000d, + 0x412: 0x000d, 0x413: 0x000d, 0x414: 0x000d, 0x415: 0x000d, 0x416: 0x000d, 0x417: 0x000d, + 0x418: 0x000d, 0x419: 0x000d, 0x41a: 0x000d, 0x41b: 0x000d, 0x41c: 0x000d, 0x41d: 0x000d, + 0x41e: 0x000d, 0x41f: 0x000d, 0x420: 0x000d, 0x421: 0x000d, 0x422: 0x000d, 0x423: 0x000d, + 0x424: 0x000d, 0x425: 0x000d, 0x426: 0x000d, 0x427: 0x000d, 0x428: 0x000d, 0x429: 0x000d, + 0x42a: 0x000d, 0x42b: 0x000d, 0x42c: 0x000d, 0x42d: 0x000d, 0x42e: 0x000d, 0x42f: 0x000d, + 0x430: 0x000d, 0x431: 0x000d, 0x432: 0x000d, 0x433: 0x000d, 0x434: 0x000d, 0x435: 0x000d, + 0x436: 0x000d, 0x437: 0x000d, 0x438: 0x000d, 0x439: 0x000d, 0x43a: 0x000d, 0x43b: 0x000d, + 0x43c: 0x000d, 0x43d: 0x000d, 0x43e: 0x000d, 0x43f: 0x000d, + // Block 0x11, offset 0x440 + 0x440: 0x000d, 0x441: 0x000d, 0x442: 0x000d, 0x443: 0x000d, 0x444: 0x000d, 0x445: 0x000d, + 0x446: 0x000d, 0x447: 0x000d, 0x448: 0x000d, 0x449: 0x000d, 0x44a: 0x000d, 0x44b: 0x000d, + 0x44c: 0x000d, 0x44d: 0x000d, 0x44e: 0x000d, 0x44f: 0x000d, 0x450: 0x000d, 0x451: 0x000d, + 0x452: 0x000d, 0x453: 0x000d, 0x454: 0x000d, 0x455: 0x000d, 0x456: 0x000c, 0x457: 0x000c, + 0x458: 0x000c, 0x459: 0x000c, 0x45a: 0x000c, 0x45b: 0x000c, 0x45c: 0x000c, 0x45d: 0x0005, + 0x45e: 0x000a, 0x45f: 0x000c, 0x460: 0x000c, 0x461: 0x000c, 0x462: 0x000c, 0x463: 0x000c, + 0x464: 0x000c, 0x465: 0x000d, 0x466: 0x000d, 0x467: 0x000c, 0x468: 0x000c, 0x469: 0x000a, + 0x46a: 0x000c, 0x46b: 0x000c, 0x46c: 0x000c, 0x46d: 0x000c, 0x46e: 0x000d, 0x46f: 0x000d, + 0x470: 0x0002, 0x471: 0x0002, 0x472: 0x0002, 0x473: 0x0002, 0x474: 0x0002, 0x475: 0x0002, + 0x476: 0x0002, 0x477: 0x0002, 0x478: 0x0002, 0x479: 0x0002, 0x47a: 0x000d, 0x47b: 0x000d, + 0x47c: 0x000d, 0x47d: 0x000d, 0x47e: 0x000d, 0x47f: 0x000d, + // Block 0x12, offset 0x480 + 0x480: 0x000d, 0x481: 0x000d, 0x482: 0x000d, 0x483: 0x000d, 0x484: 0x000d, 0x485: 0x000d, + 0x486: 0x000d, 0x487: 0x000d, 0x488: 0x000d, 0x489: 0x000d, 0x48a: 0x000d, 0x48b: 0x000d, + 0x48c: 0x000d, 0x48d: 0x000d, 0x48e: 0x000d, 0x48f: 0x000d, 0x490: 0x000d, 0x491: 0x000c, + 0x492: 0x000d, 0x493: 0x000d, 0x494: 0x000d, 0x495: 0x000d, 0x496: 0x000d, 0x497: 0x000d, + 0x498: 0x000d, 0x499: 0x000d, 0x49a: 0x000d, 0x49b: 0x000d, 0x49c: 0x000d, 0x49d: 0x000d, + 0x49e: 0x000d, 0x49f: 0x000d, 0x4a0: 0x000d, 0x4a1: 0x000d, 0x4a2: 0x000d, 0x4a3: 0x000d, + 0x4a4: 0x000d, 0x4a5: 0x000d, 0x4a6: 0x000d, 0x4a7: 0x000d, 0x4a8: 0x000d, 0x4a9: 0x000d, + 0x4aa: 0x000d, 0x4ab: 0x000d, 0x4ac: 0x000d, 0x4ad: 0x000d, 0x4ae: 0x000d, 0x4af: 0x000d, + 0x4b0: 0x000c, 0x4b1: 0x000c, 0x4b2: 0x000c, 0x4b3: 0x000c, 0x4b4: 0x000c, 0x4b5: 0x000c, + 0x4b6: 0x000c, 0x4b7: 0x000c, 0x4b8: 0x000c, 0x4b9: 0x000c, 0x4ba: 0x000c, 0x4bb: 0x000c, + 0x4bc: 0x000c, 0x4bd: 0x000c, 0x4be: 0x000c, 0x4bf: 0x000c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x000c, 0x4c1: 0x000c, 0x4c2: 0x000c, 0x4c3: 0x000c, 0x4c4: 0x000c, 0x4c5: 0x000c, + 0x4c6: 0x000c, 0x4c7: 0x000c, 0x4c8: 0x000c, 0x4c9: 0x000c, 0x4ca: 0x000c, 0x4cb: 0x000d, + 0x4cc: 0x000d, 0x4cd: 0x000d, 0x4ce: 0x000d, 0x4cf: 0x000d, 0x4d0: 0x000d, 0x4d1: 0x000d, + 0x4d2: 0x000d, 0x4d3: 0x000d, 0x4d4: 0x000d, 0x4d5: 0x000d, 0x4d6: 0x000d, 0x4d7: 0x000d, + 0x4d8: 0x000d, 0x4d9: 0x000d, 0x4da: 0x000d, 0x4db: 0x000d, 0x4dc: 0x000d, 0x4dd: 0x000d, + 0x4de: 0x000d, 0x4df: 0x000d, 0x4e0: 0x000d, 0x4e1: 0x000d, 0x4e2: 0x000d, 0x4e3: 0x000d, + 0x4e4: 0x000d, 0x4e5: 0x000d, 0x4e6: 0x000d, 0x4e7: 0x000d, 0x4e8: 0x000d, 0x4e9: 0x000d, + 0x4ea: 0x000d, 0x4eb: 0x000d, 0x4ec: 0x000d, 0x4ed: 0x000d, 0x4ee: 0x000d, 0x4ef: 0x000d, + 0x4f0: 0x000d, 0x4f1: 0x000d, 0x4f2: 0x000d, 0x4f3: 0x000d, 0x4f4: 0x000d, 0x4f5: 0x000d, + 0x4f6: 0x000d, 0x4f7: 0x000d, 0x4f8: 0x000d, 0x4f9: 0x000d, 0x4fa: 0x000d, 0x4fb: 0x000d, + 0x4fc: 0x000d, 0x4fd: 0x000d, 0x4fe: 0x000d, 0x4ff: 0x000d, + // Block 0x14, offset 0x500 + 0x500: 0x000d, 0x501: 0x000d, 0x502: 0x000d, 0x503: 0x000d, 0x504: 0x000d, 0x505: 0x000d, + 0x506: 0x000d, 0x507: 0x000d, 0x508: 0x000d, 0x509: 0x000d, 0x50a: 0x000d, 0x50b: 0x000d, + 0x50c: 0x000d, 0x50d: 0x000d, 0x50e: 0x000d, 0x50f: 0x000d, 0x510: 0x000d, 0x511: 0x000d, + 0x512: 0x000d, 0x513: 0x000d, 0x514: 0x000d, 0x515: 0x000d, 0x516: 0x000d, 0x517: 0x000d, + 0x518: 0x000d, 0x519: 0x000d, 0x51a: 0x000d, 0x51b: 0x000d, 0x51c: 0x000d, 0x51d: 0x000d, + 0x51e: 0x000d, 0x51f: 0x000d, 0x520: 0x000d, 0x521: 0x000d, 0x522: 0x000d, 0x523: 0x000d, + 0x524: 0x000d, 0x525: 0x000d, 0x526: 0x000c, 0x527: 0x000c, 0x528: 0x000c, 0x529: 0x000c, + 0x52a: 0x000c, 0x52b: 0x000c, 0x52c: 0x000c, 0x52d: 0x000c, 0x52e: 0x000c, 0x52f: 0x000c, + 0x530: 0x000c, 0x531: 0x000d, 0x532: 0x000d, 0x533: 0x000d, 0x534: 0x000d, 0x535: 0x000d, + 0x536: 0x000d, 0x537: 0x000d, 0x538: 0x000d, 0x539: 0x000d, 0x53a: 0x000d, 0x53b: 0x000d, + 0x53c: 0x000d, 0x53d: 0x000d, 0x53e: 0x000d, 0x53f: 0x000d, + // Block 0x15, offset 0x540 + 0x540: 0x0001, 0x541: 0x0001, 0x542: 0x0001, 0x543: 0x0001, 0x544: 0x0001, 0x545: 0x0001, + 0x546: 0x0001, 0x547: 0x0001, 0x548: 0x0001, 0x549: 0x0001, 0x54a: 0x0001, 0x54b: 0x0001, + 0x54c: 0x0001, 0x54d: 0x0001, 0x54e: 0x0001, 0x54f: 0x0001, 0x550: 0x0001, 0x551: 0x0001, + 0x552: 0x0001, 0x553: 0x0001, 0x554: 0x0001, 0x555: 0x0001, 0x556: 0x0001, 0x557: 0x0001, + 0x558: 0x0001, 0x559: 0x0001, 0x55a: 0x0001, 0x55b: 0x0001, 0x55c: 0x0001, 0x55d: 0x0001, + 0x55e: 0x0001, 0x55f: 0x0001, 0x560: 0x0001, 0x561: 0x0001, 0x562: 0x0001, 0x563: 0x0001, + 0x564: 0x0001, 0x565: 0x0001, 0x566: 0x0001, 0x567: 0x0001, 0x568: 0x0001, 0x569: 0x0001, + 0x56a: 0x0001, 0x56b: 0x000c, 0x56c: 0x000c, 0x56d: 0x000c, 0x56e: 0x000c, 0x56f: 0x000c, + 0x570: 0x000c, 0x571: 0x000c, 0x572: 0x000c, 0x573: 0x000c, 0x574: 0x0001, 0x575: 0x0001, + 0x576: 0x000a, 0x577: 0x000a, 0x578: 0x000a, 0x579: 0x000a, 0x57a: 0x0001, 0x57b: 0x0001, + 0x57c: 0x0001, 0x57d: 0x0001, 0x57e: 0x0001, 0x57f: 0x0001, + // Block 0x16, offset 0x580 + 0x580: 0x0001, 0x581: 0x0001, 0x582: 0x0001, 0x583: 0x0001, 0x584: 0x0001, 0x585: 0x0001, + 0x586: 0x0001, 0x587: 0x0001, 0x588: 0x0001, 0x589: 0x0001, 0x58a: 0x0001, 0x58b: 0x0001, + 0x58c: 0x0001, 0x58d: 0x0001, 0x58e: 0x0001, 0x58f: 0x0001, 0x590: 0x0001, 0x591: 0x0001, + 0x592: 0x0001, 0x593: 0x0001, 0x594: 0x0001, 0x595: 0x0001, 0x596: 0x000c, 0x597: 0x000c, + 0x598: 0x000c, 0x599: 0x000c, 0x59a: 0x0001, 0x59b: 0x000c, 0x59c: 0x000c, 0x59d: 0x000c, + 0x59e: 0x000c, 0x59f: 0x000c, 0x5a0: 0x000c, 0x5a1: 0x000c, 0x5a2: 0x000c, 0x5a3: 0x000c, + 0x5a4: 0x0001, 0x5a5: 0x000c, 0x5a6: 0x000c, 0x5a7: 0x000c, 0x5a8: 0x0001, 0x5a9: 0x000c, + 0x5aa: 0x000c, 0x5ab: 0x000c, 0x5ac: 0x000c, 0x5ad: 0x000c, 0x5ae: 0x0001, 0x5af: 0x0001, + 0x5b0: 0x0001, 0x5b1: 0x0001, 0x5b2: 0x0001, 0x5b3: 0x0001, 0x5b4: 0x0001, 0x5b5: 0x0001, + 0x5b6: 0x0001, 0x5b7: 0x0001, 0x5b8: 0x0001, 0x5b9: 0x0001, 0x5ba: 0x0001, 0x5bb: 0x0001, + 0x5bc: 0x0001, 0x5bd: 0x0001, 0x5be: 0x0001, 0x5bf: 0x0001, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x0001, 0x5c1: 0x0001, 0x5c2: 0x0001, 0x5c3: 0x0001, 0x5c4: 0x0001, 0x5c5: 0x0001, + 0x5c6: 0x0001, 0x5c7: 0x0001, 0x5c8: 0x0001, 0x5c9: 0x0001, 0x5ca: 0x0001, 0x5cb: 0x0001, + 0x5cc: 0x0001, 0x5cd: 0x0001, 0x5ce: 0x0001, 0x5cf: 0x0001, 0x5d0: 0x0001, 0x5d1: 0x0001, + 0x5d2: 0x0001, 0x5d3: 0x0001, 0x5d4: 0x0001, 0x5d5: 0x0001, 0x5d6: 0x0001, 0x5d7: 0x0001, + 0x5d8: 0x0001, 0x5d9: 0x000c, 0x5da: 0x000c, 0x5db: 0x000c, 0x5dc: 0x0001, 0x5dd: 0x0001, + 0x5de: 0x0001, 0x5df: 0x0001, 0x5e0: 0x0001, 0x5e1: 0x0001, 0x5e2: 0x0001, 0x5e3: 0x0001, + 0x5e4: 0x0001, 0x5e5: 0x0001, 0x5e6: 0x0001, 0x5e7: 0x0001, 0x5e8: 0x0001, 0x5e9: 0x0001, + 0x5ea: 0x0001, 0x5eb: 0x0001, 0x5ec: 0x0001, 0x5ed: 0x0001, 0x5ee: 0x0001, 0x5ef: 0x0001, + 0x5f0: 0x0001, 0x5f1: 0x0001, 0x5f2: 0x0001, 0x5f3: 0x0001, 0x5f4: 0x0001, 0x5f5: 0x0001, + 0x5f6: 0x0001, 0x5f7: 0x0001, 0x5f8: 0x0001, 0x5f9: 0x0001, 0x5fa: 0x0001, 0x5fb: 0x0001, + 0x5fc: 0x0001, 0x5fd: 0x0001, 0x5fe: 0x0001, 0x5ff: 0x0001, + // Block 0x18, offset 0x600 + 0x600: 0x0001, 0x601: 0x0001, 0x602: 0x0001, 0x603: 0x0001, 0x604: 0x0001, 0x605: 0x0001, + 0x606: 0x0001, 0x607: 0x0001, 0x608: 0x0001, 0x609: 0x0001, 0x60a: 0x0001, 0x60b: 0x0001, + 0x60c: 0x0001, 0x60d: 0x0001, 0x60e: 0x0001, 0x60f: 0x0001, 0x610: 0x0001, 0x611: 0x0001, + 0x612: 0x0001, 0x613: 0x0001, 0x614: 0x0001, 0x615: 0x0001, 0x616: 0x0001, 0x617: 0x0001, + 0x618: 0x0001, 0x619: 0x0001, 0x61a: 0x0001, 0x61b: 0x0001, 0x61c: 0x0001, 0x61d: 0x0001, + 0x61e: 0x0001, 0x61f: 0x0001, 0x620: 0x000d, 0x621: 0x000d, 0x622: 0x000d, 0x623: 0x000d, + 0x624: 0x000d, 0x625: 0x000d, 0x626: 0x000d, 0x627: 0x000d, 0x628: 0x000d, 0x629: 0x000d, + 0x62a: 0x000d, 0x62b: 0x000d, 0x62c: 0x000d, 0x62d: 0x000d, 0x62e: 0x000d, 0x62f: 0x000d, + 0x630: 0x000d, 0x631: 0x000d, 0x632: 0x000d, 0x633: 0x000d, 0x634: 0x000d, 0x635: 0x000d, + 0x636: 0x000d, 0x637: 0x000d, 0x638: 0x000d, 0x639: 0x000d, 0x63a: 0x000d, 0x63b: 0x000d, + 0x63c: 0x000d, 0x63d: 0x000d, 0x63e: 0x000d, 0x63f: 0x000d, + // Block 0x19, offset 0x640 + 0x640: 0x000d, 0x641: 0x000d, 0x642: 0x000d, 0x643: 0x000d, 0x644: 0x000d, 0x645: 0x000d, + 0x646: 0x000d, 0x647: 0x000d, 0x648: 0x000d, 0x649: 0x000d, 0x64a: 0x000d, 0x64b: 0x000d, + 0x64c: 0x000d, 0x64d: 0x000d, 0x64e: 0x000d, 0x64f: 0x000d, 0x650: 0x000d, 0x651: 0x000d, + 0x652: 0x000d, 0x653: 0x000d, 0x654: 0x000c, 0x655: 0x000c, 0x656: 0x000c, 0x657: 0x000c, + 0x658: 0x000c, 0x659: 0x000c, 0x65a: 0x000c, 0x65b: 0x000c, 0x65c: 0x000c, 0x65d: 0x000c, + 0x65e: 0x000c, 0x65f: 0x000c, 0x660: 0x000c, 0x661: 0x000c, 0x662: 0x0005, 0x663: 0x000c, + 0x664: 0x000c, 0x665: 0x000c, 0x666: 0x000c, 0x667: 0x000c, 0x668: 0x000c, 0x669: 0x000c, + 0x66a: 0x000c, 0x66b: 0x000c, 0x66c: 0x000c, 0x66d: 0x000c, 0x66e: 0x000c, 0x66f: 0x000c, + 0x670: 0x000c, 0x671: 0x000c, 0x672: 0x000c, 0x673: 0x000c, 0x674: 0x000c, 0x675: 0x000c, + 0x676: 0x000c, 0x677: 0x000c, 0x678: 0x000c, 0x679: 0x000c, 0x67a: 0x000c, 0x67b: 0x000c, + 0x67c: 0x000c, 0x67d: 0x000c, 0x67e: 0x000c, 0x67f: 0x000c, + // Block 0x1a, offset 0x680 + 0x680: 0x000c, 0x681: 0x000c, 0x682: 0x000c, + 0x6ba: 0x000c, + 0x6bc: 0x000c, + // Block 0x1b, offset 0x6c0 + 0x6c1: 0x000c, 0x6c2: 0x000c, 0x6c3: 0x000c, 0x6c4: 0x000c, 0x6c5: 0x000c, + 0x6c6: 0x000c, 0x6c7: 0x000c, 0x6c8: 0x000c, + 0x6cd: 0x000c, 0x6d1: 0x000c, + 0x6d2: 0x000c, 0x6d3: 0x000c, 0x6d4: 0x000c, 0x6d5: 0x000c, 0x6d6: 0x000c, 0x6d7: 0x000c, + 0x6e2: 0x000c, 0x6e3: 0x000c, + // Block 0x1c, offset 0x700 + 0x701: 0x000c, + 0x73c: 0x000c, + // Block 0x1d, offset 0x740 + 0x741: 0x000c, 0x742: 0x000c, 0x743: 0x000c, 0x744: 0x000c, + 0x74d: 0x000c, + 0x762: 0x000c, 0x763: 0x000c, + 0x772: 0x0004, 0x773: 0x0004, + 0x77b: 0x0004, + // Block 0x1e, offset 0x780 + 0x781: 0x000c, 0x782: 0x000c, + 0x7bc: 0x000c, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x000c, 0x7c2: 0x000c, + 0x7c7: 0x000c, 0x7c8: 0x000c, 0x7cb: 0x000c, + 0x7cc: 0x000c, 0x7cd: 0x000c, 0x7d1: 0x000c, + 0x7f0: 0x000c, 0x7f1: 0x000c, 0x7f5: 0x000c, + // Block 0x20, offset 0x800 + 0x801: 0x000c, 0x802: 0x000c, 0x803: 0x000c, 0x804: 0x000c, 0x805: 0x000c, + 0x807: 0x000c, 0x808: 0x000c, + 0x80d: 0x000c, + 0x822: 0x000c, 0x823: 0x000c, + 0x831: 0x0004, + // Block 0x21, offset 0x840 + 0x841: 0x000c, + 0x87c: 0x000c, 0x87f: 0x000c, + // Block 0x22, offset 0x880 + 0x881: 0x000c, 0x882: 0x000c, 0x883: 0x000c, 0x884: 0x000c, + 0x88d: 0x000c, + 0x896: 0x000c, + 0x8a2: 0x000c, 0x8a3: 0x000c, + // Block 0x23, offset 0x8c0 + 0x8c2: 0x000c, + // Block 0x24, offset 0x900 + 0x900: 0x000c, + 0x90d: 0x000c, + 0x933: 0x000a, 0x934: 0x000a, 0x935: 0x000a, + 0x936: 0x000a, 0x937: 0x000a, 0x938: 0x000a, 0x939: 0x0004, 0x93a: 0x000a, + // Block 0x25, offset 0x940 + 0x940: 0x000c, + 0x97e: 0x000c, 0x97f: 0x000c, + // Block 0x26, offset 0x980 + 0x980: 0x000c, + 0x986: 0x000c, 0x987: 0x000c, 0x988: 0x000c, 0x98a: 0x000c, 0x98b: 0x000c, + 0x98c: 0x000c, 0x98d: 0x000c, + 0x995: 0x000c, 0x996: 0x000c, + 0x9a2: 0x000c, 0x9a3: 0x000c, + 0x9b8: 0x000a, 0x9b9: 0x000a, 0x9ba: 0x000a, 0x9bb: 0x000a, + 0x9bc: 0x000a, 0x9bd: 0x000a, 0x9be: 0x000a, + // Block 0x27, offset 0x9c0 + 0x9cc: 0x000c, 0x9cd: 0x000c, + 0x9e2: 0x000c, 0x9e3: 0x000c, + // Block 0x28, offset 0xa00 + 0xa01: 0x000c, + // Block 0x29, offset 0xa40 + 0xa41: 0x000c, 0xa42: 0x000c, 0xa43: 0x000c, 0xa44: 0x000c, + 0xa4d: 0x000c, + 0xa62: 0x000c, 0xa63: 0x000c, + // Block 0x2a, offset 0xa80 + 0xa8a: 0x000c, + 0xa92: 0x000c, 0xa93: 0x000c, 0xa94: 0x000c, 0xa96: 0x000c, + // Block 0x2b, offset 0xac0 + 0xaf1: 0x000c, 0xaf4: 0x000c, 0xaf5: 0x000c, + 0xaf6: 0x000c, 0xaf7: 0x000c, 0xaf8: 0x000c, 0xaf9: 0x000c, 0xafa: 0x000c, + 0xaff: 0x0004, + // Block 0x2c, offset 0xb00 + 0xb07: 0x000c, 0xb08: 0x000c, 0xb09: 0x000c, 0xb0a: 0x000c, 0xb0b: 0x000c, + 0xb0c: 0x000c, 0xb0d: 0x000c, 0xb0e: 0x000c, + // Block 0x2d, offset 0xb40 + 0xb71: 0x000c, 0xb74: 0x000c, 0xb75: 0x000c, + 0xb76: 0x000c, 0xb77: 0x000c, 0xb78: 0x000c, 0xb79: 0x000c, 0xb7b: 0x000c, + 0xb7c: 0x000c, + // Block 0x2e, offset 0xb80 + 0xb88: 0x000c, 0xb89: 0x000c, 0xb8a: 0x000c, 0xb8b: 0x000c, + 0xb8c: 0x000c, 0xb8d: 0x000c, + // Block 0x2f, offset 0xbc0 + 0xbd8: 0x000c, 0xbd9: 0x000c, + 0xbf5: 0x000c, + 0xbf7: 0x000c, 0xbf9: 0x000c, 0xbfa: 0x003a, 0xbfb: 0x002a, + 0xbfc: 0x003a, 0xbfd: 0x002a, + // Block 0x30, offset 0xc00 + 0xc31: 0x000c, 0xc32: 0x000c, 0xc33: 0x000c, 0xc34: 0x000c, 0xc35: 0x000c, + 0xc36: 0x000c, 0xc37: 0x000c, 0xc38: 0x000c, 0xc39: 0x000c, 0xc3a: 0x000c, 0xc3b: 0x000c, + 0xc3c: 0x000c, 0xc3d: 0x000c, 0xc3e: 0x000c, + // Block 0x31, offset 0xc40 + 0xc40: 0x000c, 0xc41: 0x000c, 0xc42: 0x000c, 0xc43: 0x000c, 0xc44: 0x000c, + 0xc46: 0x000c, 0xc47: 0x000c, + 0xc4d: 0x000c, 0xc4e: 0x000c, 0xc4f: 0x000c, 0xc50: 0x000c, 0xc51: 0x000c, + 0xc52: 0x000c, 0xc53: 0x000c, 0xc54: 0x000c, 0xc55: 0x000c, 0xc56: 0x000c, 0xc57: 0x000c, + 0xc59: 0x000c, 0xc5a: 0x000c, 0xc5b: 0x000c, 0xc5c: 0x000c, 0xc5d: 0x000c, + 0xc5e: 0x000c, 0xc5f: 0x000c, 0xc60: 0x000c, 0xc61: 0x000c, 0xc62: 0x000c, 0xc63: 0x000c, + 0xc64: 0x000c, 0xc65: 0x000c, 0xc66: 0x000c, 0xc67: 0x000c, 0xc68: 0x000c, 0xc69: 0x000c, + 0xc6a: 0x000c, 0xc6b: 0x000c, 0xc6c: 0x000c, 0xc6d: 0x000c, 0xc6e: 0x000c, 0xc6f: 0x000c, + 0xc70: 0x000c, 0xc71: 0x000c, 0xc72: 0x000c, 0xc73: 0x000c, 0xc74: 0x000c, 0xc75: 0x000c, + 0xc76: 0x000c, 0xc77: 0x000c, 0xc78: 0x000c, 0xc79: 0x000c, 0xc7a: 0x000c, 0xc7b: 0x000c, + 0xc7c: 0x000c, + // Block 0x32, offset 0xc80 + 0xc86: 0x000c, + // Block 0x33, offset 0xcc0 + 0xced: 0x000c, 0xcee: 0x000c, 0xcef: 0x000c, + 0xcf0: 0x000c, 0xcf2: 0x000c, 0xcf3: 0x000c, 0xcf4: 0x000c, 0xcf5: 0x000c, + 0xcf6: 0x000c, 0xcf7: 0x000c, 0xcf9: 0x000c, 0xcfa: 0x000c, + 0xcfd: 0x000c, 0xcfe: 0x000c, + // Block 0x34, offset 0xd00 + 0xd18: 0x000c, 0xd19: 0x000c, + 0xd1e: 0x000c, 0xd1f: 0x000c, 0xd20: 0x000c, + 0xd31: 0x000c, 0xd32: 0x000c, 0xd33: 0x000c, 0xd34: 0x000c, + // Block 0x35, offset 0xd40 + 0xd42: 0x000c, 0xd45: 0x000c, + 0xd46: 0x000c, + 0xd4d: 0x000c, + 0xd5d: 0x000c, + // Block 0x36, offset 0xd80 + 0xd9d: 0x000c, + 0xd9e: 0x000c, 0xd9f: 0x000c, + // Block 0x37, offset 0xdc0 + 0xdd0: 0x000a, 0xdd1: 0x000a, + 0xdd2: 0x000a, 0xdd3: 0x000a, 0xdd4: 0x000a, 0xdd5: 0x000a, 0xdd6: 0x000a, 0xdd7: 0x000a, + 0xdd8: 0x000a, 0xdd9: 0x000a, + // Block 0x38, offset 0xe00 + 0xe00: 0x000a, + // Block 0x39, offset 0xe40 + 0xe40: 0x0009, + 0xe5b: 0x007a, 0xe5c: 0x006a, + // Block 0x3a, offset 0xe80 + 0xe92: 0x000c, 0xe93: 0x000c, 0xe94: 0x000c, + 0xeb2: 0x000c, 0xeb3: 0x000c, 0xeb4: 0x000c, + // Block 0x3b, offset 0xec0 + 0xed2: 0x000c, 0xed3: 0x000c, + 0xef2: 0x000c, 0xef3: 0x000c, + // Block 0x3c, offset 0xf00 + 0xf34: 0x000c, 0xf35: 0x000c, + 0xf37: 0x000c, 0xf38: 0x000c, 0xf39: 0x000c, 0xf3a: 0x000c, 0xf3b: 0x000c, + 0xf3c: 0x000c, 0xf3d: 0x000c, + // Block 0x3d, offset 0xf40 + 0xf46: 0x000c, 0xf49: 0x000c, 0xf4a: 0x000c, 0xf4b: 0x000c, + 0xf4c: 0x000c, 0xf4d: 0x000c, 0xf4e: 0x000c, 0xf4f: 0x000c, 0xf50: 0x000c, 0xf51: 0x000c, + 0xf52: 0x000c, 0xf53: 0x000c, + 0xf5b: 0x0004, 0xf5d: 0x000c, + 0xf70: 0x000a, 0xf71: 0x000a, 0xf72: 0x000a, 0xf73: 0x000a, 0xf74: 0x000a, 0xf75: 0x000a, + 0xf76: 0x000a, 0xf77: 0x000a, 0xf78: 0x000a, 0xf79: 0x000a, + // Block 0x3e, offset 0xf80 + 0xf80: 0x000a, 0xf81: 0x000a, 0xf82: 0x000a, 0xf83: 0x000a, 0xf84: 0x000a, 0xf85: 0x000a, + 0xf86: 0x000a, 0xf87: 0x000a, 0xf88: 0x000a, 0xf89: 0x000a, 0xf8a: 0x000a, 0xf8b: 0x000c, + 0xf8c: 0x000c, 0xf8d: 0x000c, 0xf8e: 0x000b, + // Block 0x3f, offset 0xfc0 + 0xfc5: 0x000c, + 0xfc6: 0x000c, + 0xfe9: 0x000c, + // Block 0x40, offset 0x1000 + 0x1020: 0x000c, 0x1021: 0x000c, 0x1022: 0x000c, + 0x1027: 0x000c, 0x1028: 0x000c, + 0x1032: 0x000c, + 0x1039: 0x000c, 0x103a: 0x000c, 0x103b: 0x000c, + // Block 0x41, offset 0x1040 + 0x1040: 0x000a, 0x1044: 0x000a, 0x1045: 0x000a, + // Block 0x42, offset 0x1080 + 0x109e: 0x000a, 0x109f: 0x000a, 0x10a0: 0x000a, 0x10a1: 0x000a, 0x10a2: 0x000a, 0x10a3: 0x000a, + 0x10a4: 0x000a, 0x10a5: 0x000a, 0x10a6: 0x000a, 0x10a7: 0x000a, 0x10a8: 0x000a, 0x10a9: 0x000a, + 0x10aa: 0x000a, 0x10ab: 0x000a, 0x10ac: 0x000a, 0x10ad: 0x000a, 0x10ae: 0x000a, 0x10af: 0x000a, + 0x10b0: 0x000a, 0x10b1: 0x000a, 0x10b2: 0x000a, 0x10b3: 0x000a, 0x10b4: 0x000a, 0x10b5: 0x000a, + 0x10b6: 0x000a, 0x10b7: 0x000a, 0x10b8: 0x000a, 0x10b9: 0x000a, 0x10ba: 0x000a, 0x10bb: 0x000a, + 0x10bc: 0x000a, 0x10bd: 0x000a, 0x10be: 0x000a, 0x10bf: 0x000a, + // Block 0x43, offset 0x10c0 + 0x10d7: 0x000c, + 0x10d8: 0x000c, 0x10db: 0x000c, + // Block 0x44, offset 0x1100 + 0x1116: 0x000c, + 0x1118: 0x000c, 0x1119: 0x000c, 0x111a: 0x000c, 0x111b: 0x000c, 0x111c: 0x000c, 0x111d: 0x000c, + 0x111e: 0x000c, 0x1120: 0x000c, 0x1122: 0x000c, + 0x1125: 0x000c, 0x1126: 0x000c, 0x1127: 0x000c, 0x1128: 0x000c, 0x1129: 0x000c, + 0x112a: 0x000c, 0x112b: 0x000c, 0x112c: 0x000c, + 0x1133: 0x000c, 0x1134: 0x000c, 0x1135: 0x000c, + 0x1136: 0x000c, 0x1137: 0x000c, 0x1138: 0x000c, 0x1139: 0x000c, 0x113a: 0x000c, 0x113b: 0x000c, + 0x113c: 0x000c, 0x113f: 0x000c, + // Block 0x45, offset 0x1140 + 0x1170: 0x000c, 0x1171: 0x000c, 0x1172: 0x000c, 0x1173: 0x000c, 0x1174: 0x000c, 0x1175: 0x000c, + 0x1176: 0x000c, 0x1177: 0x000c, 0x1178: 0x000c, 0x1179: 0x000c, 0x117a: 0x000c, 0x117b: 0x000c, + 0x117c: 0x000c, 0x117d: 0x000c, 0x117e: 0x000c, + // Block 0x46, offset 0x1180 + 0x1180: 0x000c, 0x1181: 0x000c, 0x1182: 0x000c, 0x1183: 0x000c, + 0x11b4: 0x000c, + 0x11b6: 0x000c, 0x11b7: 0x000c, 0x11b8: 0x000c, 0x11b9: 0x000c, 0x11ba: 0x000c, + 0x11bc: 0x000c, + // Block 0x47, offset 0x11c0 + 0x11c2: 0x000c, + 0x11eb: 0x000c, 0x11ec: 0x000c, 0x11ed: 0x000c, 0x11ee: 0x000c, 0x11ef: 0x000c, + 0x11f0: 0x000c, 0x11f1: 0x000c, 0x11f2: 0x000c, 0x11f3: 0x000c, + // Block 0x48, offset 0x1200 + 0x1200: 0x000c, 0x1201: 0x000c, + 0x1222: 0x000c, 0x1223: 0x000c, + 0x1224: 0x000c, 0x1225: 0x000c, 0x1228: 0x000c, 0x1229: 0x000c, + 0x122b: 0x000c, 0x122c: 0x000c, 0x122d: 0x000c, + // Block 0x49, offset 0x1240 + 0x1266: 0x000c, 0x1268: 0x000c, 0x1269: 0x000c, + 0x126d: 0x000c, 0x126f: 0x000c, + 0x1270: 0x000c, 0x1271: 0x000c, + // Block 0x4a, offset 0x1280 + 0x12ac: 0x000c, 0x12ad: 0x000c, 0x12ae: 0x000c, 0x12af: 0x000c, + 0x12b0: 0x000c, 0x12b1: 0x000c, 0x12b2: 0x000c, 0x12b3: 0x000c, + 0x12b6: 0x000c, 0x12b7: 0x000c, + // Block 0x4b, offset 0x12c0 + 0x12d0: 0x000c, 0x12d1: 0x000c, + 0x12d2: 0x000c, 0x12d4: 0x000c, 0x12d5: 0x000c, 0x12d6: 0x000c, 0x12d7: 0x000c, + 0x12d8: 0x000c, 0x12d9: 0x000c, 0x12da: 0x000c, 0x12db: 0x000c, 0x12dc: 0x000c, 0x12dd: 0x000c, + 0x12de: 0x000c, 0x12df: 0x000c, 0x12e0: 0x000c, 0x12e2: 0x000c, 0x12e3: 0x000c, + 0x12e4: 0x000c, 0x12e5: 0x000c, 0x12e6: 0x000c, 0x12e7: 0x000c, 0x12e8: 0x000c, + 0x12ed: 0x000c, + 0x12f4: 0x000c, + 0x12f8: 0x000c, 0x12f9: 0x000c, + // Block 0x4c, offset 0x1300 + 0x1300: 0x000c, 0x1301: 0x000c, 0x1302: 0x000c, 0x1303: 0x000c, 0x1304: 0x000c, 0x1305: 0x000c, + 0x1306: 0x000c, 0x1307: 0x000c, 0x1308: 0x000c, 0x1309: 0x000c, 0x130a: 0x000c, 0x130b: 0x000c, + 0x130c: 0x000c, 0x130d: 0x000c, 0x130e: 0x000c, 0x130f: 0x000c, 0x1310: 0x000c, 0x1311: 0x000c, + 0x1312: 0x000c, 0x1313: 0x000c, 0x1314: 0x000c, 0x1315: 0x000c, 0x1316: 0x000c, 0x1317: 0x000c, + 0x1318: 0x000c, 0x1319: 0x000c, 0x131a: 0x000c, 0x131b: 0x000c, 0x131c: 0x000c, 0x131d: 0x000c, + 0x131e: 0x000c, 0x131f: 0x000c, 0x1320: 0x000c, 0x1321: 0x000c, 0x1322: 0x000c, 0x1323: 0x000c, + 0x1324: 0x000c, 0x1325: 0x000c, 0x1326: 0x000c, 0x1327: 0x000c, 0x1328: 0x000c, 0x1329: 0x000c, + 0x132a: 0x000c, 0x132b: 0x000c, 0x132c: 0x000c, 0x132d: 0x000c, 0x132e: 0x000c, 0x132f: 0x000c, + 0x1330: 0x000c, 0x1331: 0x000c, 0x1332: 0x000c, 0x1333: 0x000c, 0x1334: 0x000c, 0x1335: 0x000c, + 0x133b: 0x000c, + 0x133c: 0x000c, 0x133d: 0x000c, 0x133e: 0x000c, 0x133f: 0x000c, + // Block 0x4d, offset 0x1340 + 0x137d: 0x000a, 0x137f: 0x000a, + // Block 0x4e, offset 0x1380 + 0x1380: 0x000a, 0x1381: 0x000a, + 0x138d: 0x000a, 0x138e: 0x000a, 0x138f: 0x000a, + 0x139d: 0x000a, + 0x139e: 0x000a, 0x139f: 0x000a, + 0x13ad: 0x000a, 0x13ae: 0x000a, 0x13af: 0x000a, + 0x13bd: 0x000a, 0x13be: 0x000a, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x0009, 0x13c1: 0x0009, 0x13c2: 0x0009, 0x13c3: 0x0009, 0x13c4: 0x0009, 0x13c5: 0x0009, + 0x13c6: 0x0009, 0x13c7: 0x0009, 0x13c8: 0x0009, 0x13c9: 0x0009, 0x13ca: 0x0009, 0x13cb: 0x000b, + 0x13cc: 0x000b, 0x13cd: 0x000b, 0x13cf: 0x0001, 0x13d0: 0x000a, 0x13d1: 0x000a, + 0x13d2: 0x000a, 0x13d3: 0x000a, 0x13d4: 0x000a, 0x13d5: 0x000a, 0x13d6: 0x000a, 0x13d7: 0x000a, + 0x13d8: 0x000a, 0x13d9: 0x000a, 0x13da: 0x000a, 0x13db: 0x000a, 0x13dc: 0x000a, 0x13dd: 0x000a, + 0x13de: 0x000a, 0x13df: 0x000a, 0x13e0: 0x000a, 0x13e1: 0x000a, 0x13e2: 0x000a, 0x13e3: 0x000a, + 0x13e4: 0x000a, 0x13e5: 0x000a, 0x13e6: 0x000a, 0x13e7: 0x000a, 0x13e8: 0x0009, 0x13e9: 0x0007, + 0x13ea: 0x000e, 0x13eb: 0x000e, 0x13ec: 0x000e, 0x13ed: 0x000e, 0x13ee: 0x000e, 0x13ef: 0x0006, + 0x13f0: 0x0004, 0x13f1: 0x0004, 0x13f2: 0x0004, 0x13f3: 0x0004, 0x13f4: 0x0004, 0x13f5: 0x000a, + 0x13f6: 0x000a, 0x13f7: 0x000a, 0x13f8: 0x000a, 0x13f9: 0x000a, 0x13fa: 0x000a, 0x13fb: 0x000a, + 0x13fc: 0x000a, 0x13fd: 0x000a, 0x13fe: 0x000a, 0x13ff: 0x000a, + // Block 0x50, offset 0x1400 + 0x1400: 0x000a, 0x1401: 0x000a, 0x1402: 0x000a, 0x1403: 0x000a, 0x1404: 0x0006, 0x1405: 0x009a, + 0x1406: 0x008a, 0x1407: 0x000a, 0x1408: 0x000a, 0x1409: 0x000a, 0x140a: 0x000a, 0x140b: 0x000a, + 0x140c: 0x000a, 0x140d: 0x000a, 0x140e: 0x000a, 0x140f: 0x000a, 0x1410: 0x000a, 0x1411: 0x000a, + 0x1412: 0x000a, 0x1413: 0x000a, 0x1414: 0x000a, 0x1415: 0x000a, 0x1416: 0x000a, 0x1417: 0x000a, + 0x1418: 0x000a, 0x1419: 0x000a, 0x141a: 0x000a, 0x141b: 0x000a, 0x141c: 0x000a, 0x141d: 0x000a, + 0x141e: 0x000a, 0x141f: 0x0009, 0x1420: 0x000b, 0x1421: 0x000b, 0x1422: 0x000b, 0x1423: 0x000b, + 0x1424: 0x000b, 0x1425: 0x000b, 0x1426: 0x000e, 0x1427: 0x000e, 0x1428: 0x000e, 0x1429: 0x000e, + 0x142a: 0x000b, 0x142b: 0x000b, 0x142c: 0x000b, 0x142d: 0x000b, 0x142e: 0x000b, 0x142f: 0x000b, + 0x1430: 0x0002, 0x1434: 0x0002, 0x1435: 0x0002, + 0x1436: 0x0002, 0x1437: 0x0002, 0x1438: 0x0002, 0x1439: 0x0002, 0x143a: 0x0003, 0x143b: 0x0003, + 0x143c: 0x000a, 0x143d: 0x009a, 0x143e: 0x008a, + // Block 0x51, offset 0x1440 + 0x1440: 0x0002, 0x1441: 0x0002, 0x1442: 0x0002, 0x1443: 0x0002, 0x1444: 0x0002, 0x1445: 0x0002, + 0x1446: 0x0002, 0x1447: 0x0002, 0x1448: 0x0002, 0x1449: 0x0002, 0x144a: 0x0003, 0x144b: 0x0003, + 0x144c: 0x000a, 0x144d: 0x009a, 0x144e: 0x008a, + 0x1460: 0x0004, 0x1461: 0x0004, 0x1462: 0x0004, 0x1463: 0x0004, + 0x1464: 0x0004, 0x1465: 0x0004, 0x1466: 0x0004, 0x1467: 0x0004, 0x1468: 0x0004, 0x1469: 0x0004, + 0x146a: 0x0004, 0x146b: 0x0004, 0x146c: 0x0004, 0x146d: 0x0004, 0x146e: 0x0004, 0x146f: 0x0004, + 0x1470: 0x0004, 0x1471: 0x0004, 0x1472: 0x0004, 0x1473: 0x0004, 0x1474: 0x0004, 0x1475: 0x0004, + 0x1476: 0x0004, 0x1477: 0x0004, 0x1478: 0x0004, 0x1479: 0x0004, 0x147a: 0x0004, 0x147b: 0x0004, + 0x147c: 0x0004, 0x147d: 0x0004, 0x147e: 0x0004, 0x147f: 0x0004, + // Block 0x52, offset 0x1480 + 0x1480: 0x0004, 0x1481: 0x0004, 0x1482: 0x0004, 0x1483: 0x0004, 0x1484: 0x0004, 0x1485: 0x0004, + 0x1486: 0x0004, 0x1487: 0x0004, 0x1488: 0x0004, 0x1489: 0x0004, 0x148a: 0x0004, 0x148b: 0x0004, + 0x148c: 0x0004, 0x148d: 0x0004, 0x148e: 0x0004, 0x148f: 0x0004, 0x1490: 0x000c, 0x1491: 0x000c, + 0x1492: 0x000c, 0x1493: 0x000c, 0x1494: 0x000c, 0x1495: 0x000c, 0x1496: 0x000c, 0x1497: 0x000c, + 0x1498: 0x000c, 0x1499: 0x000c, 0x149a: 0x000c, 0x149b: 0x000c, 0x149c: 0x000c, 0x149d: 0x000c, + 0x149e: 0x000c, 0x149f: 0x000c, 0x14a0: 0x000c, 0x14a1: 0x000c, 0x14a2: 0x000c, 0x14a3: 0x000c, + 0x14a4: 0x000c, 0x14a5: 0x000c, 0x14a6: 0x000c, 0x14a7: 0x000c, 0x14a8: 0x000c, 0x14a9: 0x000c, + 0x14aa: 0x000c, 0x14ab: 0x000c, 0x14ac: 0x000c, 0x14ad: 0x000c, 0x14ae: 0x000c, 0x14af: 0x000c, + 0x14b0: 0x000c, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x000a, 0x14c1: 0x000a, 0x14c3: 0x000a, 0x14c4: 0x000a, 0x14c5: 0x000a, + 0x14c6: 0x000a, 0x14c8: 0x000a, 0x14c9: 0x000a, + 0x14d4: 0x000a, 0x14d6: 0x000a, 0x14d7: 0x000a, + 0x14d8: 0x000a, + 0x14de: 0x000a, 0x14df: 0x000a, 0x14e0: 0x000a, 0x14e1: 0x000a, 0x14e2: 0x000a, 0x14e3: 0x000a, + 0x14e5: 0x000a, 0x14e7: 0x000a, 0x14e9: 0x000a, + 0x14ee: 0x0004, + 0x14fa: 0x000a, 0x14fb: 0x000a, + // Block 0x54, offset 0x1500 + 0x1500: 0x000a, 0x1501: 0x000a, 0x1502: 0x000a, 0x1503: 0x000a, 0x1504: 0x000a, + 0x150a: 0x000a, 0x150b: 0x000a, + 0x150c: 0x000a, 0x150d: 0x000a, 0x1510: 0x000a, 0x1511: 0x000a, + 0x1512: 0x000a, 0x1513: 0x000a, 0x1514: 0x000a, 0x1515: 0x000a, 0x1516: 0x000a, 0x1517: 0x000a, + 0x1518: 0x000a, 0x1519: 0x000a, 0x151a: 0x000a, 0x151b: 0x000a, 0x151c: 0x000a, 0x151d: 0x000a, + 0x151e: 0x000a, 0x151f: 0x000a, + // Block 0x55, offset 0x1540 + 0x1549: 0x000a, 0x154a: 0x000a, 0x154b: 0x000a, + 0x1550: 0x000a, 0x1551: 0x000a, + 0x1552: 0x000a, 0x1553: 0x000a, 0x1554: 0x000a, 0x1555: 0x000a, 0x1556: 0x000a, 0x1557: 0x000a, + 0x1558: 0x000a, 0x1559: 0x000a, 0x155a: 0x000a, 0x155b: 0x000a, 0x155c: 0x000a, 0x155d: 0x000a, + 0x155e: 0x000a, 0x155f: 0x000a, 0x1560: 0x000a, 0x1561: 0x000a, 0x1562: 0x000a, 0x1563: 0x000a, + 0x1564: 0x000a, 0x1565: 0x000a, 0x1566: 0x000a, 0x1567: 0x000a, 0x1568: 0x000a, 0x1569: 0x000a, + 0x156a: 0x000a, 0x156b: 0x000a, 0x156c: 0x000a, 0x156d: 0x000a, 0x156e: 0x000a, 0x156f: 0x000a, + 0x1570: 0x000a, 0x1571: 0x000a, 0x1572: 0x000a, 0x1573: 0x000a, 0x1574: 0x000a, 0x1575: 0x000a, + 0x1576: 0x000a, 0x1577: 0x000a, 0x1578: 0x000a, 0x1579: 0x000a, 0x157a: 0x000a, 0x157b: 0x000a, + 0x157c: 0x000a, 0x157d: 0x000a, 0x157e: 0x000a, 0x157f: 0x000a, + // Block 0x56, offset 0x1580 + 0x1580: 0x000a, 0x1581: 0x000a, 0x1582: 0x000a, 0x1583: 0x000a, 0x1584: 0x000a, 0x1585: 0x000a, + 0x1586: 0x000a, 0x1587: 0x000a, 0x1588: 0x000a, 0x1589: 0x000a, 0x158a: 0x000a, 0x158b: 0x000a, + 0x158c: 0x000a, 0x158d: 0x000a, 0x158e: 0x000a, 0x158f: 0x000a, 0x1590: 0x000a, 0x1591: 0x000a, + 0x1592: 0x000a, 0x1593: 0x000a, 0x1594: 0x000a, 0x1595: 0x000a, 0x1596: 0x000a, 0x1597: 0x000a, + 0x1598: 0x000a, 0x1599: 0x000a, 0x159a: 0x000a, 0x159b: 0x000a, 0x159c: 0x000a, 0x159d: 0x000a, + 0x159e: 0x000a, 0x159f: 0x000a, 0x15a0: 0x000a, 0x15a1: 0x000a, 0x15a2: 0x000a, 0x15a3: 0x000a, + 0x15a4: 0x000a, 0x15a5: 0x000a, 0x15a6: 0x000a, 0x15a7: 0x000a, 0x15a8: 0x000a, 0x15a9: 0x000a, + 0x15aa: 0x000a, 0x15ab: 0x000a, 0x15ac: 0x000a, 0x15ad: 0x000a, 0x15ae: 0x000a, 0x15af: 0x000a, + 0x15b0: 0x000a, 0x15b1: 0x000a, 0x15b2: 0x000a, 0x15b3: 0x000a, 0x15b4: 0x000a, 0x15b5: 0x000a, + 0x15b6: 0x000a, 0x15b7: 0x000a, 0x15b8: 0x000a, 0x15b9: 0x000a, 0x15ba: 0x000a, 0x15bb: 0x000a, + 0x15bc: 0x000a, 0x15bd: 0x000a, 0x15be: 0x000a, 0x15bf: 0x000a, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x000a, 0x15c1: 0x000a, 0x15c2: 0x000a, 0x15c3: 0x000a, 0x15c4: 0x000a, 0x15c5: 0x000a, + 0x15c6: 0x000a, 0x15c7: 0x000a, 0x15c8: 0x000a, 0x15c9: 0x000a, 0x15ca: 0x000a, 0x15cb: 0x000a, + 0x15cc: 0x000a, 0x15cd: 0x000a, 0x15ce: 0x000a, 0x15cf: 0x000a, 0x15d0: 0x000a, 0x15d1: 0x000a, + 0x15d2: 0x0003, 0x15d3: 0x0004, 0x15d4: 0x000a, 0x15d5: 0x000a, 0x15d6: 0x000a, 0x15d7: 0x000a, + 0x15d8: 0x000a, 0x15d9: 0x000a, 0x15da: 0x000a, 0x15db: 0x000a, 0x15dc: 0x000a, 0x15dd: 0x000a, + 0x15de: 0x000a, 0x15df: 0x000a, 0x15e0: 0x000a, 0x15e1: 0x000a, 0x15e2: 0x000a, 0x15e3: 0x000a, + 0x15e4: 0x000a, 0x15e5: 0x000a, 0x15e6: 0x000a, 0x15e7: 0x000a, 0x15e8: 0x000a, 0x15e9: 0x000a, + 0x15ea: 0x000a, 0x15eb: 0x000a, 0x15ec: 0x000a, 0x15ed: 0x000a, 0x15ee: 0x000a, 0x15ef: 0x000a, + 0x15f0: 0x000a, 0x15f1: 0x000a, 0x15f2: 0x000a, 0x15f3: 0x000a, 0x15f4: 0x000a, 0x15f5: 0x000a, + 0x15f6: 0x000a, 0x15f7: 0x000a, 0x15f8: 0x000a, 0x15f9: 0x000a, 0x15fa: 0x000a, 0x15fb: 0x000a, + 0x15fc: 0x000a, 0x15fd: 0x000a, 0x15fe: 0x000a, 0x15ff: 0x000a, + // Block 0x58, offset 0x1600 + 0x1600: 0x000a, 0x1601: 0x000a, 0x1602: 0x000a, 0x1603: 0x000a, 0x1604: 0x000a, 0x1605: 0x000a, + 0x1606: 0x000a, 0x1607: 0x000a, 0x1608: 0x003a, 0x1609: 0x002a, 0x160a: 0x003a, 0x160b: 0x002a, + 0x160c: 0x000a, 0x160d: 0x000a, 0x160e: 0x000a, 0x160f: 0x000a, 0x1610: 0x000a, 0x1611: 0x000a, + 0x1612: 0x000a, 0x1613: 0x000a, 0x1614: 0x000a, 0x1615: 0x000a, 0x1616: 0x000a, 0x1617: 0x000a, + 0x1618: 0x000a, 0x1619: 0x000a, 0x161a: 0x000a, 0x161b: 0x000a, 0x161c: 0x000a, 0x161d: 0x000a, + 0x161e: 0x000a, 0x161f: 0x000a, 0x1620: 0x000a, 0x1621: 0x000a, 0x1622: 0x000a, 0x1623: 0x000a, + 0x1624: 0x000a, 0x1625: 0x000a, 0x1626: 0x000a, 0x1627: 0x000a, 0x1628: 0x000a, 0x1629: 0x009a, + 0x162a: 0x008a, 0x162b: 0x000a, 0x162c: 0x000a, 0x162d: 0x000a, 0x162e: 0x000a, 0x162f: 0x000a, + 0x1630: 0x000a, 0x1631: 0x000a, 0x1632: 0x000a, 0x1633: 0x000a, 0x1634: 0x000a, 0x1635: 0x000a, + // Block 0x59, offset 0x1640 + 0x167b: 0x000a, + 0x167c: 0x000a, 0x167d: 0x000a, 0x167e: 0x000a, 0x167f: 0x000a, + // Block 0x5a, offset 0x1680 + 0x1680: 0x000a, 0x1681: 0x000a, 0x1682: 0x000a, 0x1683: 0x000a, 0x1684: 0x000a, 0x1685: 0x000a, + 0x1686: 0x000a, 0x1687: 0x000a, 0x1688: 0x000a, 0x1689: 0x000a, 0x168a: 0x000a, 0x168b: 0x000a, + 0x168c: 0x000a, 0x168d: 0x000a, 0x168e: 0x000a, 0x168f: 0x000a, 0x1690: 0x000a, 0x1691: 0x000a, + 0x1692: 0x000a, 0x1693: 0x000a, 0x1694: 0x000a, 0x1696: 0x000a, 0x1697: 0x000a, + 0x1698: 0x000a, 0x1699: 0x000a, 0x169a: 0x000a, 0x169b: 0x000a, 0x169c: 0x000a, 0x169d: 0x000a, + 0x169e: 0x000a, 0x169f: 0x000a, 0x16a0: 0x000a, 0x16a1: 0x000a, 0x16a2: 0x000a, 0x16a3: 0x000a, + 0x16a4: 0x000a, 0x16a5: 0x000a, 0x16a6: 0x000a, 0x16a7: 0x000a, 0x16a8: 0x000a, 0x16a9: 0x000a, + 0x16aa: 0x000a, 0x16ab: 0x000a, 0x16ac: 0x000a, 0x16ad: 0x000a, 0x16ae: 0x000a, 0x16af: 0x000a, + 0x16b0: 0x000a, 0x16b1: 0x000a, 0x16b2: 0x000a, 0x16b3: 0x000a, 0x16b4: 0x000a, 0x16b5: 0x000a, + 0x16b6: 0x000a, 0x16b7: 0x000a, 0x16b8: 0x000a, 0x16b9: 0x000a, 0x16ba: 0x000a, 0x16bb: 0x000a, + 0x16bc: 0x000a, 0x16bd: 0x000a, 0x16be: 0x000a, 0x16bf: 0x000a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x000a, 0x16c1: 0x000a, 0x16c2: 0x000a, 0x16c3: 0x000a, 0x16c4: 0x000a, 0x16c5: 0x000a, + 0x16c6: 0x000a, 0x16c7: 0x000a, 0x16c8: 0x000a, 0x16c9: 0x000a, 0x16ca: 0x000a, 0x16cb: 0x000a, + 0x16cc: 0x000a, 0x16cd: 0x000a, 0x16ce: 0x000a, 0x16cf: 0x000a, 0x16d0: 0x000a, 0x16d1: 0x000a, + 0x16d2: 0x000a, 0x16d3: 0x000a, 0x16d4: 0x000a, 0x16d5: 0x000a, 0x16d6: 0x000a, 0x16d7: 0x000a, + 0x16d8: 0x000a, 0x16d9: 0x000a, 0x16da: 0x000a, 0x16db: 0x000a, 0x16dc: 0x000a, 0x16dd: 0x000a, + 0x16de: 0x000a, 0x16df: 0x000a, 0x16e0: 0x000a, 0x16e1: 0x000a, 0x16e2: 0x000a, 0x16e3: 0x000a, + 0x16e4: 0x000a, 0x16e5: 0x000a, 0x16e6: 0x000a, 0x16e7: 0x000a, 0x16e8: 0x000a, 0x16e9: 0x000a, + 0x16ea: 0x000a, 0x16eb: 0x000a, 0x16ec: 0x000a, 0x16ed: 0x000a, 0x16ee: 0x000a, 0x16ef: 0x000a, + 0x16f0: 0x000a, 0x16f1: 0x000a, 0x16f2: 0x000a, 0x16f3: 0x000a, 0x16f4: 0x000a, 0x16f5: 0x000a, + 0x16f6: 0x000a, 0x16f7: 0x000a, 0x16f8: 0x000a, 0x16f9: 0x000a, 0x16fa: 0x000a, 0x16fb: 0x000a, + 0x16fc: 0x000a, 0x16fd: 0x000a, 0x16fe: 0x000a, + // Block 0x5c, offset 0x1700 + 0x1700: 0x000a, 0x1701: 0x000a, 0x1702: 0x000a, 0x1703: 0x000a, 0x1704: 0x000a, 0x1705: 0x000a, + 0x1706: 0x000a, 0x1707: 0x000a, 0x1708: 0x000a, 0x1709: 0x000a, 0x170a: 0x000a, 0x170b: 0x000a, + 0x170c: 0x000a, 0x170d: 0x000a, 0x170e: 0x000a, 0x170f: 0x000a, 0x1710: 0x000a, 0x1711: 0x000a, + 0x1712: 0x000a, 0x1713: 0x000a, 0x1714: 0x000a, 0x1715: 0x000a, 0x1716: 0x000a, 0x1717: 0x000a, + 0x1718: 0x000a, 0x1719: 0x000a, 0x171a: 0x000a, 0x171b: 0x000a, 0x171c: 0x000a, 0x171d: 0x000a, + 0x171e: 0x000a, 0x171f: 0x000a, 0x1720: 0x000a, 0x1721: 0x000a, 0x1722: 0x000a, 0x1723: 0x000a, + 0x1724: 0x000a, 0x1725: 0x000a, 0x1726: 0x000a, + // Block 0x5d, offset 0x1740 + 0x1740: 0x000a, 0x1741: 0x000a, 0x1742: 0x000a, 0x1743: 0x000a, 0x1744: 0x000a, 0x1745: 0x000a, + 0x1746: 0x000a, 0x1747: 0x000a, 0x1748: 0x000a, 0x1749: 0x000a, 0x174a: 0x000a, + 0x1760: 0x000a, 0x1761: 0x000a, 0x1762: 0x000a, 0x1763: 0x000a, + 0x1764: 0x000a, 0x1765: 0x000a, 0x1766: 0x000a, 0x1767: 0x000a, 0x1768: 0x000a, 0x1769: 0x000a, + 0x176a: 0x000a, 0x176b: 0x000a, 0x176c: 0x000a, 0x176d: 0x000a, 0x176e: 0x000a, 0x176f: 0x000a, + 0x1770: 0x000a, 0x1771: 0x000a, 0x1772: 0x000a, 0x1773: 0x000a, 0x1774: 0x000a, 0x1775: 0x000a, + 0x1776: 0x000a, 0x1777: 0x000a, 0x1778: 0x000a, 0x1779: 0x000a, 0x177a: 0x000a, 0x177b: 0x000a, + 0x177c: 0x000a, 0x177d: 0x000a, 0x177e: 0x000a, 0x177f: 0x000a, + // Block 0x5e, offset 0x1780 + 0x1780: 0x000a, 0x1781: 0x000a, 0x1782: 0x000a, 0x1783: 0x000a, 0x1784: 0x000a, 0x1785: 0x000a, + 0x1786: 0x000a, 0x1787: 0x000a, 0x1788: 0x0002, 0x1789: 0x0002, 0x178a: 0x0002, 0x178b: 0x0002, + 0x178c: 0x0002, 0x178d: 0x0002, 0x178e: 0x0002, 0x178f: 0x0002, 0x1790: 0x0002, 0x1791: 0x0002, + 0x1792: 0x0002, 0x1793: 0x0002, 0x1794: 0x0002, 0x1795: 0x0002, 0x1796: 0x0002, 0x1797: 0x0002, + 0x1798: 0x0002, 0x1799: 0x0002, 0x179a: 0x0002, 0x179b: 0x0002, + // Block 0x5f, offset 0x17c0 + 0x17ea: 0x000a, 0x17eb: 0x000a, 0x17ec: 0x000a, 0x17ed: 0x000a, 0x17ee: 0x000a, 0x17ef: 0x000a, + 0x17f0: 0x000a, 0x17f1: 0x000a, 0x17f2: 0x000a, 0x17f3: 0x000a, 0x17f4: 0x000a, 0x17f5: 0x000a, + 0x17f6: 0x000a, 0x17f7: 0x000a, 0x17f8: 0x000a, 0x17f9: 0x000a, 0x17fa: 0x000a, 0x17fb: 0x000a, + 0x17fc: 0x000a, 0x17fd: 0x000a, 0x17fe: 0x000a, 0x17ff: 0x000a, + // Block 0x60, offset 0x1800 + 0x1800: 0x000a, 0x1801: 0x000a, 0x1802: 0x000a, 0x1803: 0x000a, 0x1804: 0x000a, 0x1805: 0x000a, + 0x1806: 0x000a, 0x1807: 0x000a, 0x1808: 0x000a, 0x1809: 0x000a, 0x180a: 0x000a, 0x180b: 0x000a, + 0x180c: 0x000a, 0x180d: 0x000a, 0x180e: 0x000a, 0x180f: 0x000a, 0x1810: 0x000a, 0x1811: 0x000a, + 0x1812: 0x000a, 0x1813: 0x000a, 0x1814: 0x000a, 0x1815: 0x000a, 0x1816: 0x000a, 0x1817: 0x000a, + 0x1818: 0x000a, 0x1819: 0x000a, 0x181a: 0x000a, 0x181b: 0x000a, 0x181c: 0x000a, 0x181d: 0x000a, + 0x181e: 0x000a, 0x181f: 0x000a, 0x1820: 0x000a, 0x1821: 0x000a, 0x1822: 0x000a, 0x1823: 0x000a, + 0x1824: 0x000a, 0x1825: 0x000a, 0x1826: 0x000a, 0x1827: 0x000a, 0x1828: 0x000a, 0x1829: 0x000a, + 0x182a: 0x000a, 0x182b: 0x000a, 0x182d: 0x000a, 0x182e: 0x000a, 0x182f: 0x000a, + 0x1830: 0x000a, 0x1831: 0x000a, 0x1832: 0x000a, 0x1833: 0x000a, 0x1834: 0x000a, 0x1835: 0x000a, + 0x1836: 0x000a, 0x1837: 0x000a, 0x1838: 0x000a, 0x1839: 0x000a, 0x183a: 0x000a, 0x183b: 0x000a, + 0x183c: 0x000a, 0x183d: 0x000a, 0x183e: 0x000a, 0x183f: 0x000a, + // Block 0x61, offset 0x1840 + 0x1840: 0x000a, 0x1841: 0x000a, 0x1842: 0x000a, 0x1843: 0x000a, 0x1844: 0x000a, 0x1845: 0x000a, + 0x1846: 0x000a, 0x1847: 0x000a, 0x1848: 0x000a, 0x1849: 0x000a, 0x184a: 0x000a, 0x184b: 0x000a, + 0x184c: 0x000a, 0x184d: 0x000a, 0x184e: 0x000a, 0x184f: 0x000a, 0x1850: 0x000a, 0x1851: 0x000a, + 0x1852: 0x000a, 0x1853: 0x000a, 0x1854: 0x000a, 0x1855: 0x000a, 0x1856: 0x000a, 0x1857: 0x000a, + 0x1858: 0x000a, 0x1859: 0x000a, 0x185a: 0x000a, 0x185b: 0x000a, 0x185c: 0x000a, 0x185d: 0x000a, + 0x185e: 0x000a, 0x185f: 0x000a, 0x1860: 0x000a, 0x1861: 0x000a, 0x1862: 0x000a, 0x1863: 0x000a, + 0x1864: 0x000a, 0x1865: 0x000a, 0x1866: 0x000a, 0x1867: 0x000a, 0x1868: 0x003a, 0x1869: 0x002a, + 0x186a: 0x003a, 0x186b: 0x002a, 0x186c: 0x003a, 0x186d: 0x002a, 0x186e: 0x003a, 0x186f: 0x002a, + 0x1870: 0x003a, 0x1871: 0x002a, 0x1872: 0x003a, 0x1873: 0x002a, 0x1874: 0x003a, 0x1875: 0x002a, + 0x1876: 0x000a, 0x1877: 0x000a, 0x1878: 0x000a, 0x1879: 0x000a, 0x187a: 0x000a, 0x187b: 0x000a, + 0x187c: 0x000a, 0x187d: 0x000a, 0x187e: 0x000a, 0x187f: 0x000a, + // Block 0x62, offset 0x1880 + 0x1880: 0x000a, 0x1881: 0x000a, 0x1882: 0x000a, 0x1883: 0x000a, 0x1884: 0x000a, 0x1885: 0x009a, + 0x1886: 0x008a, 0x1887: 0x000a, 0x1888: 0x000a, 0x1889: 0x000a, 0x188a: 0x000a, 0x188b: 0x000a, + 0x188c: 0x000a, 0x188d: 0x000a, 0x188e: 0x000a, 0x188f: 0x000a, 0x1890: 0x000a, 0x1891: 0x000a, + 0x1892: 0x000a, 0x1893: 0x000a, 0x1894: 0x000a, 0x1895: 0x000a, 0x1896: 0x000a, 0x1897: 0x000a, + 0x1898: 0x000a, 0x1899: 0x000a, 0x189a: 0x000a, 0x189b: 0x000a, 0x189c: 0x000a, 0x189d: 0x000a, + 0x189e: 0x000a, 0x189f: 0x000a, 0x18a0: 0x000a, 0x18a1: 0x000a, 0x18a2: 0x000a, 0x18a3: 0x000a, + 0x18a4: 0x000a, 0x18a5: 0x000a, 0x18a6: 0x003a, 0x18a7: 0x002a, 0x18a8: 0x003a, 0x18a9: 0x002a, + 0x18aa: 0x003a, 0x18ab: 0x002a, 0x18ac: 0x003a, 0x18ad: 0x002a, 0x18ae: 0x003a, 0x18af: 0x002a, + 0x18b0: 0x000a, 0x18b1: 0x000a, 0x18b2: 0x000a, 0x18b3: 0x000a, 0x18b4: 0x000a, 0x18b5: 0x000a, + 0x18b6: 0x000a, 0x18b7: 0x000a, 0x18b8: 0x000a, 0x18b9: 0x000a, 0x18ba: 0x000a, 0x18bb: 0x000a, + 0x18bc: 0x000a, 0x18bd: 0x000a, 0x18be: 0x000a, 0x18bf: 0x000a, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x000a, 0x18c1: 0x000a, 0x18c2: 0x000a, 0x18c3: 0x007a, 0x18c4: 0x006a, 0x18c5: 0x009a, + 0x18c6: 0x008a, 0x18c7: 0x00ba, 0x18c8: 0x00aa, 0x18c9: 0x009a, 0x18ca: 0x008a, 0x18cb: 0x007a, + 0x18cc: 0x006a, 0x18cd: 0x00da, 0x18ce: 0x002a, 0x18cf: 0x003a, 0x18d0: 0x00ca, 0x18d1: 0x009a, + 0x18d2: 0x008a, 0x18d3: 0x007a, 0x18d4: 0x006a, 0x18d5: 0x009a, 0x18d6: 0x008a, 0x18d7: 0x00ba, + 0x18d8: 0x00aa, 0x18d9: 0x000a, 0x18da: 0x000a, 0x18db: 0x000a, 0x18dc: 0x000a, 0x18dd: 0x000a, + 0x18de: 0x000a, 0x18df: 0x000a, 0x18e0: 0x000a, 0x18e1: 0x000a, 0x18e2: 0x000a, 0x18e3: 0x000a, + 0x18e4: 0x000a, 0x18e5: 0x000a, 0x18e6: 0x000a, 0x18e7: 0x000a, 0x18e8: 0x000a, 0x18e9: 0x000a, + 0x18ea: 0x000a, 0x18eb: 0x000a, 0x18ec: 0x000a, 0x18ed: 0x000a, 0x18ee: 0x000a, 0x18ef: 0x000a, + 0x18f0: 0x000a, 0x18f1: 0x000a, 0x18f2: 0x000a, 0x18f3: 0x000a, 0x18f4: 0x000a, 0x18f5: 0x000a, + 0x18f6: 0x000a, 0x18f7: 0x000a, 0x18f8: 0x000a, 0x18f9: 0x000a, 0x18fa: 0x000a, 0x18fb: 0x000a, + 0x18fc: 0x000a, 0x18fd: 0x000a, 0x18fe: 0x000a, 0x18ff: 0x000a, + // Block 0x64, offset 0x1900 + 0x1900: 0x000a, 0x1901: 0x000a, 0x1902: 0x000a, 0x1903: 0x000a, 0x1904: 0x000a, 0x1905: 0x000a, + 0x1906: 0x000a, 0x1907: 0x000a, 0x1908: 0x000a, 0x1909: 0x000a, 0x190a: 0x000a, 0x190b: 0x000a, + 0x190c: 0x000a, 0x190d: 0x000a, 0x190e: 0x000a, 0x190f: 0x000a, 0x1910: 0x000a, 0x1911: 0x000a, + 0x1912: 0x000a, 0x1913: 0x000a, 0x1914: 0x000a, 0x1915: 0x000a, 0x1916: 0x000a, 0x1917: 0x000a, + 0x1918: 0x003a, 0x1919: 0x002a, 0x191a: 0x003a, 0x191b: 0x002a, 0x191c: 0x000a, 0x191d: 0x000a, + 0x191e: 0x000a, 0x191f: 0x000a, 0x1920: 0x000a, 0x1921: 0x000a, 0x1922: 0x000a, 0x1923: 0x000a, + 0x1924: 0x000a, 0x1925: 0x000a, 0x1926: 0x000a, 0x1927: 0x000a, 0x1928: 0x000a, 0x1929: 0x000a, + 0x192a: 0x000a, 0x192b: 0x000a, 0x192c: 0x000a, 0x192d: 0x000a, 0x192e: 0x000a, 0x192f: 0x000a, + 0x1930: 0x000a, 0x1931: 0x000a, 0x1932: 0x000a, 0x1933: 0x000a, 0x1934: 0x000a, 0x1935: 0x000a, + 0x1936: 0x000a, 0x1937: 0x000a, 0x1938: 0x000a, 0x1939: 0x000a, 0x193a: 0x000a, 0x193b: 0x000a, + 0x193c: 0x003a, 0x193d: 0x002a, 0x193e: 0x000a, 0x193f: 0x000a, + // Block 0x65, offset 0x1940 + 0x1940: 0x000a, 0x1941: 0x000a, 0x1942: 0x000a, 0x1943: 0x000a, 0x1944: 0x000a, 0x1945: 0x000a, + 0x1946: 0x000a, 0x1947: 0x000a, 0x1948: 0x000a, 0x1949: 0x000a, 0x194a: 0x000a, 0x194b: 0x000a, + 0x194c: 0x000a, 0x194d: 0x000a, 0x194e: 0x000a, 0x194f: 0x000a, 0x1950: 0x000a, 0x1951: 0x000a, + 0x1952: 0x000a, 0x1953: 0x000a, 0x1954: 0x000a, 0x1955: 0x000a, 0x1956: 0x000a, 0x1957: 0x000a, + 0x1958: 0x000a, 0x1959: 0x000a, 0x195a: 0x000a, 0x195b: 0x000a, 0x195c: 0x000a, 0x195d: 0x000a, + 0x195e: 0x000a, 0x195f: 0x000a, 0x1960: 0x000a, 0x1961: 0x000a, 0x1962: 0x000a, 0x1963: 0x000a, + 0x1964: 0x000a, 0x1965: 0x000a, 0x1966: 0x000a, 0x1967: 0x000a, 0x1968: 0x000a, 0x1969: 0x000a, + 0x196a: 0x000a, 0x196b: 0x000a, 0x196c: 0x000a, 0x196d: 0x000a, 0x196e: 0x000a, 0x196f: 0x000a, + 0x1970: 0x000a, 0x1971: 0x000a, 0x1972: 0x000a, 0x1973: 0x000a, + 0x1976: 0x000a, 0x1977: 0x000a, 0x1978: 0x000a, 0x1979: 0x000a, 0x197a: 0x000a, 0x197b: 0x000a, + 0x197c: 0x000a, 0x197d: 0x000a, 0x197e: 0x000a, 0x197f: 0x000a, + // Block 0x66, offset 0x1980 + 0x1980: 0x000a, 0x1981: 0x000a, 0x1982: 0x000a, 0x1983: 0x000a, 0x1984: 0x000a, 0x1985: 0x000a, + 0x1986: 0x000a, 0x1987: 0x000a, 0x1988: 0x000a, 0x1989: 0x000a, 0x198a: 0x000a, 0x198b: 0x000a, + 0x198c: 0x000a, 0x198d: 0x000a, 0x198e: 0x000a, 0x198f: 0x000a, 0x1990: 0x000a, 0x1991: 0x000a, + 0x1992: 0x000a, 0x1993: 0x000a, 0x1994: 0x000a, 0x1995: 0x000a, + 0x1998: 0x000a, 0x1999: 0x000a, 0x199a: 0x000a, 0x199b: 0x000a, 0x199c: 0x000a, 0x199d: 0x000a, + 0x199e: 0x000a, 0x199f: 0x000a, 0x19a0: 0x000a, 0x19a1: 0x000a, 0x19a2: 0x000a, 0x19a3: 0x000a, + 0x19a4: 0x000a, 0x19a5: 0x000a, 0x19a6: 0x000a, 0x19a7: 0x000a, 0x19a8: 0x000a, 0x19a9: 0x000a, + 0x19aa: 0x000a, 0x19ab: 0x000a, 0x19ac: 0x000a, 0x19ad: 0x000a, 0x19ae: 0x000a, 0x19af: 0x000a, + 0x19b0: 0x000a, 0x19b1: 0x000a, 0x19b2: 0x000a, 0x19b3: 0x000a, 0x19b4: 0x000a, 0x19b5: 0x000a, + 0x19b6: 0x000a, 0x19b7: 0x000a, 0x19b8: 0x000a, 0x19b9: 0x000a, + 0x19bd: 0x000a, 0x19be: 0x000a, 0x19bf: 0x000a, + // Block 0x67, offset 0x19c0 + 0x19c0: 0x000a, 0x19c1: 0x000a, 0x19c2: 0x000a, 0x19c3: 0x000a, 0x19c4: 0x000a, 0x19c5: 0x000a, + 0x19c6: 0x000a, 0x19c7: 0x000a, 0x19c8: 0x000a, 0x19ca: 0x000a, 0x19cb: 0x000a, + 0x19cc: 0x000a, 0x19cd: 0x000a, 0x19ce: 0x000a, 0x19cf: 0x000a, 0x19d0: 0x000a, 0x19d1: 0x000a, + 0x19ec: 0x000a, 0x19ed: 0x000a, 0x19ee: 0x000a, 0x19ef: 0x000a, + // Block 0x68, offset 0x1a00 + 0x1a25: 0x000a, 0x1a26: 0x000a, 0x1a27: 0x000a, 0x1a28: 0x000a, 0x1a29: 0x000a, + 0x1a2a: 0x000a, 0x1a2f: 0x000c, + 0x1a30: 0x000c, 0x1a31: 0x000c, + 0x1a39: 0x000a, 0x1a3a: 0x000a, 0x1a3b: 0x000a, + 0x1a3c: 0x000a, 0x1a3d: 0x000a, 0x1a3e: 0x000a, 0x1a3f: 0x000a, + // Block 0x69, offset 0x1a40 + 0x1a7f: 0x000c, + // Block 0x6a, offset 0x1a80 + 0x1aa0: 0x000c, 0x1aa1: 0x000c, 0x1aa2: 0x000c, 0x1aa3: 0x000c, + 0x1aa4: 0x000c, 0x1aa5: 0x000c, 0x1aa6: 0x000c, 0x1aa7: 0x000c, 0x1aa8: 0x000c, 0x1aa9: 0x000c, + 0x1aaa: 0x000c, 0x1aab: 0x000c, 0x1aac: 0x000c, 0x1aad: 0x000c, 0x1aae: 0x000c, 0x1aaf: 0x000c, + 0x1ab0: 0x000c, 0x1ab1: 0x000c, 0x1ab2: 0x000c, 0x1ab3: 0x000c, 0x1ab4: 0x000c, 0x1ab5: 0x000c, + 0x1ab6: 0x000c, 0x1ab7: 0x000c, 0x1ab8: 0x000c, 0x1ab9: 0x000c, 0x1aba: 0x000c, 0x1abb: 0x000c, + 0x1abc: 0x000c, 0x1abd: 0x000c, 0x1abe: 0x000c, 0x1abf: 0x000c, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x000a, 0x1ac1: 0x000a, 0x1ac2: 0x000a, 0x1ac3: 0x000a, 0x1ac4: 0x000a, 0x1ac5: 0x000a, + 0x1ac6: 0x000a, 0x1ac7: 0x000a, 0x1ac8: 0x000a, 0x1ac9: 0x000a, 0x1aca: 0x000a, 0x1acb: 0x000a, + 0x1acc: 0x000a, 0x1acd: 0x000a, 0x1ace: 0x000a, 0x1acf: 0x000a, 0x1ad0: 0x000a, 0x1ad1: 0x000a, + 0x1ad2: 0x000a, 0x1ad3: 0x000a, 0x1ad4: 0x000a, 0x1ad5: 0x000a, 0x1ad6: 0x000a, 0x1ad7: 0x000a, + 0x1ad8: 0x000a, 0x1ad9: 0x000a, 0x1ada: 0x000a, 0x1adb: 0x000a, 0x1adc: 0x000a, 0x1add: 0x000a, + 0x1ade: 0x000a, 0x1adf: 0x000a, 0x1ae0: 0x000a, 0x1ae1: 0x000a, 0x1ae2: 0x003a, 0x1ae3: 0x002a, + 0x1ae4: 0x003a, 0x1ae5: 0x002a, 0x1ae6: 0x003a, 0x1ae7: 0x002a, 0x1ae8: 0x003a, 0x1ae9: 0x002a, + 0x1aea: 0x000a, 0x1aeb: 0x000a, 0x1aec: 0x000a, 0x1aed: 0x000a, 0x1aee: 0x000a, 0x1aef: 0x000a, + 0x1af0: 0x000a, 0x1af1: 0x000a, 0x1af2: 0x000a, 0x1af3: 0x000a, 0x1af4: 0x000a, 0x1af5: 0x000a, + 0x1af6: 0x000a, 0x1af7: 0x000a, 0x1af8: 0x000a, 0x1af9: 0x000a, 0x1afa: 0x000a, 0x1afb: 0x000a, + 0x1afc: 0x000a, 0x1afd: 0x000a, 0x1afe: 0x000a, 0x1aff: 0x000a, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x000a, 0x1b01: 0x000a, 0x1b02: 0x000a, 0x1b03: 0x000a, 0x1b04: 0x000a, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x000a, 0x1b41: 0x000a, 0x1b42: 0x000a, 0x1b43: 0x000a, 0x1b44: 0x000a, 0x1b45: 0x000a, + 0x1b46: 0x000a, 0x1b47: 0x000a, 0x1b48: 0x000a, 0x1b49: 0x000a, 0x1b4a: 0x000a, 0x1b4b: 0x000a, + 0x1b4c: 0x000a, 0x1b4d: 0x000a, 0x1b4e: 0x000a, 0x1b4f: 0x000a, 0x1b50: 0x000a, 0x1b51: 0x000a, + 0x1b52: 0x000a, 0x1b53: 0x000a, 0x1b54: 0x000a, 0x1b55: 0x000a, 0x1b56: 0x000a, 0x1b57: 0x000a, + 0x1b58: 0x000a, 0x1b59: 0x000a, 0x1b5b: 0x000a, 0x1b5c: 0x000a, 0x1b5d: 0x000a, + 0x1b5e: 0x000a, 0x1b5f: 0x000a, 0x1b60: 0x000a, 0x1b61: 0x000a, 0x1b62: 0x000a, 0x1b63: 0x000a, + 0x1b64: 0x000a, 0x1b65: 0x000a, 0x1b66: 0x000a, 0x1b67: 0x000a, 0x1b68: 0x000a, 0x1b69: 0x000a, + 0x1b6a: 0x000a, 0x1b6b: 0x000a, 0x1b6c: 0x000a, 0x1b6d: 0x000a, 0x1b6e: 0x000a, 0x1b6f: 0x000a, + 0x1b70: 0x000a, 0x1b71: 0x000a, 0x1b72: 0x000a, 0x1b73: 0x000a, 0x1b74: 0x000a, 0x1b75: 0x000a, + 0x1b76: 0x000a, 0x1b77: 0x000a, 0x1b78: 0x000a, 0x1b79: 0x000a, 0x1b7a: 0x000a, 0x1b7b: 0x000a, + 0x1b7c: 0x000a, 0x1b7d: 0x000a, 0x1b7e: 0x000a, 0x1b7f: 0x000a, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x000a, 0x1b81: 0x000a, 0x1b82: 0x000a, 0x1b83: 0x000a, 0x1b84: 0x000a, 0x1b85: 0x000a, + 0x1b86: 0x000a, 0x1b87: 0x000a, 0x1b88: 0x000a, 0x1b89: 0x000a, 0x1b8a: 0x000a, 0x1b8b: 0x000a, + 0x1b8c: 0x000a, 0x1b8d: 0x000a, 0x1b8e: 0x000a, 0x1b8f: 0x000a, 0x1b90: 0x000a, 0x1b91: 0x000a, + 0x1b92: 0x000a, 0x1b93: 0x000a, 0x1b94: 0x000a, 0x1b95: 0x000a, 0x1b96: 0x000a, 0x1b97: 0x000a, + 0x1b98: 0x000a, 0x1b99: 0x000a, 0x1b9a: 0x000a, 0x1b9b: 0x000a, 0x1b9c: 0x000a, 0x1b9d: 0x000a, + 0x1b9e: 0x000a, 0x1b9f: 0x000a, 0x1ba0: 0x000a, 0x1ba1: 0x000a, 0x1ba2: 0x000a, 0x1ba3: 0x000a, + 0x1ba4: 0x000a, 0x1ba5: 0x000a, 0x1ba6: 0x000a, 0x1ba7: 0x000a, 0x1ba8: 0x000a, 0x1ba9: 0x000a, + 0x1baa: 0x000a, 0x1bab: 0x000a, 0x1bac: 0x000a, 0x1bad: 0x000a, 0x1bae: 0x000a, 0x1baf: 0x000a, + 0x1bb0: 0x000a, 0x1bb1: 0x000a, 0x1bb2: 0x000a, 0x1bb3: 0x000a, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0x000a, 0x1bc1: 0x000a, 0x1bc2: 0x000a, 0x1bc3: 0x000a, 0x1bc4: 0x000a, 0x1bc5: 0x000a, + 0x1bc6: 0x000a, 0x1bc7: 0x000a, 0x1bc8: 0x000a, 0x1bc9: 0x000a, 0x1bca: 0x000a, 0x1bcb: 0x000a, + 0x1bcc: 0x000a, 0x1bcd: 0x000a, 0x1bce: 0x000a, 0x1bcf: 0x000a, 0x1bd0: 0x000a, 0x1bd1: 0x000a, + 0x1bd2: 0x000a, 0x1bd3: 0x000a, 0x1bd4: 0x000a, 0x1bd5: 0x000a, + 0x1bf0: 0x000a, 0x1bf1: 0x000a, 0x1bf2: 0x000a, 0x1bf3: 0x000a, 0x1bf4: 0x000a, 0x1bf5: 0x000a, + 0x1bf6: 0x000a, 0x1bf7: 0x000a, 0x1bf8: 0x000a, 0x1bf9: 0x000a, 0x1bfa: 0x000a, 0x1bfb: 0x000a, + // Block 0x70, offset 0x1c00 + 0x1c00: 0x0009, 0x1c01: 0x000a, 0x1c02: 0x000a, 0x1c03: 0x000a, 0x1c04: 0x000a, + 0x1c08: 0x003a, 0x1c09: 0x002a, 0x1c0a: 0x003a, 0x1c0b: 0x002a, + 0x1c0c: 0x003a, 0x1c0d: 0x002a, 0x1c0e: 0x003a, 0x1c0f: 0x002a, 0x1c10: 0x003a, 0x1c11: 0x002a, + 0x1c12: 0x000a, 0x1c13: 0x000a, 0x1c14: 0x003a, 0x1c15: 0x002a, 0x1c16: 0x003a, 0x1c17: 0x002a, + 0x1c18: 0x003a, 0x1c19: 0x002a, 0x1c1a: 0x003a, 0x1c1b: 0x002a, 0x1c1c: 0x000a, 0x1c1d: 0x000a, + 0x1c1e: 0x000a, 0x1c1f: 0x000a, 0x1c20: 0x000a, + 0x1c2a: 0x000c, 0x1c2b: 0x000c, 0x1c2c: 0x000c, 0x1c2d: 0x000c, + 0x1c30: 0x000a, + 0x1c36: 0x000a, 0x1c37: 0x000a, + 0x1c3d: 0x000a, 0x1c3e: 0x000a, 0x1c3f: 0x000a, + // Block 0x71, offset 0x1c40 + 0x1c59: 0x000c, 0x1c5a: 0x000c, 0x1c5b: 0x000a, 0x1c5c: 0x000a, + 0x1c60: 0x000a, + // Block 0x72, offset 0x1c80 + 0x1cbb: 0x000a, + // Block 0x73, offset 0x1cc0 + 0x1cc0: 0x000a, 0x1cc1: 0x000a, 0x1cc2: 0x000a, 0x1cc3: 0x000a, 0x1cc4: 0x000a, 0x1cc5: 0x000a, + 0x1cc6: 0x000a, 0x1cc7: 0x000a, 0x1cc8: 0x000a, 0x1cc9: 0x000a, 0x1cca: 0x000a, 0x1ccb: 0x000a, + 0x1ccc: 0x000a, 0x1ccd: 0x000a, 0x1cce: 0x000a, 0x1ccf: 0x000a, 0x1cd0: 0x000a, 0x1cd1: 0x000a, + 0x1cd2: 0x000a, 0x1cd3: 0x000a, 0x1cd4: 0x000a, 0x1cd5: 0x000a, 0x1cd6: 0x000a, 0x1cd7: 0x000a, + 0x1cd8: 0x000a, 0x1cd9: 0x000a, 0x1cda: 0x000a, 0x1cdb: 0x000a, 0x1cdc: 0x000a, 0x1cdd: 0x000a, + 0x1cde: 0x000a, 0x1cdf: 0x000a, 0x1ce0: 0x000a, 0x1ce1: 0x000a, 0x1ce2: 0x000a, 0x1ce3: 0x000a, + // Block 0x74, offset 0x1d00 + 0x1d1d: 0x000a, + 0x1d1e: 0x000a, + // Block 0x75, offset 0x1d40 + 0x1d50: 0x000a, 0x1d51: 0x000a, + 0x1d52: 0x000a, 0x1d53: 0x000a, 0x1d54: 0x000a, 0x1d55: 0x000a, 0x1d56: 0x000a, 0x1d57: 0x000a, + 0x1d58: 0x000a, 0x1d59: 0x000a, 0x1d5a: 0x000a, 0x1d5b: 0x000a, 0x1d5c: 0x000a, 0x1d5d: 0x000a, + 0x1d5e: 0x000a, 0x1d5f: 0x000a, + 0x1d7c: 0x000a, 0x1d7d: 0x000a, 0x1d7e: 0x000a, + // Block 0x76, offset 0x1d80 + 0x1db1: 0x000a, 0x1db2: 0x000a, 0x1db3: 0x000a, 0x1db4: 0x000a, 0x1db5: 0x000a, + 0x1db6: 0x000a, 0x1db7: 0x000a, 0x1db8: 0x000a, 0x1db9: 0x000a, 0x1dba: 0x000a, 0x1dbb: 0x000a, + 0x1dbc: 0x000a, 0x1dbd: 0x000a, 0x1dbe: 0x000a, 0x1dbf: 0x000a, + // Block 0x77, offset 0x1dc0 + 0x1dcc: 0x000a, 0x1dcd: 0x000a, 0x1dce: 0x000a, 0x1dcf: 0x000a, + // Block 0x78, offset 0x1e00 + 0x1e37: 0x000a, 0x1e38: 0x000a, 0x1e39: 0x000a, 0x1e3a: 0x000a, + // Block 0x79, offset 0x1e40 + 0x1e5e: 0x000a, 0x1e5f: 0x000a, + 0x1e7f: 0x000a, + // Block 0x7a, offset 0x1e80 + 0x1e90: 0x000a, 0x1e91: 0x000a, + 0x1e92: 0x000a, 0x1e93: 0x000a, 0x1e94: 0x000a, 0x1e95: 0x000a, 0x1e96: 0x000a, 0x1e97: 0x000a, + 0x1e98: 0x000a, 0x1e99: 0x000a, 0x1e9a: 0x000a, 0x1e9b: 0x000a, 0x1e9c: 0x000a, 0x1e9d: 0x000a, + 0x1e9e: 0x000a, 0x1e9f: 0x000a, 0x1ea0: 0x000a, 0x1ea1: 0x000a, 0x1ea2: 0x000a, 0x1ea3: 0x000a, + 0x1ea4: 0x000a, 0x1ea5: 0x000a, 0x1ea6: 0x000a, 0x1ea7: 0x000a, 0x1ea8: 0x000a, 0x1ea9: 0x000a, + 0x1eaa: 0x000a, 0x1eab: 0x000a, 0x1eac: 0x000a, 0x1ead: 0x000a, 0x1eae: 0x000a, 0x1eaf: 0x000a, + 0x1eb0: 0x000a, 0x1eb1: 0x000a, 0x1eb2: 0x000a, 0x1eb3: 0x000a, 0x1eb4: 0x000a, 0x1eb5: 0x000a, + 0x1eb6: 0x000a, 0x1eb7: 0x000a, 0x1eb8: 0x000a, 0x1eb9: 0x000a, 0x1eba: 0x000a, 0x1ebb: 0x000a, + 0x1ebc: 0x000a, 0x1ebd: 0x000a, 0x1ebe: 0x000a, 0x1ebf: 0x000a, + // Block 0x7b, offset 0x1ec0 + 0x1ec0: 0x000a, 0x1ec1: 0x000a, 0x1ec2: 0x000a, 0x1ec3: 0x000a, 0x1ec4: 0x000a, 0x1ec5: 0x000a, + 0x1ec6: 0x000a, + // Block 0x7c, offset 0x1f00 + 0x1f0d: 0x000a, 0x1f0e: 0x000a, 0x1f0f: 0x000a, + // Block 0x7d, offset 0x1f40 + 0x1f6f: 0x000c, + 0x1f70: 0x000c, 0x1f71: 0x000c, 0x1f72: 0x000c, 0x1f73: 0x000a, 0x1f74: 0x000c, 0x1f75: 0x000c, + 0x1f76: 0x000c, 0x1f77: 0x000c, 0x1f78: 0x000c, 0x1f79: 0x000c, 0x1f7a: 0x000c, 0x1f7b: 0x000c, + 0x1f7c: 0x000c, 0x1f7d: 0x000c, 0x1f7e: 0x000a, 0x1f7f: 0x000a, + // Block 0x7e, offset 0x1f80 + 0x1f9e: 0x000c, 0x1f9f: 0x000c, + // Block 0x7f, offset 0x1fc0 + 0x1ff0: 0x000c, 0x1ff1: 0x000c, + // Block 0x80, offset 0x2000 + 0x2000: 0x000a, 0x2001: 0x000a, 0x2002: 0x000a, 0x2003: 0x000a, 0x2004: 0x000a, 0x2005: 0x000a, + 0x2006: 0x000a, 0x2007: 0x000a, 0x2008: 0x000a, 0x2009: 0x000a, 0x200a: 0x000a, 0x200b: 0x000a, + 0x200c: 0x000a, 0x200d: 0x000a, 0x200e: 0x000a, 0x200f: 0x000a, 0x2010: 0x000a, 0x2011: 0x000a, + 0x2012: 0x000a, 0x2013: 0x000a, 0x2014: 0x000a, 0x2015: 0x000a, 0x2016: 0x000a, 0x2017: 0x000a, + 0x2018: 0x000a, 0x2019: 0x000a, 0x201a: 0x000a, 0x201b: 0x000a, 0x201c: 0x000a, 0x201d: 0x000a, + 0x201e: 0x000a, 0x201f: 0x000a, 0x2020: 0x000a, 0x2021: 0x000a, + // Block 0x81, offset 0x2040 + 0x2048: 0x000a, + // Block 0x82, offset 0x2080 + 0x2082: 0x000c, + 0x2086: 0x000c, 0x208b: 0x000c, + 0x20a5: 0x000c, 0x20a6: 0x000c, 0x20a8: 0x000a, 0x20a9: 0x000a, + 0x20aa: 0x000a, 0x20ab: 0x000a, + 0x20b8: 0x0004, 0x20b9: 0x0004, + // Block 0x83, offset 0x20c0 + 0x20f4: 0x000a, 0x20f5: 0x000a, + 0x20f6: 0x000a, 0x20f7: 0x000a, + // Block 0x84, offset 0x2100 + 0x2104: 0x000c, 0x2105: 0x000c, + 0x2120: 0x000c, 0x2121: 0x000c, 0x2122: 0x000c, 0x2123: 0x000c, + 0x2124: 0x000c, 0x2125: 0x000c, 0x2126: 0x000c, 0x2127: 0x000c, 0x2128: 0x000c, 0x2129: 0x000c, + 0x212a: 0x000c, 0x212b: 0x000c, 0x212c: 0x000c, 0x212d: 0x000c, 0x212e: 0x000c, 0x212f: 0x000c, + 0x2130: 0x000c, 0x2131: 0x000c, + // Block 0x85, offset 0x2140 + 0x2166: 0x000c, 0x2167: 0x000c, 0x2168: 0x000c, 0x2169: 0x000c, + 0x216a: 0x000c, 0x216b: 0x000c, 0x216c: 0x000c, 0x216d: 0x000c, + // Block 0x86, offset 0x2180 + 0x2187: 0x000c, 0x2188: 0x000c, 0x2189: 0x000c, 0x218a: 0x000c, 0x218b: 0x000c, + 0x218c: 0x000c, 0x218d: 0x000c, 0x218e: 0x000c, 0x218f: 0x000c, 0x2190: 0x000c, 0x2191: 0x000c, + // Block 0x87, offset 0x21c0 + 0x21c0: 0x000c, 0x21c1: 0x000c, 0x21c2: 0x000c, + 0x21f3: 0x000c, + 0x21f6: 0x000c, 0x21f7: 0x000c, 0x21f8: 0x000c, 0x21f9: 0x000c, + 0x21fc: 0x000c, + // Block 0x88, offset 0x2200 + 0x2225: 0x000c, + // Block 0x89, offset 0x2240 + 0x2269: 0x000c, + 0x226a: 0x000c, 0x226b: 0x000c, 0x226c: 0x000c, 0x226d: 0x000c, 0x226e: 0x000c, + 0x2271: 0x000c, 0x2272: 0x000c, 0x2275: 0x000c, + 0x2276: 0x000c, + // Block 0x8a, offset 0x2280 + 0x2283: 0x000c, + 0x228c: 0x000c, + 0x22bc: 0x000c, + // Block 0x8b, offset 0x22c0 + 0x22f0: 0x000c, 0x22f2: 0x000c, 0x22f3: 0x000c, 0x22f4: 0x000c, + 0x22f7: 0x000c, 0x22f8: 0x000c, + 0x22fe: 0x000c, 0x22ff: 0x000c, + // Block 0x8c, offset 0x2300 + 0x2301: 0x000c, + 0x232c: 0x000c, 0x232d: 0x000c, + 0x2336: 0x000c, + // Block 0x8d, offset 0x2340 + 0x2365: 0x000c, 0x2368: 0x000c, + 0x236d: 0x000c, + // Block 0x8e, offset 0x2380 + 0x239d: 0x0001, + 0x239e: 0x000c, 0x239f: 0x0001, 0x23a0: 0x0001, 0x23a1: 0x0001, 0x23a2: 0x0001, 0x23a3: 0x0001, + 0x23a4: 0x0001, 0x23a5: 0x0001, 0x23a6: 0x0001, 0x23a7: 0x0001, 0x23a8: 0x0001, 0x23a9: 0x0003, + 0x23aa: 0x0001, 0x23ab: 0x0001, 0x23ac: 0x0001, 0x23ad: 0x0001, 0x23ae: 0x0001, 0x23af: 0x0001, + 0x23b0: 0x0001, 0x23b1: 0x0001, 0x23b2: 0x0001, 0x23b3: 0x0001, 0x23b4: 0x0001, 0x23b5: 0x0001, + 0x23b6: 0x0001, 0x23b7: 0x0001, 0x23b8: 0x0001, 0x23b9: 0x0001, 0x23ba: 0x0001, 0x23bb: 0x0001, + 0x23bc: 0x0001, 0x23bd: 0x0001, 0x23be: 0x0001, 0x23bf: 0x0001, + // Block 0x8f, offset 0x23c0 + 0x23c0: 0x0001, 0x23c1: 0x0001, 0x23c2: 0x0001, 0x23c3: 0x0001, 0x23c4: 0x0001, 0x23c5: 0x0001, + 0x23c6: 0x0001, 0x23c7: 0x0001, 0x23c8: 0x0001, 0x23c9: 0x0001, 0x23ca: 0x0001, 0x23cb: 0x0001, + 0x23cc: 0x0001, 0x23cd: 0x0001, 0x23ce: 0x0001, 0x23cf: 0x0001, 0x23d0: 0x000d, 0x23d1: 0x000d, + 0x23d2: 0x000d, 0x23d3: 0x000d, 0x23d4: 0x000d, 0x23d5: 0x000d, 0x23d6: 0x000d, 0x23d7: 0x000d, + 0x23d8: 0x000d, 0x23d9: 0x000d, 0x23da: 0x000d, 0x23db: 0x000d, 0x23dc: 0x000d, 0x23dd: 0x000d, + 0x23de: 0x000d, 0x23df: 0x000d, 0x23e0: 0x000d, 0x23e1: 0x000d, 0x23e2: 0x000d, 0x23e3: 0x000d, + 0x23e4: 0x000d, 0x23e5: 0x000d, 0x23e6: 0x000d, 0x23e7: 0x000d, 0x23e8: 0x000d, 0x23e9: 0x000d, + 0x23ea: 0x000d, 0x23eb: 0x000d, 0x23ec: 0x000d, 0x23ed: 0x000d, 0x23ee: 0x000d, 0x23ef: 0x000d, + 0x23f0: 0x000d, 0x23f1: 0x000d, 0x23f2: 0x000d, 0x23f3: 0x000d, 0x23f4: 0x000d, 0x23f5: 0x000d, + 0x23f6: 0x000d, 0x23f7: 0x000d, 0x23f8: 0x000d, 0x23f9: 0x000d, 0x23fa: 0x000d, 0x23fb: 0x000d, + 0x23fc: 0x000d, 0x23fd: 0x000d, 0x23fe: 0x000d, 0x23ff: 0x000d, + // Block 0x90, offset 0x2400 + 0x2400: 0x000d, 0x2401: 0x000d, 0x2402: 0x000d, 0x2403: 0x000d, 0x2404: 0x000d, 0x2405: 0x000d, + 0x2406: 0x000d, 0x2407: 0x000d, 0x2408: 0x000d, 0x2409: 0x000d, 0x240a: 0x000d, 0x240b: 0x000d, + 0x240c: 0x000d, 0x240d: 0x000d, 0x240e: 0x000d, 0x240f: 0x000d, 0x2410: 0x000d, 0x2411: 0x000d, + 0x2412: 0x000d, 0x2413: 0x000d, 0x2414: 0x000d, 0x2415: 0x000d, 0x2416: 0x000d, 0x2417: 0x000d, + 0x2418: 0x000d, 0x2419: 0x000d, 0x241a: 0x000d, 0x241b: 0x000d, 0x241c: 0x000d, 0x241d: 0x000d, + 0x241e: 0x000d, 0x241f: 0x000d, 0x2420: 0x000d, 0x2421: 0x000d, 0x2422: 0x000d, 0x2423: 0x000d, + 0x2424: 0x000d, 0x2425: 0x000d, 0x2426: 0x000d, 0x2427: 0x000d, 0x2428: 0x000d, 0x2429: 0x000d, + 0x242a: 0x000d, 0x242b: 0x000d, 0x242c: 0x000d, 0x242d: 0x000d, 0x242e: 0x000d, 0x242f: 0x000d, + 0x2430: 0x000d, 0x2431: 0x000d, 0x2432: 0x000d, 0x2433: 0x000d, 0x2434: 0x000d, 0x2435: 0x000d, + 0x2436: 0x000d, 0x2437: 0x000d, 0x2438: 0x000d, 0x2439: 0x000d, 0x243a: 0x000d, 0x243b: 0x000d, + 0x243c: 0x000d, 0x243d: 0x000d, 0x243e: 0x000a, 0x243f: 0x000a, + // Block 0x91, offset 0x2440 + 0x2440: 0x000d, 0x2441: 0x000d, 0x2442: 0x000d, 0x2443: 0x000d, 0x2444: 0x000d, 0x2445: 0x000d, + 0x2446: 0x000d, 0x2447: 0x000d, 0x2448: 0x000d, 0x2449: 0x000d, 0x244a: 0x000d, 0x244b: 0x000d, + 0x244c: 0x000d, 0x244d: 0x000d, 0x244e: 0x000d, 0x244f: 0x000d, 0x2450: 0x000b, 0x2451: 0x000b, + 0x2452: 0x000b, 0x2453: 0x000b, 0x2454: 0x000b, 0x2455: 0x000b, 0x2456: 0x000b, 0x2457: 0x000b, + 0x2458: 0x000b, 0x2459: 0x000b, 0x245a: 0x000b, 0x245b: 0x000b, 0x245c: 0x000b, 0x245d: 0x000b, + 0x245e: 0x000b, 0x245f: 0x000b, 0x2460: 0x000b, 0x2461: 0x000b, 0x2462: 0x000b, 0x2463: 0x000b, + 0x2464: 0x000b, 0x2465: 0x000b, 0x2466: 0x000b, 0x2467: 0x000b, 0x2468: 0x000b, 0x2469: 0x000b, + 0x246a: 0x000b, 0x246b: 0x000b, 0x246c: 0x000b, 0x246d: 0x000b, 0x246e: 0x000b, 0x246f: 0x000b, + 0x2470: 0x000d, 0x2471: 0x000d, 0x2472: 0x000d, 0x2473: 0x000d, 0x2474: 0x000d, 0x2475: 0x000d, + 0x2476: 0x000d, 0x2477: 0x000d, 0x2478: 0x000d, 0x2479: 0x000d, 0x247a: 0x000d, 0x247b: 0x000d, + 0x247c: 0x000d, 0x247d: 0x000a, 0x247e: 0x000d, 0x247f: 0x000d, + // Block 0x92, offset 0x2480 + 0x2480: 0x000c, 0x2481: 0x000c, 0x2482: 0x000c, 0x2483: 0x000c, 0x2484: 0x000c, 0x2485: 0x000c, + 0x2486: 0x000c, 0x2487: 0x000c, 0x2488: 0x000c, 0x2489: 0x000c, 0x248a: 0x000c, 0x248b: 0x000c, + 0x248c: 0x000c, 0x248d: 0x000c, 0x248e: 0x000c, 0x248f: 0x000c, 0x2490: 0x000a, 0x2491: 0x000a, + 0x2492: 0x000a, 0x2493: 0x000a, 0x2494: 0x000a, 0x2495: 0x000a, 0x2496: 0x000a, 0x2497: 0x000a, + 0x2498: 0x000a, 0x2499: 0x000a, + 0x24a0: 0x000c, 0x24a1: 0x000c, 0x24a2: 0x000c, 0x24a3: 0x000c, + 0x24a4: 0x000c, 0x24a5: 0x000c, 0x24a6: 0x000c, 0x24a7: 0x000c, 0x24a8: 0x000c, 0x24a9: 0x000c, + 0x24aa: 0x000c, 0x24ab: 0x000c, 0x24ac: 0x000c, 0x24ad: 0x000c, 0x24ae: 0x000c, 0x24af: 0x000c, + 0x24b0: 0x000a, 0x24b1: 0x000a, 0x24b2: 0x000a, 0x24b3: 0x000a, 0x24b4: 0x000a, 0x24b5: 0x000a, + 0x24b6: 0x000a, 0x24b7: 0x000a, 0x24b8: 0x000a, 0x24b9: 0x000a, 0x24ba: 0x000a, 0x24bb: 0x000a, + 0x24bc: 0x000a, 0x24bd: 0x000a, 0x24be: 0x000a, 0x24bf: 0x000a, + // Block 0x93, offset 0x24c0 + 0x24c0: 0x000a, 0x24c1: 0x000a, 0x24c2: 0x000a, 0x24c3: 0x000a, 0x24c4: 0x000a, 0x24c5: 0x000a, + 0x24c6: 0x000a, 0x24c7: 0x000a, 0x24c8: 0x000a, 0x24c9: 0x000a, 0x24ca: 0x000a, 0x24cb: 0x000a, + 0x24cc: 0x000a, 0x24cd: 0x000a, 0x24ce: 0x000a, 0x24cf: 0x000a, 0x24d0: 0x0006, 0x24d1: 0x000a, + 0x24d2: 0x0006, 0x24d4: 0x000a, 0x24d5: 0x0006, 0x24d6: 0x000a, 0x24d7: 0x000a, + 0x24d8: 0x000a, 0x24d9: 0x009a, 0x24da: 0x008a, 0x24db: 0x007a, 0x24dc: 0x006a, 0x24dd: 0x009a, + 0x24de: 0x008a, 0x24df: 0x0004, 0x24e0: 0x000a, 0x24e1: 0x000a, 0x24e2: 0x0003, 0x24e3: 0x0003, + 0x24e4: 0x000a, 0x24e5: 0x000a, 0x24e6: 0x000a, 0x24e8: 0x000a, 0x24e9: 0x0004, + 0x24ea: 0x0004, 0x24eb: 0x000a, + 0x24f0: 0x000d, 0x24f1: 0x000d, 0x24f2: 0x000d, 0x24f3: 0x000d, 0x24f4: 0x000d, 0x24f5: 0x000d, + 0x24f6: 0x000d, 0x24f7: 0x000d, 0x24f8: 0x000d, 0x24f9: 0x000d, 0x24fa: 0x000d, 0x24fb: 0x000d, + 0x24fc: 0x000d, 0x24fd: 0x000d, 0x24fe: 0x000d, 0x24ff: 0x000d, + // Block 0x94, offset 0x2500 + 0x2500: 0x000d, 0x2501: 0x000d, 0x2502: 0x000d, 0x2503: 0x000d, 0x2504: 0x000d, 0x2505: 0x000d, + 0x2506: 0x000d, 0x2507: 0x000d, 0x2508: 0x000d, 0x2509: 0x000d, 0x250a: 0x000d, 0x250b: 0x000d, + 0x250c: 0x000d, 0x250d: 0x000d, 0x250e: 0x000d, 0x250f: 0x000d, 0x2510: 0x000d, 0x2511: 0x000d, + 0x2512: 0x000d, 0x2513: 0x000d, 0x2514: 0x000d, 0x2515: 0x000d, 0x2516: 0x000d, 0x2517: 0x000d, + 0x2518: 0x000d, 0x2519: 0x000d, 0x251a: 0x000d, 0x251b: 0x000d, 0x251c: 0x000d, 0x251d: 0x000d, + 0x251e: 0x000d, 0x251f: 0x000d, 0x2520: 0x000d, 0x2521: 0x000d, 0x2522: 0x000d, 0x2523: 0x000d, + 0x2524: 0x000d, 0x2525: 0x000d, 0x2526: 0x000d, 0x2527: 0x000d, 0x2528: 0x000d, 0x2529: 0x000d, + 0x252a: 0x000d, 0x252b: 0x000d, 0x252c: 0x000d, 0x252d: 0x000d, 0x252e: 0x000d, 0x252f: 0x000d, + 0x2530: 0x000d, 0x2531: 0x000d, 0x2532: 0x000d, 0x2533: 0x000d, 0x2534: 0x000d, 0x2535: 0x000d, + 0x2536: 0x000d, 0x2537: 0x000d, 0x2538: 0x000d, 0x2539: 0x000d, 0x253a: 0x000d, 0x253b: 0x000d, + 0x253c: 0x000d, 0x253d: 0x000d, 0x253e: 0x000d, 0x253f: 0x000b, + // Block 0x95, offset 0x2540 + 0x2541: 0x000a, 0x2542: 0x000a, 0x2543: 0x0004, 0x2544: 0x0004, 0x2545: 0x0004, + 0x2546: 0x000a, 0x2547: 0x000a, 0x2548: 0x003a, 0x2549: 0x002a, 0x254a: 0x000a, 0x254b: 0x0003, + 0x254c: 0x0006, 0x254d: 0x0003, 0x254e: 0x0006, 0x254f: 0x0006, 0x2550: 0x0002, 0x2551: 0x0002, + 0x2552: 0x0002, 0x2553: 0x0002, 0x2554: 0x0002, 0x2555: 0x0002, 0x2556: 0x0002, 0x2557: 0x0002, + 0x2558: 0x0002, 0x2559: 0x0002, 0x255a: 0x0006, 0x255b: 0x000a, 0x255c: 0x000a, 0x255d: 0x000a, + 0x255e: 0x000a, 0x255f: 0x000a, 0x2560: 0x000a, + 0x257b: 0x005a, + 0x257c: 0x000a, 0x257d: 0x004a, 0x257e: 0x000a, 0x257f: 0x000a, + // Block 0x96, offset 0x2580 + 0x2580: 0x000a, + 0x259b: 0x005a, 0x259c: 0x000a, 0x259d: 0x004a, + 0x259e: 0x000a, 0x259f: 0x00fa, 0x25a0: 0x00ea, 0x25a1: 0x000a, 0x25a2: 0x003a, 0x25a3: 0x002a, + 0x25a4: 0x000a, 0x25a5: 0x000a, + // Block 0x97, offset 0x25c0 + 0x25e0: 0x0004, 0x25e1: 0x0004, 0x25e2: 0x000a, 0x25e3: 0x000a, + 0x25e4: 0x000a, 0x25e5: 0x0004, 0x25e6: 0x0004, 0x25e8: 0x000a, 0x25e9: 0x000a, + 0x25ea: 0x000a, 0x25eb: 0x000a, 0x25ec: 0x000a, 0x25ed: 0x000a, 0x25ee: 0x000a, + 0x25f0: 0x000b, 0x25f1: 0x000b, 0x25f2: 0x000b, 0x25f3: 0x000b, 0x25f4: 0x000b, 0x25f5: 0x000b, + 0x25f6: 0x000b, 0x25f7: 0x000b, 0x25f8: 0x000b, 0x25f9: 0x000a, 0x25fa: 0x000a, 0x25fb: 0x000a, + 0x25fc: 0x000a, 0x25fd: 0x000a, 0x25fe: 0x000b, 0x25ff: 0x000b, + // Block 0x98, offset 0x2600 + 0x2601: 0x000a, + // Block 0x99, offset 0x2640 + 0x2640: 0x000a, 0x2641: 0x000a, 0x2642: 0x000a, 0x2643: 0x000a, 0x2644: 0x000a, 0x2645: 0x000a, + 0x2646: 0x000a, 0x2647: 0x000a, 0x2648: 0x000a, 0x2649: 0x000a, 0x264a: 0x000a, 0x264b: 0x000a, + 0x264c: 0x000a, 0x2650: 0x000a, 0x2651: 0x000a, + 0x2652: 0x000a, 0x2653: 0x000a, 0x2654: 0x000a, 0x2655: 0x000a, 0x2656: 0x000a, 0x2657: 0x000a, + 0x2658: 0x000a, 0x2659: 0x000a, 0x265a: 0x000a, 0x265b: 0x000a, + 0x2660: 0x000a, + // Block 0x9a, offset 0x2680 + 0x26bd: 0x000c, + // Block 0x9b, offset 0x26c0 + 0x26e0: 0x000c, 0x26e1: 0x0002, 0x26e2: 0x0002, 0x26e3: 0x0002, + 0x26e4: 0x0002, 0x26e5: 0x0002, 0x26e6: 0x0002, 0x26e7: 0x0002, 0x26e8: 0x0002, 0x26e9: 0x0002, + 0x26ea: 0x0002, 0x26eb: 0x0002, 0x26ec: 0x0002, 0x26ed: 0x0002, 0x26ee: 0x0002, 0x26ef: 0x0002, + 0x26f0: 0x0002, 0x26f1: 0x0002, 0x26f2: 0x0002, 0x26f3: 0x0002, 0x26f4: 0x0002, 0x26f5: 0x0002, + 0x26f6: 0x0002, 0x26f7: 0x0002, 0x26f8: 0x0002, 0x26f9: 0x0002, 0x26fa: 0x0002, 0x26fb: 0x0002, + // Block 0x9c, offset 0x2700 + 0x2736: 0x000c, 0x2737: 0x000c, 0x2738: 0x000c, 0x2739: 0x000c, 0x273a: 0x000c, + // Block 0x9d, offset 0x2740 + 0x2740: 0x0001, 0x2741: 0x0001, 0x2742: 0x0001, 0x2743: 0x0001, 0x2744: 0x0001, 0x2745: 0x0001, + 0x2746: 0x0001, 0x2747: 0x0001, 0x2748: 0x0001, 0x2749: 0x0001, 0x274a: 0x0001, 0x274b: 0x0001, + 0x274c: 0x0001, 0x274d: 0x0001, 0x274e: 0x0001, 0x274f: 0x0001, 0x2750: 0x0001, 0x2751: 0x0001, + 0x2752: 0x0001, 0x2753: 0x0001, 0x2754: 0x0001, 0x2755: 0x0001, 0x2756: 0x0001, 0x2757: 0x0001, + 0x2758: 0x0001, 0x2759: 0x0001, 0x275a: 0x0001, 0x275b: 0x0001, 0x275c: 0x0001, 0x275d: 0x0001, + 0x275e: 0x0001, 0x275f: 0x0001, 0x2760: 0x0001, 0x2761: 0x0001, 0x2762: 0x0001, 0x2763: 0x0001, + 0x2764: 0x0001, 0x2765: 0x0001, 0x2766: 0x0001, 0x2767: 0x0001, 0x2768: 0x0001, 0x2769: 0x0001, + 0x276a: 0x0001, 0x276b: 0x0001, 0x276c: 0x0001, 0x276d: 0x0001, 0x276e: 0x0001, 0x276f: 0x0001, + 0x2770: 0x0001, 0x2771: 0x0001, 0x2772: 0x0001, 0x2773: 0x0001, 0x2774: 0x0001, 0x2775: 0x0001, + 0x2776: 0x0001, 0x2777: 0x0001, 0x2778: 0x0001, 0x2779: 0x0001, 0x277a: 0x0001, 0x277b: 0x0001, + 0x277c: 0x0001, 0x277d: 0x0001, 0x277e: 0x0001, 0x277f: 0x0001, + // Block 0x9e, offset 0x2780 + 0x2780: 0x0001, 0x2781: 0x0001, 0x2782: 0x0001, 0x2783: 0x0001, 0x2784: 0x0001, 0x2785: 0x0001, + 0x2786: 0x0001, 0x2787: 0x0001, 0x2788: 0x0001, 0x2789: 0x0001, 0x278a: 0x0001, 0x278b: 0x0001, + 0x278c: 0x0001, 0x278d: 0x0001, 0x278e: 0x0001, 0x278f: 0x0001, 0x2790: 0x0001, 0x2791: 0x0001, + 0x2792: 0x0001, 0x2793: 0x0001, 0x2794: 0x0001, 0x2795: 0x0001, 0x2796: 0x0001, 0x2797: 0x0001, + 0x2798: 0x0001, 0x2799: 0x0001, 0x279a: 0x0001, 0x279b: 0x0001, 0x279c: 0x0001, 0x279d: 0x0001, + 0x279e: 0x0001, 0x279f: 0x000a, 0x27a0: 0x0001, 0x27a1: 0x0001, 0x27a2: 0x0001, 0x27a3: 0x0001, + 0x27a4: 0x0001, 0x27a5: 0x0001, 0x27a6: 0x0001, 0x27a7: 0x0001, 0x27a8: 0x0001, 0x27a9: 0x0001, + 0x27aa: 0x0001, 0x27ab: 0x0001, 0x27ac: 0x0001, 0x27ad: 0x0001, 0x27ae: 0x0001, 0x27af: 0x0001, + 0x27b0: 0x0001, 0x27b1: 0x0001, 0x27b2: 0x0001, 0x27b3: 0x0001, 0x27b4: 0x0001, 0x27b5: 0x0001, + 0x27b6: 0x0001, 0x27b7: 0x0001, 0x27b8: 0x0001, 0x27b9: 0x0001, 0x27ba: 0x0001, 0x27bb: 0x0001, + 0x27bc: 0x0001, 0x27bd: 0x0001, 0x27be: 0x0001, 0x27bf: 0x0001, + // Block 0x9f, offset 0x27c0 + 0x27c0: 0x0001, 0x27c1: 0x000c, 0x27c2: 0x000c, 0x27c3: 0x000c, 0x27c4: 0x0001, 0x27c5: 0x000c, + 0x27c6: 0x000c, 0x27c7: 0x0001, 0x27c8: 0x0001, 0x27c9: 0x0001, 0x27ca: 0x0001, 0x27cb: 0x0001, + 0x27cc: 0x000c, 0x27cd: 0x000c, 0x27ce: 0x000c, 0x27cf: 0x000c, 0x27d0: 0x0001, 0x27d1: 0x0001, + 0x27d2: 0x0001, 0x27d3: 0x0001, 0x27d4: 0x0001, 0x27d5: 0x0001, 0x27d6: 0x0001, 0x27d7: 0x0001, + 0x27d8: 0x0001, 0x27d9: 0x0001, 0x27da: 0x0001, 0x27db: 0x0001, 0x27dc: 0x0001, 0x27dd: 0x0001, + 0x27de: 0x0001, 0x27df: 0x0001, 0x27e0: 0x0001, 0x27e1: 0x0001, 0x27e2: 0x0001, 0x27e3: 0x0001, + 0x27e4: 0x0001, 0x27e5: 0x0001, 0x27e6: 0x0001, 0x27e7: 0x0001, 0x27e8: 0x0001, 0x27e9: 0x0001, + 0x27ea: 0x0001, 0x27eb: 0x0001, 0x27ec: 0x0001, 0x27ed: 0x0001, 0x27ee: 0x0001, 0x27ef: 0x0001, + 0x27f0: 0x0001, 0x27f1: 0x0001, 0x27f2: 0x0001, 0x27f3: 0x0001, 0x27f4: 0x0001, 0x27f5: 0x0001, + 0x27f6: 0x0001, 0x27f7: 0x0001, 0x27f8: 0x000c, 0x27f9: 0x000c, 0x27fa: 0x000c, 0x27fb: 0x0001, + 0x27fc: 0x0001, 0x27fd: 0x0001, 0x27fe: 0x0001, 0x27ff: 0x000c, + // Block 0xa0, offset 0x2800 + 0x2800: 0x0001, 0x2801: 0x0001, 0x2802: 0x0001, 0x2803: 0x0001, 0x2804: 0x0001, 0x2805: 0x0001, + 0x2806: 0x0001, 0x2807: 0x0001, 0x2808: 0x0001, 0x2809: 0x0001, 0x280a: 0x0001, 0x280b: 0x0001, + 0x280c: 0x0001, 0x280d: 0x0001, 0x280e: 0x0001, 0x280f: 0x0001, 0x2810: 0x0001, 0x2811: 0x0001, + 0x2812: 0x0001, 0x2813: 0x0001, 0x2814: 0x0001, 0x2815: 0x0001, 0x2816: 0x0001, 0x2817: 0x0001, + 0x2818: 0x0001, 0x2819: 0x0001, 0x281a: 0x0001, 0x281b: 0x0001, 0x281c: 0x0001, 0x281d: 0x0001, + 0x281e: 0x0001, 0x281f: 0x0001, 0x2820: 0x0001, 0x2821: 0x0001, 0x2822: 0x0001, 0x2823: 0x0001, + 0x2824: 0x0001, 0x2825: 0x000c, 0x2826: 0x000c, 0x2827: 0x0001, 0x2828: 0x0001, 0x2829: 0x0001, + 0x282a: 0x0001, 0x282b: 0x0001, 0x282c: 0x0001, 0x282d: 0x0001, 0x282e: 0x0001, 0x282f: 0x0001, + 0x2830: 0x0001, 0x2831: 0x0001, 0x2832: 0x0001, 0x2833: 0x0001, 0x2834: 0x0001, 0x2835: 0x0001, + 0x2836: 0x0001, 0x2837: 0x0001, 0x2838: 0x0001, 0x2839: 0x0001, 0x283a: 0x0001, 0x283b: 0x0001, + 0x283c: 0x0001, 0x283d: 0x0001, 0x283e: 0x0001, 0x283f: 0x0001, + // Block 0xa1, offset 0x2840 + 0x2840: 0x0001, 0x2841: 0x0001, 0x2842: 0x0001, 0x2843: 0x0001, 0x2844: 0x0001, 0x2845: 0x0001, + 0x2846: 0x0001, 0x2847: 0x0001, 0x2848: 0x0001, 0x2849: 0x0001, 0x284a: 0x0001, 0x284b: 0x0001, + 0x284c: 0x0001, 0x284d: 0x0001, 0x284e: 0x0001, 0x284f: 0x0001, 0x2850: 0x0001, 0x2851: 0x0001, + 0x2852: 0x0001, 0x2853: 0x0001, 0x2854: 0x0001, 0x2855: 0x0001, 0x2856: 0x0001, 0x2857: 0x0001, + 0x2858: 0x0001, 0x2859: 0x0001, 0x285a: 0x0001, 0x285b: 0x0001, 0x285c: 0x0001, 0x285d: 0x0001, + 0x285e: 0x0001, 0x285f: 0x0001, 0x2860: 0x0001, 0x2861: 0x0001, 0x2862: 0x0001, 0x2863: 0x0001, + 0x2864: 0x0001, 0x2865: 0x0001, 0x2866: 0x0001, 0x2867: 0x0001, 0x2868: 0x0001, 0x2869: 0x0001, + 0x286a: 0x0001, 0x286b: 0x0001, 0x286c: 0x0001, 0x286d: 0x0001, 0x286e: 0x0001, 0x286f: 0x0001, + 0x2870: 0x0001, 0x2871: 0x0001, 0x2872: 0x0001, 0x2873: 0x0001, 0x2874: 0x0001, 0x2875: 0x0001, + 0x2876: 0x0001, 0x2877: 0x0001, 0x2878: 0x0001, 0x2879: 0x000a, 0x287a: 0x000a, 0x287b: 0x000a, + 0x287c: 0x000a, 0x287d: 0x000a, 0x287e: 0x000a, 0x287f: 0x000a, + // Block 0xa2, offset 0x2880 + 0x2880: 0x0001, 0x2881: 0x0001, 0x2882: 0x0001, 0x2883: 0x0001, 0x2884: 0x0001, 0x2885: 0x0001, + 0x2886: 0x0001, 0x2887: 0x0001, 0x2888: 0x0001, 0x2889: 0x0001, 0x288a: 0x0001, 0x288b: 0x0001, + 0x288c: 0x0001, 0x288d: 0x0001, 0x288e: 0x0001, 0x288f: 0x0001, 0x2890: 0x0001, 0x2891: 0x0001, + 0x2892: 0x0001, 0x2893: 0x0001, 0x2894: 0x0001, 0x2895: 0x0001, 0x2896: 0x0001, 0x2897: 0x0001, + 0x2898: 0x0001, 0x2899: 0x0001, 0x289a: 0x0001, 0x289b: 0x0001, 0x289c: 0x0001, 0x289d: 0x0001, + 0x289e: 0x0001, 0x289f: 0x0001, 0x28a0: 0x0005, 0x28a1: 0x0005, 0x28a2: 0x0005, 0x28a3: 0x0005, + 0x28a4: 0x0005, 0x28a5: 0x0005, 0x28a6: 0x0005, 0x28a7: 0x0005, 0x28a8: 0x0005, 0x28a9: 0x0005, + 0x28aa: 0x0005, 0x28ab: 0x0005, 0x28ac: 0x0005, 0x28ad: 0x0005, 0x28ae: 0x0005, 0x28af: 0x0005, + 0x28b0: 0x0005, 0x28b1: 0x0005, 0x28b2: 0x0005, 0x28b3: 0x0005, 0x28b4: 0x0005, 0x28b5: 0x0005, + 0x28b6: 0x0005, 0x28b7: 0x0005, 0x28b8: 0x0005, 0x28b9: 0x0005, 0x28ba: 0x0005, 0x28bb: 0x0005, + 0x28bc: 0x0005, 0x28bd: 0x0005, 0x28be: 0x0005, 0x28bf: 0x0001, + // Block 0xa3, offset 0x28c0 + 0x28c1: 0x000c, + 0x28f8: 0x000c, 0x28f9: 0x000c, 0x28fa: 0x000c, 0x28fb: 0x000c, + 0x28fc: 0x000c, 0x28fd: 0x000c, 0x28fe: 0x000c, 0x28ff: 0x000c, + // Block 0xa4, offset 0x2900 + 0x2900: 0x000c, 0x2901: 0x000c, 0x2902: 0x000c, 0x2903: 0x000c, 0x2904: 0x000c, 0x2905: 0x000c, + 0x2906: 0x000c, + 0x2912: 0x000a, 0x2913: 0x000a, 0x2914: 0x000a, 0x2915: 0x000a, 0x2916: 0x000a, 0x2917: 0x000a, + 0x2918: 0x000a, 0x2919: 0x000a, 0x291a: 0x000a, 0x291b: 0x000a, 0x291c: 0x000a, 0x291d: 0x000a, + 0x291e: 0x000a, 0x291f: 0x000a, 0x2920: 0x000a, 0x2921: 0x000a, 0x2922: 0x000a, 0x2923: 0x000a, + 0x2924: 0x000a, 0x2925: 0x000a, + 0x293f: 0x000c, + // Block 0xa5, offset 0x2940 + 0x2940: 0x000c, 0x2941: 0x000c, + 0x2973: 0x000c, 0x2974: 0x000c, 0x2975: 0x000c, + 0x2976: 0x000c, 0x2979: 0x000c, 0x297a: 0x000c, + // Block 0xa6, offset 0x2980 + 0x2980: 0x000c, 0x2981: 0x000c, 0x2982: 0x000c, + 0x29a7: 0x000c, 0x29a8: 0x000c, 0x29a9: 0x000c, + 0x29aa: 0x000c, 0x29ab: 0x000c, 0x29ad: 0x000c, 0x29ae: 0x000c, 0x29af: 0x000c, + 0x29b0: 0x000c, 0x29b1: 0x000c, 0x29b2: 0x000c, 0x29b3: 0x000c, 0x29b4: 0x000c, + // Block 0xa7, offset 0x29c0 + 0x29f3: 0x000c, + // Block 0xa8, offset 0x2a00 + 0x2a00: 0x000c, 0x2a01: 0x000c, + 0x2a36: 0x000c, 0x2a37: 0x000c, 0x2a38: 0x000c, 0x2a39: 0x000c, 0x2a3a: 0x000c, 0x2a3b: 0x000c, + 0x2a3c: 0x000c, 0x2a3d: 0x000c, 0x2a3e: 0x000c, + // Block 0xa9, offset 0x2a40 + 0x2a4a: 0x000c, 0x2a4b: 0x000c, + 0x2a4c: 0x000c, + // Block 0xaa, offset 0x2a80 + 0x2aaf: 0x000c, + 0x2ab0: 0x000c, 0x2ab1: 0x000c, 0x2ab4: 0x000c, + 0x2ab6: 0x000c, 0x2ab7: 0x000c, + 0x2abe: 0x000c, + // Block 0xab, offset 0x2ac0 + 0x2adf: 0x000c, 0x2ae3: 0x000c, + 0x2ae4: 0x000c, 0x2ae5: 0x000c, 0x2ae6: 0x000c, 0x2ae7: 0x000c, 0x2ae8: 0x000c, 0x2ae9: 0x000c, + 0x2aea: 0x000c, + // Block 0xac, offset 0x2b00 + 0x2b00: 0x000c, 0x2b01: 0x000c, + 0x2b3c: 0x000c, + // Block 0xad, offset 0x2b40 + 0x2b40: 0x000c, + 0x2b66: 0x000c, 0x2b67: 0x000c, 0x2b68: 0x000c, 0x2b69: 0x000c, + 0x2b6a: 0x000c, 0x2b6b: 0x000c, 0x2b6c: 0x000c, + 0x2b70: 0x000c, 0x2b71: 0x000c, 0x2b72: 0x000c, 0x2b73: 0x000c, 0x2b74: 0x000c, + // Block 0xae, offset 0x2b80 + 0x2bb8: 0x000c, 0x2bb9: 0x000c, 0x2bba: 0x000c, 0x2bbb: 0x000c, + 0x2bbc: 0x000c, 0x2bbd: 0x000c, 0x2bbe: 0x000c, 0x2bbf: 0x000c, + // Block 0xaf, offset 0x2bc0 + 0x2bc2: 0x000c, 0x2bc3: 0x000c, 0x2bc4: 0x000c, + 0x2bc6: 0x000c, + // Block 0xb0, offset 0x2c00 + 0x2c33: 0x000c, 0x2c34: 0x000c, 0x2c35: 0x000c, + 0x2c36: 0x000c, 0x2c37: 0x000c, 0x2c38: 0x000c, 0x2c3a: 0x000c, + 0x2c3f: 0x000c, + // Block 0xb1, offset 0x2c40 + 0x2c40: 0x000c, 0x2c42: 0x000c, 0x2c43: 0x000c, + // Block 0xb2, offset 0x2c80 + 0x2cb2: 0x000c, 0x2cb3: 0x000c, 0x2cb4: 0x000c, 0x2cb5: 0x000c, + 0x2cbc: 0x000c, 0x2cbd: 0x000c, 0x2cbf: 0x000c, + // Block 0xb3, offset 0x2cc0 + 0x2cc0: 0x000c, + 0x2cdc: 0x000c, 0x2cdd: 0x000c, + // Block 0xb4, offset 0x2d00 + 0x2d33: 0x000c, 0x2d34: 0x000c, 0x2d35: 0x000c, + 0x2d36: 0x000c, 0x2d37: 0x000c, 0x2d38: 0x000c, 0x2d39: 0x000c, 0x2d3a: 0x000c, + 0x2d3d: 0x000c, 0x2d3f: 0x000c, + // Block 0xb5, offset 0x2d40 + 0x2d40: 0x000c, + 0x2d60: 0x000a, 0x2d61: 0x000a, 0x2d62: 0x000a, 0x2d63: 0x000a, + 0x2d64: 0x000a, 0x2d65: 0x000a, 0x2d66: 0x000a, 0x2d67: 0x000a, 0x2d68: 0x000a, 0x2d69: 0x000a, + 0x2d6a: 0x000a, 0x2d6b: 0x000a, 0x2d6c: 0x000a, + // Block 0xb6, offset 0x2d80 + 0x2dab: 0x000c, 0x2dad: 0x000c, + 0x2db0: 0x000c, 0x2db1: 0x000c, 0x2db2: 0x000c, 0x2db3: 0x000c, 0x2db4: 0x000c, 0x2db5: 0x000c, + 0x2db7: 0x000c, + // Block 0xb7, offset 0x2dc0 + 0x2ddd: 0x000c, + 0x2dde: 0x000c, 0x2ddf: 0x000c, 0x2de2: 0x000c, 0x2de3: 0x000c, + 0x2de4: 0x000c, 0x2de5: 0x000c, 0x2de7: 0x000c, 0x2de8: 0x000c, 0x2de9: 0x000c, + 0x2dea: 0x000c, 0x2deb: 0x000c, + // Block 0xb8, offset 0x2e00 + 0x2e30: 0x000c, 0x2e31: 0x000c, 0x2e32: 0x000c, 0x2e33: 0x000c, 0x2e34: 0x000c, 0x2e35: 0x000c, + 0x2e36: 0x000c, 0x2e38: 0x000c, 0x2e39: 0x000c, 0x2e3a: 0x000c, 0x2e3b: 0x000c, + 0x2e3c: 0x000c, 0x2e3d: 0x000c, + // Block 0xb9, offset 0x2e40 + 0x2e52: 0x000c, 0x2e53: 0x000c, 0x2e54: 0x000c, 0x2e55: 0x000c, 0x2e56: 0x000c, 0x2e57: 0x000c, + 0x2e58: 0x000c, 0x2e59: 0x000c, 0x2e5a: 0x000c, 0x2e5b: 0x000c, 0x2e5c: 0x000c, 0x2e5d: 0x000c, + 0x2e5e: 0x000c, 0x2e5f: 0x000c, 0x2e60: 0x000c, 0x2e61: 0x000c, 0x2e62: 0x000c, 0x2e63: 0x000c, + 0x2e64: 0x000c, 0x2e65: 0x000c, 0x2e66: 0x000c, 0x2e67: 0x000c, + 0x2e6a: 0x000c, 0x2e6b: 0x000c, 0x2e6c: 0x000c, 0x2e6d: 0x000c, 0x2e6e: 0x000c, 0x2e6f: 0x000c, + 0x2e70: 0x000c, 0x2e72: 0x000c, 0x2e73: 0x000c, 0x2e75: 0x000c, + 0x2e76: 0x000c, + // Block 0xba, offset 0x2e80 + 0x2eb0: 0x000c, 0x2eb1: 0x000c, 0x2eb2: 0x000c, 0x2eb3: 0x000c, 0x2eb4: 0x000c, + // Block 0xbb, offset 0x2ec0 + 0x2ef0: 0x000c, 0x2ef1: 0x000c, 0x2ef2: 0x000c, 0x2ef3: 0x000c, 0x2ef4: 0x000c, 0x2ef5: 0x000c, + 0x2ef6: 0x000c, + // Block 0xbc, offset 0x2f00 + 0x2f0f: 0x000c, 0x2f10: 0x000c, 0x2f11: 0x000c, + 0x2f12: 0x000c, + // Block 0xbd, offset 0x2f40 + 0x2f5d: 0x000c, + 0x2f5e: 0x000c, 0x2f60: 0x000b, 0x2f61: 0x000b, 0x2f62: 0x000b, 0x2f63: 0x000b, + // Block 0xbe, offset 0x2f80 + 0x2fa7: 0x000c, 0x2fa8: 0x000c, 0x2fa9: 0x000c, + 0x2fb3: 0x000b, 0x2fb4: 0x000b, 0x2fb5: 0x000b, + 0x2fb6: 0x000b, 0x2fb7: 0x000b, 0x2fb8: 0x000b, 0x2fb9: 0x000b, 0x2fba: 0x000b, 0x2fbb: 0x000c, + 0x2fbc: 0x000c, 0x2fbd: 0x000c, 0x2fbe: 0x000c, 0x2fbf: 0x000c, + // Block 0xbf, offset 0x2fc0 + 0x2fc0: 0x000c, 0x2fc1: 0x000c, 0x2fc2: 0x000c, 0x2fc5: 0x000c, + 0x2fc6: 0x000c, 0x2fc7: 0x000c, 0x2fc8: 0x000c, 0x2fc9: 0x000c, 0x2fca: 0x000c, 0x2fcb: 0x000c, + 0x2fea: 0x000c, 0x2feb: 0x000c, 0x2fec: 0x000c, 0x2fed: 0x000c, + // Block 0xc0, offset 0x3000 + 0x3000: 0x000a, 0x3001: 0x000a, 0x3002: 0x000c, 0x3003: 0x000c, 0x3004: 0x000c, 0x3005: 0x000a, + // Block 0xc1, offset 0x3040 + 0x3040: 0x000a, 0x3041: 0x000a, 0x3042: 0x000a, 0x3043: 0x000a, 0x3044: 0x000a, 0x3045: 0x000a, + 0x3046: 0x000a, 0x3047: 0x000a, 0x3048: 0x000a, 0x3049: 0x000a, 0x304a: 0x000a, 0x304b: 0x000a, + 0x304c: 0x000a, 0x304d: 0x000a, 0x304e: 0x000a, 0x304f: 0x000a, 0x3050: 0x000a, 0x3051: 0x000a, + 0x3052: 0x000a, 0x3053: 0x000a, 0x3054: 0x000a, 0x3055: 0x000a, 0x3056: 0x000a, + // Block 0xc2, offset 0x3080 + 0x309b: 0x000a, + // Block 0xc3, offset 0x30c0 + 0x30d5: 0x000a, + // Block 0xc4, offset 0x3100 + 0x310f: 0x000a, + // Block 0xc5, offset 0x3140 + 0x3149: 0x000a, + // Block 0xc6, offset 0x3180 + 0x3183: 0x000a, + 0x318e: 0x0002, 0x318f: 0x0002, 0x3190: 0x0002, 0x3191: 0x0002, + 0x3192: 0x0002, 0x3193: 0x0002, 0x3194: 0x0002, 0x3195: 0x0002, 0x3196: 0x0002, 0x3197: 0x0002, + 0x3198: 0x0002, 0x3199: 0x0002, 0x319a: 0x0002, 0x319b: 0x0002, 0x319c: 0x0002, 0x319d: 0x0002, + 0x319e: 0x0002, 0x319f: 0x0002, 0x31a0: 0x0002, 0x31a1: 0x0002, 0x31a2: 0x0002, 0x31a3: 0x0002, + 0x31a4: 0x0002, 0x31a5: 0x0002, 0x31a6: 0x0002, 0x31a7: 0x0002, 0x31a8: 0x0002, 0x31a9: 0x0002, + 0x31aa: 0x0002, 0x31ab: 0x0002, 0x31ac: 0x0002, 0x31ad: 0x0002, 0x31ae: 0x0002, 0x31af: 0x0002, + 0x31b0: 0x0002, 0x31b1: 0x0002, 0x31b2: 0x0002, 0x31b3: 0x0002, 0x31b4: 0x0002, 0x31b5: 0x0002, + 0x31b6: 0x0002, 0x31b7: 0x0002, 0x31b8: 0x0002, 0x31b9: 0x0002, 0x31ba: 0x0002, 0x31bb: 0x0002, + 0x31bc: 0x0002, 0x31bd: 0x0002, 0x31be: 0x0002, 0x31bf: 0x0002, + // Block 0xc7, offset 0x31c0 + 0x31c0: 0x000c, 0x31c1: 0x000c, 0x31c2: 0x000c, 0x31c3: 0x000c, 0x31c4: 0x000c, 0x31c5: 0x000c, + 0x31c6: 0x000c, 0x31c7: 0x000c, 0x31c8: 0x000c, 0x31c9: 0x000c, 0x31ca: 0x000c, 0x31cb: 0x000c, + 0x31cc: 0x000c, 0x31cd: 0x000c, 0x31ce: 0x000c, 0x31cf: 0x000c, 0x31d0: 0x000c, 0x31d1: 0x000c, + 0x31d2: 0x000c, 0x31d3: 0x000c, 0x31d4: 0x000c, 0x31d5: 0x000c, 0x31d6: 0x000c, 0x31d7: 0x000c, + 0x31d8: 0x000c, 0x31d9: 0x000c, 0x31da: 0x000c, 0x31db: 0x000c, 0x31dc: 0x000c, 0x31dd: 0x000c, + 0x31de: 0x000c, 0x31df: 0x000c, 0x31e0: 0x000c, 0x31e1: 0x000c, 0x31e2: 0x000c, 0x31e3: 0x000c, + 0x31e4: 0x000c, 0x31e5: 0x000c, 0x31e6: 0x000c, 0x31e7: 0x000c, 0x31e8: 0x000c, 0x31e9: 0x000c, + 0x31ea: 0x000c, 0x31eb: 0x000c, 0x31ec: 0x000c, 0x31ed: 0x000c, 0x31ee: 0x000c, 0x31ef: 0x000c, + 0x31f0: 0x000c, 0x31f1: 0x000c, 0x31f2: 0x000c, 0x31f3: 0x000c, 0x31f4: 0x000c, 0x31f5: 0x000c, + 0x31f6: 0x000c, 0x31fb: 0x000c, + 0x31fc: 0x000c, 0x31fd: 0x000c, 0x31fe: 0x000c, 0x31ff: 0x000c, + // Block 0xc8, offset 0x3200 + 0x3200: 0x000c, 0x3201: 0x000c, 0x3202: 0x000c, 0x3203: 0x000c, 0x3204: 0x000c, 0x3205: 0x000c, + 0x3206: 0x000c, 0x3207: 0x000c, 0x3208: 0x000c, 0x3209: 0x000c, 0x320a: 0x000c, 0x320b: 0x000c, + 0x320c: 0x000c, 0x320d: 0x000c, 0x320e: 0x000c, 0x320f: 0x000c, 0x3210: 0x000c, 0x3211: 0x000c, + 0x3212: 0x000c, 0x3213: 0x000c, 0x3214: 0x000c, 0x3215: 0x000c, 0x3216: 0x000c, 0x3217: 0x000c, + 0x3218: 0x000c, 0x3219: 0x000c, 0x321a: 0x000c, 0x321b: 0x000c, 0x321c: 0x000c, 0x321d: 0x000c, + 0x321e: 0x000c, 0x321f: 0x000c, 0x3220: 0x000c, 0x3221: 0x000c, 0x3222: 0x000c, 0x3223: 0x000c, + 0x3224: 0x000c, 0x3225: 0x000c, 0x3226: 0x000c, 0x3227: 0x000c, 0x3228: 0x000c, 0x3229: 0x000c, + 0x322a: 0x000c, 0x322b: 0x000c, 0x322c: 0x000c, + 0x3235: 0x000c, + // Block 0xc9, offset 0x3240 + 0x3244: 0x000c, + 0x325b: 0x000c, 0x325c: 0x000c, 0x325d: 0x000c, + 0x325e: 0x000c, 0x325f: 0x000c, 0x3261: 0x000c, 0x3262: 0x000c, 0x3263: 0x000c, + 0x3264: 0x000c, 0x3265: 0x000c, 0x3266: 0x000c, 0x3267: 0x000c, 0x3268: 0x000c, 0x3269: 0x000c, + 0x326a: 0x000c, 0x326b: 0x000c, 0x326c: 0x000c, 0x326d: 0x000c, 0x326e: 0x000c, 0x326f: 0x000c, + // Block 0xca, offset 0x3280 + 0x3280: 0x000c, 0x3281: 0x000c, 0x3282: 0x000c, 0x3283: 0x000c, 0x3284: 0x000c, 0x3285: 0x000c, + 0x3286: 0x000c, 0x3288: 0x000c, 0x3289: 0x000c, 0x328a: 0x000c, 0x328b: 0x000c, + 0x328c: 0x000c, 0x328d: 0x000c, 0x328e: 0x000c, 0x328f: 0x000c, 0x3290: 0x000c, 0x3291: 0x000c, + 0x3292: 0x000c, 0x3293: 0x000c, 0x3294: 0x000c, 0x3295: 0x000c, 0x3296: 0x000c, 0x3297: 0x000c, + 0x3298: 0x000c, 0x329b: 0x000c, 0x329c: 0x000c, 0x329d: 0x000c, + 0x329e: 0x000c, 0x329f: 0x000c, 0x32a0: 0x000c, 0x32a1: 0x000c, 0x32a3: 0x000c, + 0x32a4: 0x000c, 0x32a6: 0x000c, 0x32a7: 0x000c, 0x32a8: 0x000c, 0x32a9: 0x000c, + 0x32aa: 0x000c, + // Block 0xcb, offset 0x32c0 + 0x32c0: 0x0001, 0x32c1: 0x0001, 0x32c2: 0x0001, 0x32c3: 0x0001, 0x32c4: 0x0001, 0x32c5: 0x0001, + 0x32c6: 0x0001, 0x32c7: 0x0001, 0x32c8: 0x0001, 0x32c9: 0x0001, 0x32ca: 0x0001, 0x32cb: 0x0001, + 0x32cc: 0x0001, 0x32cd: 0x0001, 0x32ce: 0x0001, 0x32cf: 0x0001, 0x32d0: 0x000c, 0x32d1: 0x000c, + 0x32d2: 0x000c, 0x32d3: 0x000c, 0x32d4: 0x000c, 0x32d5: 0x000c, 0x32d6: 0x000c, 0x32d7: 0x0001, + 0x32d8: 0x0001, 0x32d9: 0x0001, 0x32da: 0x0001, 0x32db: 0x0001, 0x32dc: 0x0001, 0x32dd: 0x0001, + 0x32de: 0x0001, 0x32df: 0x0001, 0x32e0: 0x0001, 0x32e1: 0x0001, 0x32e2: 0x0001, 0x32e3: 0x0001, + 0x32e4: 0x0001, 0x32e5: 0x0001, 0x32e6: 0x0001, 0x32e7: 0x0001, 0x32e8: 0x0001, 0x32e9: 0x0001, + 0x32ea: 0x0001, 0x32eb: 0x0001, 0x32ec: 0x0001, 0x32ed: 0x0001, 0x32ee: 0x0001, 0x32ef: 0x0001, + 0x32f0: 0x0001, 0x32f1: 0x0001, 0x32f2: 0x0001, 0x32f3: 0x0001, 0x32f4: 0x0001, 0x32f5: 0x0001, + 0x32f6: 0x0001, 0x32f7: 0x0001, 0x32f8: 0x0001, 0x32f9: 0x0001, 0x32fa: 0x0001, 0x32fb: 0x0001, + 0x32fc: 0x0001, 0x32fd: 0x0001, 0x32fe: 0x0001, 0x32ff: 0x0001, + // Block 0xcc, offset 0x3300 + 0x3300: 0x0001, 0x3301: 0x0001, 0x3302: 0x0001, 0x3303: 0x0001, 0x3304: 0x000c, 0x3305: 0x000c, + 0x3306: 0x000c, 0x3307: 0x000c, 0x3308: 0x000c, 0x3309: 0x000c, 0x330a: 0x000c, 0x330b: 0x0001, + 0x330c: 0x0001, 0x330d: 0x0001, 0x330e: 0x0001, 0x330f: 0x0001, 0x3310: 0x0001, 0x3311: 0x0001, + 0x3312: 0x0001, 0x3313: 0x0001, 0x3314: 0x0001, 0x3315: 0x0001, 0x3316: 0x0001, 0x3317: 0x0001, + 0x3318: 0x0001, 0x3319: 0x0001, 0x331a: 0x0001, 0x331b: 0x0001, 0x331c: 0x0001, 0x331d: 0x0001, + 0x331e: 0x0001, 0x331f: 0x0001, 0x3320: 0x0001, 0x3321: 0x0001, 0x3322: 0x0001, 0x3323: 0x0001, + 0x3324: 0x0001, 0x3325: 0x0001, 0x3326: 0x0001, 0x3327: 0x0001, 0x3328: 0x0001, 0x3329: 0x0001, + 0x332a: 0x0001, 0x332b: 0x0001, 0x332c: 0x0001, 0x332d: 0x0001, 0x332e: 0x0001, 0x332f: 0x0001, + 0x3330: 0x0001, 0x3331: 0x0001, 0x3332: 0x0001, 0x3333: 0x0001, 0x3334: 0x0001, 0x3335: 0x0001, + 0x3336: 0x0001, 0x3337: 0x0001, 0x3338: 0x0001, 0x3339: 0x0001, 0x333a: 0x0001, 0x333b: 0x0001, + 0x333c: 0x0001, 0x333d: 0x0001, 0x333e: 0x0001, 0x333f: 0x0001, + // Block 0xcd, offset 0x3340 + 0x3340: 0x000d, 0x3341: 0x000d, 0x3342: 0x000d, 0x3343: 0x000d, 0x3344: 0x000d, 0x3345: 0x000d, + 0x3346: 0x000d, 0x3347: 0x000d, 0x3348: 0x000d, 0x3349: 0x000d, 0x334a: 0x000d, 0x334b: 0x000d, + 0x334c: 0x000d, 0x334d: 0x000d, 0x334e: 0x000d, 0x334f: 0x000d, 0x3350: 0x000d, 0x3351: 0x000d, + 0x3352: 0x000d, 0x3353: 0x000d, 0x3354: 0x000d, 0x3355: 0x000d, 0x3356: 0x000d, 0x3357: 0x000d, + 0x3358: 0x000d, 0x3359: 0x000d, 0x335a: 0x000d, 0x335b: 0x000d, 0x335c: 0x000d, 0x335d: 0x000d, + 0x335e: 0x000d, 0x335f: 0x000d, 0x3360: 0x000d, 0x3361: 0x000d, 0x3362: 0x000d, 0x3363: 0x000d, + 0x3364: 0x000d, 0x3365: 0x000d, 0x3366: 0x000d, 0x3367: 0x000d, 0x3368: 0x000d, 0x3369: 0x000d, + 0x336a: 0x000d, 0x336b: 0x000d, 0x336c: 0x000d, 0x336d: 0x000d, 0x336e: 0x000d, 0x336f: 0x000d, + 0x3370: 0x000a, 0x3371: 0x000a, 0x3372: 0x000d, 0x3373: 0x000d, 0x3374: 0x000d, 0x3375: 0x000d, + 0x3376: 0x000d, 0x3377: 0x000d, 0x3378: 0x000d, 0x3379: 0x000d, 0x337a: 0x000d, 0x337b: 0x000d, + 0x337c: 0x000d, 0x337d: 0x000d, 0x337e: 0x000d, 0x337f: 0x000d, + // Block 0xce, offset 0x3380 + 0x3380: 0x000a, 0x3381: 0x000a, 0x3382: 0x000a, 0x3383: 0x000a, 0x3384: 0x000a, 0x3385: 0x000a, + 0x3386: 0x000a, 0x3387: 0x000a, 0x3388: 0x000a, 0x3389: 0x000a, 0x338a: 0x000a, 0x338b: 0x000a, + 0x338c: 0x000a, 0x338d: 0x000a, 0x338e: 0x000a, 0x338f: 0x000a, 0x3390: 0x000a, 0x3391: 0x000a, + 0x3392: 0x000a, 0x3393: 0x000a, 0x3394: 0x000a, 0x3395: 0x000a, 0x3396: 0x000a, 0x3397: 0x000a, + 0x3398: 0x000a, 0x3399: 0x000a, 0x339a: 0x000a, 0x339b: 0x000a, 0x339c: 0x000a, 0x339d: 0x000a, + 0x339e: 0x000a, 0x339f: 0x000a, 0x33a0: 0x000a, 0x33a1: 0x000a, 0x33a2: 0x000a, 0x33a3: 0x000a, + 0x33a4: 0x000a, 0x33a5: 0x000a, 0x33a6: 0x000a, 0x33a7: 0x000a, 0x33a8: 0x000a, 0x33a9: 0x000a, + 0x33aa: 0x000a, 0x33ab: 0x000a, + 0x33b0: 0x000a, 0x33b1: 0x000a, 0x33b2: 0x000a, 0x33b3: 0x000a, 0x33b4: 0x000a, 0x33b5: 0x000a, + 0x33b6: 0x000a, 0x33b7: 0x000a, 0x33b8: 0x000a, 0x33b9: 0x000a, 0x33ba: 0x000a, 0x33bb: 0x000a, + 0x33bc: 0x000a, 0x33bd: 0x000a, 0x33be: 0x000a, 0x33bf: 0x000a, + // Block 0xcf, offset 0x33c0 + 0x33c0: 0x000a, 0x33c1: 0x000a, 0x33c2: 0x000a, 0x33c3: 0x000a, 0x33c4: 0x000a, 0x33c5: 0x000a, + 0x33c6: 0x000a, 0x33c7: 0x000a, 0x33c8: 0x000a, 0x33c9: 0x000a, 0x33ca: 0x000a, 0x33cb: 0x000a, + 0x33cc: 0x000a, 0x33cd: 0x000a, 0x33ce: 0x000a, 0x33cf: 0x000a, 0x33d0: 0x000a, 0x33d1: 0x000a, + 0x33d2: 0x000a, 0x33d3: 0x000a, + 0x33e0: 0x000a, 0x33e1: 0x000a, 0x33e2: 0x000a, 0x33e3: 0x000a, + 0x33e4: 0x000a, 0x33e5: 0x000a, 0x33e6: 0x000a, 0x33e7: 0x000a, 0x33e8: 0x000a, 0x33e9: 0x000a, + 0x33ea: 0x000a, 0x33eb: 0x000a, 0x33ec: 0x000a, 0x33ed: 0x000a, 0x33ee: 0x000a, + 0x33f1: 0x000a, 0x33f2: 0x000a, 0x33f3: 0x000a, 0x33f4: 0x000a, 0x33f5: 0x000a, + 0x33f6: 0x000a, 0x33f7: 0x000a, 0x33f8: 0x000a, 0x33f9: 0x000a, 0x33fa: 0x000a, 0x33fb: 0x000a, + 0x33fc: 0x000a, 0x33fd: 0x000a, 0x33fe: 0x000a, 0x33ff: 0x000a, + // Block 0xd0, offset 0x3400 + 0x3401: 0x000a, 0x3402: 0x000a, 0x3403: 0x000a, 0x3404: 0x000a, 0x3405: 0x000a, + 0x3406: 0x000a, 0x3407: 0x000a, 0x3408: 0x000a, 0x3409: 0x000a, 0x340a: 0x000a, 0x340b: 0x000a, + 0x340c: 0x000a, 0x340d: 0x000a, 0x340e: 0x000a, 0x340f: 0x000a, 0x3411: 0x000a, + 0x3412: 0x000a, 0x3413: 0x000a, 0x3414: 0x000a, 0x3415: 0x000a, 0x3416: 0x000a, 0x3417: 0x000a, + 0x3418: 0x000a, 0x3419: 0x000a, 0x341a: 0x000a, 0x341b: 0x000a, 0x341c: 0x000a, 0x341d: 0x000a, + 0x341e: 0x000a, 0x341f: 0x000a, 0x3420: 0x000a, 0x3421: 0x000a, 0x3422: 0x000a, 0x3423: 0x000a, + 0x3424: 0x000a, 0x3425: 0x000a, 0x3426: 0x000a, 0x3427: 0x000a, 0x3428: 0x000a, 0x3429: 0x000a, + 0x342a: 0x000a, 0x342b: 0x000a, 0x342c: 0x000a, 0x342d: 0x000a, 0x342e: 0x000a, 0x342f: 0x000a, + 0x3430: 0x000a, 0x3431: 0x000a, 0x3432: 0x000a, 0x3433: 0x000a, 0x3434: 0x000a, 0x3435: 0x000a, + // Block 0xd1, offset 0x3440 + 0x3440: 0x0002, 0x3441: 0x0002, 0x3442: 0x0002, 0x3443: 0x0002, 0x3444: 0x0002, 0x3445: 0x0002, + 0x3446: 0x0002, 0x3447: 0x0002, 0x3448: 0x0002, 0x3449: 0x0002, 0x344a: 0x0002, 0x344b: 0x000a, + 0x344c: 0x000a, + // Block 0xd2, offset 0x3480 + 0x34aa: 0x000a, 0x34ab: 0x000a, + // Block 0xd3, offset 0x34c0 + 0x34c0: 0x000a, 0x34c1: 0x000a, 0x34c2: 0x000a, 0x34c3: 0x000a, 0x34c4: 0x000a, 0x34c5: 0x000a, + 0x34c6: 0x000a, 0x34c7: 0x000a, 0x34c8: 0x000a, 0x34c9: 0x000a, 0x34ca: 0x000a, 0x34cb: 0x000a, + 0x34cc: 0x000a, 0x34cd: 0x000a, 0x34ce: 0x000a, 0x34cf: 0x000a, 0x34d0: 0x000a, 0x34d1: 0x000a, + 0x34d2: 0x000a, + 0x34e0: 0x000a, 0x34e1: 0x000a, 0x34e2: 0x000a, 0x34e3: 0x000a, + 0x34e4: 0x000a, 0x34e5: 0x000a, 0x34e6: 0x000a, 0x34e7: 0x000a, 0x34e8: 0x000a, 0x34e9: 0x000a, + 0x34ea: 0x000a, 0x34eb: 0x000a, 0x34ec: 0x000a, + 0x34f0: 0x000a, 0x34f1: 0x000a, 0x34f2: 0x000a, 0x34f3: 0x000a, 0x34f4: 0x000a, 0x34f5: 0x000a, + 0x34f6: 0x000a, + // Block 0xd4, offset 0x3500 + 0x3500: 0x000a, 0x3501: 0x000a, 0x3502: 0x000a, 0x3503: 0x000a, 0x3504: 0x000a, 0x3505: 0x000a, + 0x3506: 0x000a, 0x3507: 0x000a, 0x3508: 0x000a, 0x3509: 0x000a, 0x350a: 0x000a, 0x350b: 0x000a, + 0x350c: 0x000a, 0x350d: 0x000a, 0x350e: 0x000a, 0x350f: 0x000a, 0x3510: 0x000a, 0x3511: 0x000a, + 0x3512: 0x000a, 0x3513: 0x000a, 0x3514: 0x000a, + // Block 0xd5, offset 0x3540 + 0x3540: 0x000a, 0x3541: 0x000a, 0x3542: 0x000a, 0x3543: 0x000a, 0x3544: 0x000a, 0x3545: 0x000a, + 0x3546: 0x000a, 0x3547: 0x000a, 0x3548: 0x000a, 0x3549: 0x000a, 0x354a: 0x000a, 0x354b: 0x000a, + 0x3550: 0x000a, 0x3551: 0x000a, + 0x3552: 0x000a, 0x3553: 0x000a, 0x3554: 0x000a, 0x3555: 0x000a, 0x3556: 0x000a, 0x3557: 0x000a, + 0x3558: 0x000a, 0x3559: 0x000a, 0x355a: 0x000a, 0x355b: 0x000a, 0x355c: 0x000a, 0x355d: 0x000a, + 0x355e: 0x000a, 0x355f: 0x000a, 0x3560: 0x000a, 0x3561: 0x000a, 0x3562: 0x000a, 0x3563: 0x000a, + 0x3564: 0x000a, 0x3565: 0x000a, 0x3566: 0x000a, 0x3567: 0x000a, 0x3568: 0x000a, 0x3569: 0x000a, + 0x356a: 0x000a, 0x356b: 0x000a, 0x356c: 0x000a, 0x356d: 0x000a, 0x356e: 0x000a, 0x356f: 0x000a, + 0x3570: 0x000a, 0x3571: 0x000a, 0x3572: 0x000a, 0x3573: 0x000a, 0x3574: 0x000a, 0x3575: 0x000a, + 0x3576: 0x000a, 0x3577: 0x000a, 0x3578: 0x000a, 0x3579: 0x000a, 0x357a: 0x000a, 0x357b: 0x000a, + 0x357c: 0x000a, 0x357d: 0x000a, 0x357e: 0x000a, 0x357f: 0x000a, + // Block 0xd6, offset 0x3580 + 0x3580: 0x000a, 0x3581: 0x000a, 0x3582: 0x000a, 0x3583: 0x000a, 0x3584: 0x000a, 0x3585: 0x000a, + 0x3586: 0x000a, 0x3587: 0x000a, + 0x3590: 0x000a, 0x3591: 0x000a, + 0x3592: 0x000a, 0x3593: 0x000a, 0x3594: 0x000a, 0x3595: 0x000a, 0x3596: 0x000a, 0x3597: 0x000a, + 0x3598: 0x000a, 0x3599: 0x000a, + 0x35a0: 0x000a, 0x35a1: 0x000a, 0x35a2: 0x000a, 0x35a3: 0x000a, + 0x35a4: 0x000a, 0x35a5: 0x000a, 0x35a6: 0x000a, 0x35a7: 0x000a, 0x35a8: 0x000a, 0x35a9: 0x000a, + 0x35aa: 0x000a, 0x35ab: 0x000a, 0x35ac: 0x000a, 0x35ad: 0x000a, 0x35ae: 0x000a, 0x35af: 0x000a, + 0x35b0: 0x000a, 0x35b1: 0x000a, 0x35b2: 0x000a, 0x35b3: 0x000a, 0x35b4: 0x000a, 0x35b5: 0x000a, + 0x35b6: 0x000a, 0x35b7: 0x000a, 0x35b8: 0x000a, 0x35b9: 0x000a, 0x35ba: 0x000a, 0x35bb: 0x000a, + 0x35bc: 0x000a, 0x35bd: 0x000a, 0x35be: 0x000a, 0x35bf: 0x000a, + // Block 0xd7, offset 0x35c0 + 0x35c0: 0x000a, 0x35c1: 0x000a, 0x35c2: 0x000a, 0x35c3: 0x000a, 0x35c4: 0x000a, 0x35c5: 0x000a, + 0x35c6: 0x000a, 0x35c7: 0x000a, + 0x35d0: 0x000a, 0x35d1: 0x000a, + 0x35d2: 0x000a, 0x35d3: 0x000a, 0x35d4: 0x000a, 0x35d5: 0x000a, 0x35d6: 0x000a, 0x35d7: 0x000a, + 0x35d8: 0x000a, 0x35d9: 0x000a, 0x35da: 0x000a, 0x35db: 0x000a, 0x35dc: 0x000a, 0x35dd: 0x000a, + 0x35de: 0x000a, 0x35df: 0x000a, 0x35e0: 0x000a, 0x35e1: 0x000a, 0x35e2: 0x000a, 0x35e3: 0x000a, + 0x35e4: 0x000a, 0x35e5: 0x000a, 0x35e6: 0x000a, 0x35e7: 0x000a, 0x35e8: 0x000a, 0x35e9: 0x000a, + 0x35ea: 0x000a, 0x35eb: 0x000a, 0x35ec: 0x000a, 0x35ed: 0x000a, + // Block 0xd8, offset 0x3600 + 0x3610: 0x000a, 0x3611: 0x000a, + 0x3612: 0x000a, 0x3613: 0x000a, 0x3614: 0x000a, 0x3615: 0x000a, 0x3616: 0x000a, 0x3617: 0x000a, + 0x3618: 0x000a, 0x3619: 0x000a, 0x361a: 0x000a, 0x361b: 0x000a, 0x361c: 0x000a, 0x361d: 0x000a, + 0x361e: 0x000a, 0x3620: 0x000a, 0x3621: 0x000a, 0x3622: 0x000a, 0x3623: 0x000a, + 0x3624: 0x000a, 0x3625: 0x000a, 0x3626: 0x000a, 0x3627: 0x000a, + 0x3630: 0x000a, 0x3633: 0x000a, 0x3634: 0x000a, 0x3635: 0x000a, + 0x3636: 0x000a, 0x3637: 0x000a, 0x3638: 0x000a, 0x3639: 0x000a, 0x363a: 0x000a, 0x363b: 0x000a, + 0x363c: 0x000a, 0x363d: 0x000a, 0x363e: 0x000a, + // Block 0xd9, offset 0x3640 + 0x3640: 0x000a, 0x3641: 0x000a, 0x3642: 0x000a, 0x3643: 0x000a, 0x3644: 0x000a, 0x3645: 0x000a, + 0x3646: 0x000a, 0x3647: 0x000a, 0x3648: 0x000a, 0x3649: 0x000a, 0x364a: 0x000a, 0x364b: 0x000a, + 0x3650: 0x000a, 0x3651: 0x000a, + 0x3652: 0x000a, 0x3653: 0x000a, 0x3654: 0x000a, 0x3655: 0x000a, 0x3656: 0x000a, 0x3657: 0x000a, + 0x3658: 0x000a, 0x3659: 0x000a, 0x365a: 0x000a, 0x365b: 0x000a, 0x365c: 0x000a, 0x365d: 0x000a, + 0x365e: 0x000a, + // Block 0xda, offset 0x3680 + 0x3680: 0x000a, 0x3681: 0x000a, 0x3682: 0x000a, 0x3683: 0x000a, 0x3684: 0x000a, 0x3685: 0x000a, + 0x3686: 0x000a, 0x3687: 0x000a, 0x3688: 0x000a, 0x3689: 0x000a, 0x368a: 0x000a, 0x368b: 0x000a, + 0x368c: 0x000a, 0x368d: 0x000a, 0x368e: 0x000a, 0x368f: 0x000a, 0x3690: 0x000a, 0x3691: 0x000a, + // Block 0xdb, offset 0x36c0 + 0x36fe: 0x000b, 0x36ff: 0x000b, + // Block 0xdc, offset 0x3700 + 0x3700: 0x000b, 0x3701: 0x000b, 0x3702: 0x000b, 0x3703: 0x000b, 0x3704: 0x000b, 0x3705: 0x000b, + 0x3706: 0x000b, 0x3707: 0x000b, 0x3708: 0x000b, 0x3709: 0x000b, 0x370a: 0x000b, 0x370b: 0x000b, + 0x370c: 0x000b, 0x370d: 0x000b, 0x370e: 0x000b, 0x370f: 0x000b, 0x3710: 0x000b, 0x3711: 0x000b, + 0x3712: 0x000b, 0x3713: 0x000b, 0x3714: 0x000b, 0x3715: 0x000b, 0x3716: 0x000b, 0x3717: 0x000b, + 0x3718: 0x000b, 0x3719: 0x000b, 0x371a: 0x000b, 0x371b: 0x000b, 0x371c: 0x000b, 0x371d: 0x000b, + 0x371e: 0x000b, 0x371f: 0x000b, 0x3720: 0x000b, 0x3721: 0x000b, 0x3722: 0x000b, 0x3723: 0x000b, + 0x3724: 0x000b, 0x3725: 0x000b, 0x3726: 0x000b, 0x3727: 0x000b, 0x3728: 0x000b, 0x3729: 0x000b, + 0x372a: 0x000b, 0x372b: 0x000b, 0x372c: 0x000b, 0x372d: 0x000b, 0x372e: 0x000b, 0x372f: 0x000b, + 0x3730: 0x000b, 0x3731: 0x000b, 0x3732: 0x000b, 0x3733: 0x000b, 0x3734: 0x000b, 0x3735: 0x000b, + 0x3736: 0x000b, 0x3737: 0x000b, 0x3738: 0x000b, 0x3739: 0x000b, 0x373a: 0x000b, 0x373b: 0x000b, + 0x373c: 0x000b, 0x373d: 0x000b, 0x373e: 0x000b, 0x373f: 0x000b, + // Block 0xdd, offset 0x3740 + 0x3740: 0x000c, 0x3741: 0x000c, 0x3742: 0x000c, 0x3743: 0x000c, 0x3744: 0x000c, 0x3745: 0x000c, + 0x3746: 0x000c, 0x3747: 0x000c, 0x3748: 0x000c, 0x3749: 0x000c, 0x374a: 0x000c, 0x374b: 0x000c, + 0x374c: 0x000c, 0x374d: 0x000c, 0x374e: 0x000c, 0x374f: 0x000c, 0x3750: 0x000c, 0x3751: 0x000c, + 0x3752: 0x000c, 0x3753: 0x000c, 0x3754: 0x000c, 0x3755: 0x000c, 0x3756: 0x000c, 0x3757: 0x000c, + 0x3758: 0x000c, 0x3759: 0x000c, 0x375a: 0x000c, 0x375b: 0x000c, 0x375c: 0x000c, 0x375d: 0x000c, + 0x375e: 0x000c, 0x375f: 0x000c, 0x3760: 0x000c, 0x3761: 0x000c, 0x3762: 0x000c, 0x3763: 0x000c, + 0x3764: 0x000c, 0x3765: 0x000c, 0x3766: 0x000c, 0x3767: 0x000c, 0x3768: 0x000c, 0x3769: 0x000c, + 0x376a: 0x000c, 0x376b: 0x000c, 0x376c: 0x000c, 0x376d: 0x000c, 0x376e: 0x000c, 0x376f: 0x000c, + 0x3770: 0x000b, 0x3771: 0x000b, 0x3772: 0x000b, 0x3773: 0x000b, 0x3774: 0x000b, 0x3775: 0x000b, + 0x3776: 0x000b, 0x3777: 0x000b, 0x3778: 0x000b, 0x3779: 0x000b, 0x377a: 0x000b, 0x377b: 0x000b, + 0x377c: 0x000b, 0x377d: 0x000b, 0x377e: 0x000b, 0x377f: 0x000b, +} + +// bidiIndex: 24 blocks, 1536 entries, 1536 bytes +// Block 0 is the zero block. +var bidiIndex = [1536]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, + 0xca: 0x03, 0xcb: 0x04, 0xcc: 0x05, 0xcd: 0x06, 0xce: 0x07, 0xcf: 0x08, + 0xd2: 0x09, 0xd6: 0x0a, 0xd7: 0x0b, + 0xd8: 0x0c, 0xd9: 0x0d, 0xda: 0x0e, 0xdb: 0x0f, 0xdc: 0x10, 0xdd: 0x11, 0xde: 0x12, 0xdf: 0x13, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, + 0xea: 0x07, 0xef: 0x08, + 0xf0: 0x11, 0xf1: 0x12, 0xf2: 0x12, 0xf3: 0x14, 0xf4: 0x15, + // Block 0x4, offset 0x100 + 0x120: 0x14, 0x121: 0x15, 0x122: 0x16, 0x123: 0x17, 0x124: 0x18, 0x125: 0x19, 0x126: 0x1a, 0x127: 0x1b, + 0x128: 0x1c, 0x129: 0x1d, 0x12a: 0x1c, 0x12b: 0x1e, 0x12c: 0x1f, 0x12d: 0x20, 0x12e: 0x21, 0x12f: 0x22, + 0x130: 0x23, 0x131: 0x24, 0x132: 0x1a, 0x133: 0x25, 0x134: 0x26, 0x135: 0x27, 0x137: 0x28, + 0x138: 0x29, 0x139: 0x2a, 0x13a: 0x2b, 0x13b: 0x2c, 0x13c: 0x2d, 0x13d: 0x2e, 0x13e: 0x2f, 0x13f: 0x30, + // Block 0x5, offset 0x140 + 0x140: 0x31, 0x141: 0x32, 0x142: 0x33, + 0x14d: 0x34, 0x14e: 0x35, + 0x150: 0x36, + 0x15a: 0x37, 0x15c: 0x38, 0x15d: 0x39, 0x15e: 0x3a, 0x15f: 0x3b, + 0x160: 0x3c, 0x162: 0x3d, 0x164: 0x3e, 0x165: 0x3f, 0x167: 0x40, + 0x168: 0x41, 0x169: 0x42, 0x16a: 0x43, 0x16c: 0x44, 0x16d: 0x45, 0x16e: 0x46, 0x16f: 0x47, + 0x170: 0x48, 0x173: 0x49, 0x177: 0x4a, + 0x17e: 0x4b, 0x17f: 0x4c, + // Block 0x6, offset 0x180 + 0x180: 0x4d, 0x181: 0x4e, 0x182: 0x4f, 0x183: 0x50, 0x184: 0x51, 0x185: 0x52, 0x186: 0x53, 0x187: 0x54, + 0x188: 0x55, 0x189: 0x54, 0x18a: 0x54, 0x18b: 0x54, 0x18c: 0x56, 0x18d: 0x57, 0x18e: 0x58, 0x18f: 0x59, + 0x190: 0x5a, 0x191: 0x5b, 0x192: 0x5c, 0x193: 0x5d, 0x194: 0x54, 0x195: 0x54, 0x196: 0x54, 0x197: 0x54, + 0x198: 0x54, 0x199: 0x54, 0x19a: 0x5e, 0x19b: 0x54, 0x19c: 0x54, 0x19d: 0x5f, 0x19e: 0x54, 0x19f: 0x60, + 0x1a4: 0x54, 0x1a5: 0x54, 0x1a6: 0x61, 0x1a7: 0x62, + 0x1a8: 0x54, 0x1a9: 0x54, 0x1aa: 0x54, 0x1ab: 0x54, 0x1ac: 0x54, 0x1ad: 0x63, 0x1ae: 0x64, 0x1af: 0x65, + 0x1b3: 0x66, 0x1b5: 0x67, 0x1b7: 0x68, + 0x1b8: 0x69, 0x1b9: 0x6a, 0x1ba: 0x6b, 0x1bb: 0x6c, 0x1bc: 0x54, 0x1bd: 0x54, 0x1be: 0x54, 0x1bf: 0x6d, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x6e, 0x1c2: 0x6f, 0x1c3: 0x70, 0x1c7: 0x71, + 0x1c8: 0x72, 0x1c9: 0x73, 0x1ca: 0x74, 0x1cb: 0x75, 0x1cd: 0x76, 0x1cf: 0x77, + // Block 0x8, offset 0x200 + 0x237: 0x54, + // Block 0x9, offset 0x240 + 0x252: 0x78, 0x253: 0x79, + 0x258: 0x7a, 0x259: 0x7b, 0x25a: 0x7c, 0x25b: 0x7d, 0x25c: 0x7e, 0x25e: 0x7f, + 0x260: 0x80, 0x261: 0x81, 0x263: 0x82, 0x264: 0x83, 0x265: 0x84, 0x266: 0x85, 0x267: 0x86, + 0x268: 0x87, 0x269: 0x88, 0x26a: 0x89, 0x26b: 0x8a, 0x26f: 0x8b, + // Block 0xa, offset 0x280 + 0x2ac: 0x8c, 0x2ad: 0x8d, 0x2ae: 0x0e, 0x2af: 0x0e, + 0x2b0: 0x0e, 0x2b1: 0x0e, 0x2b2: 0x0e, 0x2b3: 0x0e, 0x2b4: 0x8e, 0x2b5: 0x0e, 0x2b6: 0x0e, 0x2b7: 0x8f, + 0x2b8: 0x90, 0x2b9: 0x91, 0x2ba: 0x0e, 0x2bb: 0x92, 0x2bc: 0x93, 0x2bd: 0x94, 0x2bf: 0x95, + // Block 0xb, offset 0x2c0 + 0x2c4: 0x96, 0x2c5: 0x54, 0x2c6: 0x97, 0x2c7: 0x98, + 0x2cb: 0x99, 0x2cd: 0x9a, + 0x2e0: 0x9b, 0x2e1: 0x9b, 0x2e2: 0x9b, 0x2e3: 0x9b, 0x2e4: 0x9c, 0x2e5: 0x9b, 0x2e6: 0x9b, 0x2e7: 0x9b, + 0x2e8: 0x9d, 0x2e9: 0x9b, 0x2ea: 0x9b, 0x2eb: 0x9e, 0x2ec: 0x9f, 0x2ed: 0x9b, 0x2ee: 0x9b, 0x2ef: 0x9b, + 0x2f0: 0x9b, 0x2f1: 0x9b, 0x2f2: 0x9b, 0x2f3: 0x9b, 0x2f4: 0x9b, 0x2f5: 0x9b, 0x2f6: 0x9b, 0x2f7: 0x9b, + 0x2f8: 0x9b, 0x2f9: 0xa0, 0x2fa: 0x9b, 0x2fb: 0x9b, 0x2fc: 0x9b, 0x2fd: 0x9b, 0x2fe: 0x9b, 0x2ff: 0x9b, + // Block 0xc, offset 0x300 + 0x300: 0xa1, 0x301: 0xa2, 0x302: 0xa3, 0x304: 0xa4, 0x305: 0xa5, 0x306: 0xa6, 0x307: 0xa7, + 0x308: 0xa8, 0x30b: 0xa9, 0x30c: 0xaa, 0x30d: 0xab, + 0x310: 0xac, 0x311: 0xad, 0x312: 0xae, 0x313: 0xaf, 0x316: 0xb0, 0x317: 0xb1, + 0x318: 0xb2, 0x319: 0xb3, 0x31a: 0xb4, 0x31c: 0xb5, + 0x330: 0xb6, 0x332: 0xb7, + // Block 0xd, offset 0x340 + 0x36b: 0xb8, 0x36c: 0xb9, + 0x37e: 0xba, + // Block 0xe, offset 0x380 + 0x3b2: 0xbb, + // Block 0xf, offset 0x3c0 + 0x3c5: 0xbc, 0x3c6: 0xbd, + 0x3c8: 0x54, 0x3c9: 0xbe, 0x3cc: 0x54, 0x3cd: 0xbf, + 0x3db: 0xc0, 0x3dc: 0xc1, 0x3dd: 0xc2, 0x3de: 0xc3, 0x3df: 0xc4, + 0x3e8: 0xc5, 0x3e9: 0xc6, 0x3ea: 0xc7, + // Block 0x10, offset 0x400 + 0x400: 0xc8, + 0x420: 0x9b, 0x421: 0x9b, 0x422: 0x9b, 0x423: 0xc9, 0x424: 0x9b, 0x425: 0xca, 0x426: 0x9b, 0x427: 0x9b, + 0x428: 0x9b, 0x429: 0x9b, 0x42a: 0x9b, 0x42b: 0x9b, 0x42c: 0x9b, 0x42d: 0x9b, 0x42e: 0x9b, 0x42f: 0x9b, + 0x430: 0x9b, 0x431: 0x9b, 0x432: 0x9b, 0x433: 0x9b, 0x434: 0x9b, 0x435: 0x9b, 0x436: 0x9b, 0x437: 0x9b, + 0x438: 0x0e, 0x439: 0x0e, 0x43a: 0x0e, 0x43b: 0xcb, 0x43c: 0x9b, 0x43d: 0x9b, 0x43e: 0x9b, 0x43f: 0x9b, + // Block 0x11, offset 0x440 + 0x440: 0xcc, 0x441: 0x54, 0x442: 0xcd, 0x443: 0xce, 0x444: 0xcf, 0x445: 0xd0, + 0x44c: 0x54, 0x44d: 0x54, 0x44e: 0x54, 0x44f: 0x54, + 0x450: 0x54, 0x451: 0x54, 0x452: 0x54, 0x453: 0x54, 0x454: 0x54, 0x455: 0x54, 0x456: 0x54, 0x457: 0x54, + 0x458: 0x54, 0x459: 0x54, 0x45a: 0x54, 0x45b: 0xd1, 0x45c: 0x54, 0x45d: 0x6c, 0x45e: 0x54, 0x45f: 0xd2, + 0x460: 0xd3, 0x461: 0xd4, 0x462: 0xd5, 0x464: 0xd6, 0x465: 0xd7, 0x466: 0xd8, 0x467: 0x36, + 0x47f: 0xd9, + // Block 0x12, offset 0x480 + 0x4bf: 0xd9, + // Block 0x13, offset 0x4c0 + 0x4d0: 0x09, 0x4d1: 0x0a, 0x4d6: 0x0b, + 0x4db: 0x0c, 0x4dd: 0x0d, 0x4de: 0x0e, 0x4df: 0x0f, + 0x4ef: 0x10, + 0x4ff: 0x10, + // Block 0x14, offset 0x500 + 0x50f: 0x10, + 0x51f: 0x10, + 0x52f: 0x10, + 0x53f: 0x10, + // Block 0x15, offset 0x540 + 0x540: 0xda, 0x541: 0xda, 0x542: 0xda, 0x543: 0xda, 0x544: 0x05, 0x545: 0x05, 0x546: 0x05, 0x547: 0xdb, + 0x548: 0xda, 0x549: 0xda, 0x54a: 0xda, 0x54b: 0xda, 0x54c: 0xda, 0x54d: 0xda, 0x54e: 0xda, 0x54f: 0xda, + 0x550: 0xda, 0x551: 0xda, 0x552: 0xda, 0x553: 0xda, 0x554: 0xda, 0x555: 0xda, 0x556: 0xda, 0x557: 0xda, + 0x558: 0xda, 0x559: 0xda, 0x55a: 0xda, 0x55b: 0xda, 0x55c: 0xda, 0x55d: 0xda, 0x55e: 0xda, 0x55f: 0xda, + 0x560: 0xda, 0x561: 0xda, 0x562: 0xda, 0x563: 0xda, 0x564: 0xda, 0x565: 0xda, 0x566: 0xda, 0x567: 0xda, + 0x568: 0xda, 0x569: 0xda, 0x56a: 0xda, 0x56b: 0xda, 0x56c: 0xda, 0x56d: 0xda, 0x56e: 0xda, 0x56f: 0xda, + 0x570: 0xda, 0x571: 0xda, 0x572: 0xda, 0x573: 0xda, 0x574: 0xda, 0x575: 0xda, 0x576: 0xda, 0x577: 0xda, + 0x578: 0xda, 0x579: 0xda, 0x57a: 0xda, 0x57b: 0xda, 0x57c: 0xda, 0x57d: 0xda, 0x57e: 0xda, 0x57f: 0xda, + // Block 0x16, offset 0x580 + 0x58f: 0x10, + 0x59f: 0x10, + 0x5a0: 0x13, + 0x5af: 0x10, + 0x5bf: 0x10, + // Block 0x17, offset 0x5c0 + 0x5cf: 0x10, +} + +// Total table size 15800 bytes (15KiB); checksum: F50EF68C diff --git a/vendor/golang.org/x/text/unicode/bidi/trieval.go b/vendor/golang.org/x/text/unicode/bidi/trieval.go new file mode 100644 index 000000000..bebd855ef --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/trieval.go @@ -0,0 +1,60 @@ +// This file was generated by go generate; DO NOT EDIT + +package bidi + +// Class is the Unicode BiDi class. Each rune has a single class. +type Class uint + +const ( + L Class = iota // LeftToRight + R // RightToLeft + EN // EuropeanNumber + ES // EuropeanSeparator + ET // EuropeanTerminator + AN // ArabicNumber + CS // CommonSeparator + B // ParagraphSeparator + S // SegmentSeparator + WS // WhiteSpace + ON // OtherNeutral + BN // BoundaryNeutral + NSM // NonspacingMark + AL // ArabicLetter + Control // Control LRO - PDI + + numClass + + LRO // LeftToRightOverride + RLO // RightToLeftOverride + LRE // LeftToRightEmbedding + RLE // RightToLeftEmbedding + PDF // PopDirectionalFormat + LRI // LeftToRightIsolate + RLI // RightToLeftIsolate + FSI // FirstStrongIsolate + PDI // PopDirectionalIsolate + + unknownClass = ^Class(0) +) + +var controlToClass = map[rune]Class{ + 0x202D: LRO, // LeftToRightOverride, + 0x202E: RLO, // RightToLeftOverride, + 0x202A: LRE, // LeftToRightEmbedding, + 0x202B: RLE, // RightToLeftEmbedding, + 0x202C: PDF, // PopDirectionalFormat, + 0x2066: LRI, // LeftToRightIsolate, + 0x2067: RLI, // RightToLeftIsolate, + 0x2068: FSI, // FirstStrongIsolate, + 0x2069: PDI, // PopDirectionalIsolate, +} + +// A trie entry has the following bits: +// 7..5 XOR mask for brackets +// 4 1: Bracket open, 0: Bracket close +// 3..0 Class type + +const ( + openMask = 0x10 + xorMaskShift = 5 +)